BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037A12

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57282.1|  POZ/BTB containing protein                             338   1e-109   Ipomoea nil [qian niu]
gb|KDO86374.1|  hypothetical protein CISIN_1g008916mg                   328   4e-108   Citrus sinensis [apfelsine]
gb|KDO86375.1|  hypothetical protein CISIN_1g008916mg                   327   5e-108   Citrus sinensis [apfelsine]
gb|KDO86372.1|  hypothetical protein CISIN_1g008916mg                   328   1e-107   Citrus sinensis [apfelsine]
gb|KDO86371.1|  hypothetical protein CISIN_1g008916mg                   328   7e-107   Citrus sinensis [apfelsine]
ref|XP_007135185.1|  hypothetical protein PHAVU_010G108100g             330   2e-106   Phaseolus vulgaris [French bean]
ref|XP_008348526.1|  PREDICTED: BTB/POZ domain-containing protein...    329   5e-106   
ref|XP_008357345.1|  PREDICTED: BTB/POZ domain-containing protein...    328   7e-106   
gb|AGV54323.1|  BTB/POZ domain-containing protein POB1-like protein     328   8e-106   Phaseolus vulgaris [French bean]
ref|XP_011023241.1|  PREDICTED: BTB/POZ domain-containing protein...    328   1e-105   Populus euphratica
ref|XP_008233229.1|  PREDICTED: BTB/POZ domain-containing protein...    328   2e-105   Prunus mume [ume]
gb|KHN27269.1|  BTB/POZ domain-containing protein POB1                  326   2e-105   Glycine soja [wild soybean]
gb|KDO86370.1|  hypothetical protein CISIN_1g008916mg                   326   2e-105   Citrus sinensis [apfelsine]
ref|XP_007218966.1|  hypothetical protein PRUPE_ppa003673mg             327   2e-105   
ref|XP_006444905.1|  hypothetical protein CICLE_v10019570mg             327   2e-105   Citrus clementina [clementine]
ref|XP_006444906.1|  hypothetical protein CICLE_v10019570mg             327   2e-105   
gb|KHN15978.1|  BTB/POZ domain-containing protein POB1                  327   3e-105   Glycine soja [wild soybean]
ref|XP_003548592.1|  PREDICTED: BTB/POZ domain-containing protein...    327   3e-105   Glycine max [soybeans]
ref|XP_002511951.1|  atpob1, putative                                   326   4e-105   Ricinus communis
ref|XP_003528818.1|  PREDICTED: BTB/POZ domain-containing protein...    326   4e-105   Glycine max [soybeans]
ref|XP_009625070.1|  PREDICTED: BTB/POZ domain-containing protein...    326   4e-105   Nicotiana tomentosiformis
gb|EYU38917.1|  hypothetical protein MIMGU_mgv1a0037492mg               317   5e-105   Erythranthe guttata [common monkey flower]
ref|XP_006339663.1|  PREDICTED: BTB/POZ domain-containing protein...    326   5e-105   Solanum tuberosum [potatoes]
ref|XP_007135186.1|  hypothetical protein PHAVU_010G108200g             326   5e-105   Phaseolus vulgaris [French bean]
ref|XP_009625060.1|  PREDICTED: BTB/POZ domain-containing protein...    326   5e-105   Nicotiana tomentosiformis
ref|XP_002301391.1|  BTB/POZ domain-containing family protein           326   5e-105   
ref|XP_010261456.1|  PREDICTED: BTB/POZ domain-containing protein...    322   6e-105   
gb|KHG17323.1|  BTB/POZ domain-containing POB1 -like protein            326   7e-105   Gossypium arboreum [tree cotton]
ref|XP_009377240.1|  PREDICTED: BTB/POZ domain-containing protein...    326   7e-105   Pyrus x bretschneideri [bai li]
ref|XP_011468961.1|  PREDICTED: BTB/POZ domain-containing protein...    326   7e-105   Fragaria vesca subsp. vesca
ref|XP_010251562.1|  PREDICTED: BTB/POZ domain-containing protein...    326   7e-105   Nelumbo nucifera [Indian lotus]
ref|XP_007051652.1|  POZ/BTB containin G-protein 1 isoform 5            320   8e-105   
ref|XP_010326766.1|  PREDICTED: BTB/POZ domain-containing protein...    325   8e-105   
gb|KJB41445.1|  hypothetical protein B456_007G104800                    325   9e-105   Gossypium raimondii
ref|XP_010251563.1|  PREDICTED: BTB/POZ domain-containing protein...    325   1e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010326760.1|  PREDICTED: BTB/POZ domain-containing protein...    325   1e-104   Solanum lycopersicum
ref|XP_009789090.1|  PREDICTED: BTB/POZ domain-containing protein...    325   2e-104   Nicotiana sylvestris
emb|CDP08731.1|  unnamed protein product                                325   2e-104   Coffea canephora [robusta coffee]
gb|KJB49507.1|  hypothetical protein B456_008G122900                    325   2e-104   Gossypium raimondii
ref|XP_007051651.1|  POZ/BTB containin G-protein 1 isoform 4            320   2e-104   
ref|XP_009789089.1|  PREDICTED: BTB/POZ domain-containing protein...    324   3e-104   Nicotiana sylvestris
gb|ACQ59090.1|  BTB/POZ protein                                         323   5e-104   Nicotiana benthamiana
ref|XP_011093267.1|  PREDICTED: BTB/POZ domain-containing protein...    323   7e-104   Sesamum indicum [beniseed]
ref|XP_011093257.1|  PREDICTED: BTB/POZ domain-containing protein...    323   8e-104   
ref|XP_007051649.1|  POZ/BTB containin G-protein 1 isoform 2            320   9e-104   
gb|KHG04846.1|  BTB/POZ domain-containing POB1 -like protein            322   1e-103   Gossypium arboreum [tree cotton]
gb|ADN34171.1|  ATPOB protein binding                                   322   1e-103   Cucumis melo subsp. melo
ref|XP_008437944.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-103   Cucumis melo [Oriental melon]
ref|XP_004133826.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-103   Cucumis sativus [cucumbers]
ref|XP_002320175.2|  BTB/POZ domain-containing family protein           322   2e-103   
ref|XP_010261454.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-103   Nelumbo nucifera [Indian lotus]
ref|XP_010261455.1|  PREDICTED: BTB/POZ domain-containing protein...    321   3e-103   Nelumbo nucifera [Indian lotus]
ref|XP_009772583.1|  PREDICTED: BTB/POZ domain-containing protein...    321   3e-103   Nicotiana sylvestris
ref|XP_007051650.1|  POZ/BTB containin G-protein 1 isoform 3            319   3e-103   
ref|XP_011037494.1|  PREDICTED: BTB/POZ domain-containing protein...    322   3e-103   Populus euphratica
ref|XP_010669540.1|  PREDICTED: BTB/POZ domain-containing protein...    321   4e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW78131.1|  hypothetical protein EUGRSUZ_D02337                     319   4e-103   Eucalyptus grandis [rose gum]
ref|XP_010544783.1|  PREDICTED: BTB/POZ domain-containing protein...    321   5e-103   Tarenaya hassleriana [spider flower]
ref|XP_009614366.1|  PREDICTED: BTB/POZ domain-containing protein...    320   5e-103   Nicotiana tomentosiformis
emb|CBI40464.3|  unnamed protein product                                319   6e-103   Vitis vinifera
ref|XP_009614365.1|  PREDICTED: BTB/POZ domain-containing protein...    320   7e-103   Nicotiana tomentosiformis
ref|XP_007051653.1|  POZ/BTB containin G-protein 1 isoform 6            319   1e-102   
ref|XP_004138466.1|  PREDICTED: BTB/POZ domain-containing protein...    320   1e-102   Cucumis sativus [cucumbers]
ref|XP_004138465.1|  PREDICTED: BTB/POZ domain-containing protein...    320   2e-102   
ref|XP_010661871.1|  PREDICTED: BTB/POZ domain-containing protein...    319   2e-102   Vitis vinifera
ref|XP_002279915.1|  PREDICTED: BTB/POZ domain-containing protein...    319   2e-102   Vitis vinifera
ref|XP_010053775.1|  PREDICTED: BTB/POZ domain-containing protein...    319   3e-102   Eucalyptus grandis [rose gum]
ref|XP_008458155.1|  PREDICTED: BTB/POZ domain-containing protein...    319   3e-102   Cucumis melo [Oriental melon]
gb|EYU32197.1|  hypothetical protein MIMGU_mgv1a003926mg                318   4e-102   Erythranthe guttata [common monkey flower]
ref|XP_007040414.1|  POZ/BTB containin G-protein 1 isoform 3            315   5e-102   
ref|XP_007040413.1|  POZ/BTB containin G-protein 1 isoform 2            315   6e-102   
ref|XP_007051648.1|  POZ/BTB containin G-protein 1 isoform 1            318   6e-102   
emb|CAN63457.1|  hypothetical protein VITISV_008241                     317   1e-101   Vitis vinifera
ref|XP_010092900.1|  BTB/POZ domain-containing protein                  317   1e-101   Morus notabilis
gb|KDP25348.1|  hypothetical protein JCGZ_20504                         318   1e-101   Jatropha curcas
gb|KDP28535.1|  hypothetical protein JCGZ_14306                         317   1e-101   Jatropha curcas
ref|XP_010658715.1|  PREDICTED: BTB/POZ domain-containing protein...    318   1e-101   Vitis vinifera
ref|XP_009626291.1|  PREDICTED: BTB/POZ domain-containing protein...    317   1e-101   Nicotiana tomentosiformis
ref|XP_003554745.1|  PREDICTED: BTB/POZ domain-containing protein...    317   1e-101   Glycine max [soybeans]
gb|KDO76413.1|  hypothetical protein CISIN_1g007950mg                   312   2e-101   Citrus sinensis [apfelsine]
ref|XP_007040415.1|  POZ/BTB containin G-protein 1 isoform 4            314   2e-101   
ref|XP_003637208.1|  Kelch-like protein                                 316   5e-101   
ref|XP_006358650.1|  PREDICTED: BTB/POZ domain-containing protein...    316   5e-101   Solanum tuberosum [potatoes]
gb|KEH18742.1|  BTB/POZ domain protein POB1                             316   6e-101   Medicago truncatula
ref|XP_011093067.1|  PREDICTED: BTB/POZ domain-containing protein...    313   8e-101   Sesamum indicum [beniseed]
ref|XP_003521793.1|  PREDICTED: BTB/POZ domain-containing protein...    315   1e-100   Glycine max [soybeans]
ref|XP_004510713.1|  PREDICTED: BTB/POZ domain-containing protein...    315   1e-100   Cicer arietinum [garbanzo]
ref|XP_003637209.1|  Kelch-like protein                                 316   2e-100   
ref|XP_010522934.1|  PREDICTED: BTB/POZ domain-containing protein...    314   2e-100   Tarenaya hassleriana [spider flower]
ref|XP_004248069.1|  PREDICTED: BTB/POZ domain-containing protein...    314   2e-100   Solanum lycopersicum
ref|XP_007040412.1|  POZ/BTB containin G-protein 1 isoform 1            315   2e-100   Theobroma cacao [chocolate]
ref|XP_007147261.1|  hypothetical protein PHAVU_006G109600g             314   2e-100   Phaseolus vulgaris [French bean]
ref|XP_006439420.1|  hypothetical protein CICLE_v10019554mg             312   2e-100   
gb|KJB22359.1|  hypothetical protein B456_004G043000                    309   2e-100   Gossypium raimondii
ref|XP_010522933.1|  PREDICTED: BTB/POZ domain-containing protein...    314   2e-100   Tarenaya hassleriana [spider flower]
gb|KHN35353.1|  BTB/POZ domain-containing protein POB1                  314   3e-100   Glycine soja [wild soybean]
ref|XP_010522935.1|  PREDICTED: BTB/POZ domain-containing protein...    313   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_010326992.1|  PREDICTED: BTB/POZ domain-containing protein...    314   3e-100   Solanum lycopersicum
gb|KDO76412.1|  hypothetical protein CISIN_1g007950mg                   312   4e-100   Citrus sinensis [apfelsine]
ref|XP_011093066.1|  PREDICTED: BTB/POZ domain-containing protein...    313   4e-100   Sesamum indicum [beniseed]
gb|AFK39130.1|  unknown                                                 313   6e-100   Lotus japonicus
ref|XP_011093065.1|  PREDICTED: BTB/POZ domain-containing protein...    313   6e-100   Sesamum indicum [beniseed]
gb|KJB52233.1|  hypothetical protein B456_008G251700                    313   9e-100   Gossypium raimondii
dbj|BAD94357.1|  hypothetical protein                                   305   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104326.1|  PREDICTED: BTB/POZ domain-containing protein...    312   1e-99    Brassica rapa
gb|KDO76410.1|  hypothetical protein CISIN_1g007950mg                   312   2e-99    Citrus sinensis [apfelsine]
ref|XP_010053177.1|  PREDICTED: BTB/POZ domain-containing protein...    313   2e-99    
ref|XP_009104323.1|  PREDICTED: BTB/POZ domain-containing protein...    312   2e-99    Brassica rapa
ref|XP_010469102.1|  PREDICTED: BTB/POZ domain-containing protein...    311   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009104327.1|  PREDICTED: BTB/POZ domain-containing protein...    312   2e-99    Brassica rapa
emb|CDY52008.1|  BnaC06g42880D                                          312   2e-99    Brassica napus [oilseed rape]
ref|XP_006476450.1|  PREDICTED: BTB/POZ domain-containing protein...    312   2e-99    Citrus sinensis [apfelsine]
ref|XP_009104325.1|  PREDICTED: BTB/POZ domain-containing protein...    312   2e-99    Brassica rapa
ref|XP_006439421.1|  hypothetical protein CICLE_v10019554mg             312   2e-99    Citrus clementina [clementine]
gb|KJB52235.1|  hypothetical protein B456_008G251700                    312   2e-99    Gossypium raimondii
ref|XP_006293933.1|  hypothetical protein CARUB_v10022924mg             308   2e-99    
ref|XP_010512512.1|  PREDICTED: BTB/POZ domain-containing protein...    312   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010413379.1|  PREDICTED: BTB/POZ domain-containing protein...    312   3e-99    Camelina sativa [gold-of-pleasure]
gb|KJB22358.1|  hypothetical protein B456_004G043000                    308   3e-99    Gossypium raimondii
gb|KDO76409.1|  hypothetical protein CISIN_1g007950mg                   311   5e-99    Citrus sinensis [apfelsine]
ref|XP_004494778.1|  PREDICTED: BTB/POZ domain-containing protein...    311   5e-99    Cicer arietinum [garbanzo]
gb|KDO76407.1|  hypothetical protein CISIN_1g007950mg                   311   5e-99    Citrus sinensis [apfelsine]
ref|XP_006402465.1|  hypothetical protein EUTSA_v10005840mg             312   6e-99    Eutrema salsugineum [saltwater cress]
ref|XP_006402466.1|  hypothetical protein EUTSA_v10005840mg             312   6e-99    Eutrema salsugineum [saltwater cress]
ref|XP_009617879.1|  PREDICTED: BTB/POZ domain-containing protein...    310   8e-99    Nicotiana tomentosiformis
ref|XP_010469101.1|  PREDICTED: BTB/POZ domain-containing protein...    310   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_011073542.1|  PREDICTED: BTB/POZ domain-containing protein...    310   1e-98    Sesamum indicum [beniseed]
ref|XP_010469099.1|  PREDICTED: BTB/POZ domain-containing protein...    310   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009789895.1|  PREDICTED: BTB/POZ domain-containing protein...    310   1e-98    Nicotiana sylvestris
ref|XP_006290834.1|  hypothetical protein CARUB_v10016944mg             309   2e-98    Capsella rubella
ref|XP_006293934.1|  hypothetical protein CARUB_v10022924mg             308   4e-98    Capsella rubella
gb|KHG04418.1|  BTB/POZ domain-containing POB1 -like protein            308   5e-98    Gossypium arboreum [tree cotton]
emb|CAB71090.1|  putative protein                                       307   7e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850733.1|  POZ/BTB containin G-protein 1                         308   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567115.1|  POZ/BTB containin G-protein 1                         308   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876624.1|  BTB/POZ domain-containing protein                  307   1e-97    
ref|XP_010518296.1|  PREDICTED: BTB/POZ domain-containing protein...    307   2e-97    Camelina sativa [gold-of-pleasure]
gb|KJB22357.1|  hypothetical protein B456_004G043000                    306   2e-97    Gossypium raimondii
gb|AAM61110.1|  unknown                                                 306   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566069.1|  protein LIGHT-RESPONSE BTB 1                          306   4e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KFK35343.1|  hypothetical protein AALP_AA5G272300                    305   8e-97    Arabis alpina [alpine rockcress]
gb|KFK35342.1|  hypothetical protein AALP_AA5G272300                    305   9e-97    Arabis alpina [alpine rockcress]
ref|XP_009772687.1|  PREDICTED: BTB/POZ domain-containing protein...    305   1e-96    Nicotiana sylvestris
ref|XP_010506624.1|  PREDICTED: BTB/POZ domain-containing protein...    305   1e-96    Camelina sativa [gold-of-pleasure]
emb|CDX95684.1|  BnaC03g25650D                                          304   1e-96    
ref|XP_011022567.1|  PREDICTED: BTB/POZ domain-containing protein...    305   2e-96    Populus euphratica
gb|EYU40044.1|  hypothetical protein MIMGU_mgv1a004127mg                304   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_002303620.1|  hypothetical protein POPTR_0003s13510g             304   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010506625.1|  PREDICTED: BTB/POZ domain-containing protein...    304   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_009133768.1|  PREDICTED: BTB/POZ domain-containing protein...    304   2e-96    Brassica rapa
emb|CDX83375.1|  BnaA03g21310D                                          304   2e-96    
gb|KJB39679.1|  hypothetical protein B456_007G025100                    303   5e-96    Gossypium raimondii
ref|XP_010925791.1|  PREDICTED: BTB/POZ domain-containing protein...    301   7e-96    Elaeis guineensis
ref|XP_010508047.1|  PREDICTED: BTB/POZ domain-containing protein...    303   9e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010925790.1|  PREDICTED: BTB/POZ domain-containing protein...    301   2e-95    Elaeis guineensis
ref|XP_002880228.1|  BTB/POZ domain-containing protein                  301   3e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_006842894.1|  hypothetical protein AMTR_s00075p00054260          291   5e-95    
ref|XP_010676365.1|  PREDICTED: BTB/POZ domain-containing protein...    300   6e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006397812.1|  hypothetical protein EUTSA_v10001385mg             299   6e-95    
ref|XP_006397813.1|  hypothetical protein EUTSA_v10001385mg             300   6e-95    Eutrema salsugineum [saltwater cress]
ref|XP_006360698.1|  PREDICTED: BTB/POZ domain-containing protein...    299   2e-94    
gb|KHG30067.1|  BTB/POZ domain-containing POB1 -like protein            297   1e-93    Gossypium arboreum [tree cotton]
ref|XP_002299499.2|  hypothetical protein POPTR_0001s10190g             297   1e-93    
ref|XP_009410864.1|  PREDICTED: BTB/POZ domain-containing protein...    295   3e-93    
ref|XP_010914379.1|  PREDICTED: BTB/POZ domain-containing protein...    295   4e-93    Elaeis guineensis
ref|XP_011026946.1|  PREDICTED: BTB/POZ domain-containing protein...    294   4e-93    Populus euphratica
ref|XP_009410863.1|  PREDICTED: BTB/POZ domain-containing protein...    295   6e-93    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX71727.1|  BnaC08g31470D                                          295   6e-93    
ref|XP_008793877.1|  PREDICTED: BTB/POZ domain-containing protein...    295   7e-93    Phoenix dactylifera
ref|XP_011026945.1|  PREDICTED: BTB/POZ domain-containing protein...    293   4e-92    Populus euphratica
ref|XP_009142670.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    291   3e-91    Brassica rapa
ref|XP_008798670.1|  PREDICTED: BTB/POZ domain-containing protein...    290   4e-91    Phoenix dactylifera
ref|XP_009419784.1|  PREDICTED: BTB/POZ domain-containing protein...    290   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419783.1|  PREDICTED: BTB/POZ domain-containing protein...    290   6e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380541.1|  PREDICTED: BTB/POZ domain-containing protein...    290   8e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380540.1|  PREDICTED: BTB/POZ domain-containing protein...    289   1e-90    
ref|XP_009380539.1|  PREDICTED: BTB/POZ domain-containing protein...    290   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380538.1|  PREDICTED: BTB/POZ domain-containing protein...    290   1e-90    
ref|XP_006343902.1|  PREDICTED: BTB/POZ domain-containing protein...    288   3e-90    Solanum tuberosum [potatoes]
ref|XP_008238990.1|  PREDICTED: BTB/POZ domain-containing protein...    288   4e-90    Prunus mume [ume]
ref|NP_001142262.1|  uncharacterized protein LOC100274431               287   5e-90    Zea mays [maize]
dbj|BAJ92080.1|  predicted protein                                      278   1e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01214.1|  predicted protein                                      280   1e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951268.1|  PREDICTED: BTB/POZ domain-containing protein...    285   3e-89    Setaria italica
ref|XP_004951269.1|  PREDICTED: BTB/POZ domain-containing protein...    285   3e-89    Setaria italica
gb|ABR16891.1|  unknown                                                 282   3e-89    Picea sitchensis
ref|XP_010915728.1|  PREDICTED: BTB/POZ domain-containing protein...    285   3e-89    Elaeis guineensis
ref|NP_001046484.1|  Os02g0260700                                       285   3e-89    
gb|EPS73437.1|  hypothetical protein M569_01319                         283   3e-89    Genlisea aurea
gb|EEC72875.1|  hypothetical protein OsI_06647                          285   4e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_003572201.1|  PREDICTED: BTB/POZ domain-containing protein...    285   4e-89    Brachypodium distachyon [annual false brome]
ref|XP_008392473.1|  PREDICTED: BTB/POZ domain-containing protein...    285   4e-89    Malus domestica [apple tree]
ref|XP_007209857.1|  hypothetical protein PRUPE_ppa003692mg             284   1e-88    Prunus persica
ref|XP_002451902.1|  hypothetical protein SORBIDRAFT_04g009720          283   1e-88    Sorghum bicolor [broomcorn]
ref|XP_006648521.1|  PREDICTED: BTB/POZ domain-containing protein...    282   1e-88    Oryza brachyantha
ref|XP_009789894.1|  PREDICTED: BTB/POZ domain-containing protein...    284   2e-88    Nicotiana sylvestris
gb|EMS60606.1|  BTB/POZ domain-containing protein POB1                  279   4e-88    Triticum urartu
ref|XP_002438463.1|  hypothetical protein SORBIDRAFT_10g020060          282   4e-88    Sorghum bicolor [broomcorn]
ref|XP_004965490.1|  PREDICTED: BTB/POZ domain-containing protein...    282   4e-88    Setaria italica
ref|XP_008794992.1|  PREDICTED: BTB/POZ domain-containing protein...    283   5e-88    Phoenix dactylifera
ref|XP_004965489.1|  PREDICTED: BTB/POZ domain-containing protein...    282   6e-88    Setaria italica
ref|XP_008794993.1|  PREDICTED: BTB/POZ domain-containing protein...    282   7e-88    
gb|ABK24446.1|  unknown                                                 282   9e-88    Picea sitchensis
ref|NP_001057726.2|  Os06g0507400                                       280   2e-87    
ref|XP_008677104.1|  PREDICTED: uncharacterized protein LOC100279...    279   2e-87    Zea mays [maize]
dbj|BAJ95490.1|  predicted protein                                      280   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563816.1|  PREDICTED: BTB/POZ domain-containing protein...    280   4e-87    Brachypodium distachyon [annual false brome]
gb|AFW65829.1|  hypothetical protein ZEAMMB73_711899                    279   5e-87    
gb|EMT31790.1|  Kelch-like protein 26                                   280   5e-87    
gb|AIB05667.1|  TRAF transcription factor                               278   1e-86    Zea mays [maize]
ref|NP_001146028.1|  hypothetical protein                               278   1e-86    Zea mays [maize]
gb|ACN26008.1|  unknown                                                 278   1e-86    Zea mays [maize]
dbj|BAJ93322.1|  predicted protein                                      278   1e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001148937.1|  GAMYB-binding protein                              278   2e-86    Zea mays [maize]
gb|EPS68073.1|  hypothetical protein M569_06692                         278   3e-86    Genlisea aurea
gb|EMT31791.1|  hypothetical protein F775_32011                         280   5e-86    
gb|AAT40121.1|  GAMYB-binding protein                                   277   7e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004298859.1|  PREDICTED: BTB/POZ domain-containing protein...    276   7e-86    Fragaria vesca subsp. vesca
ref|XP_011463940.1|  PREDICTED: BTB/POZ domain-containing protein...    276   7e-86    Fragaria vesca subsp. vesca
emb|CAD23158.1|  hypothetical protein                                   263   9e-86    Oryza sativa [red rice]
ref|XP_006656117.1|  PREDICTED: BTB/POZ domain-containing protein...    276   1e-85    
ref|XP_009116827.1|  PREDICTED: BTB/POZ domain-containing protein...    275   2e-85    Brassica rapa
emb|CDY11366.1|  BnaA09g39320D                                          274   6e-85    Brassica napus [oilseed rape]
gb|EPS71516.1|  hypothetical protein M569_03239                         273   3e-84    Genlisea aurea
emb|CDP12109.1|  unnamed protein product                                267   7e-80    Coffea canephora [robusta coffee]
gb|KHN35061.1|  BTB/POZ domain-containing protein POB1                  253   1e-77    Glycine soja [wild soybean]
ref|XP_001771535.1|  predicted protein                                  253   4e-77    
ref|XP_006590500.1|  PREDICTED: BTB/POZ domain-containing protein...    253   5e-77    Glycine max [soybeans]
ref|XP_001760430.1|  predicted protein                                  253   9e-77    
emb|CDY42028.1|  BnaC04g01060D                                          249   8e-76    Brassica napus [oilseed rape]
emb|CDX80003.1|  BnaA05g01530D                                          249   1e-75    
ref|XP_010314497.1|  PREDICTED: BTB/POZ domain-containing protein...    246   2e-74    Solanum lycopersicum
ref|XP_004252576.1|  PREDICTED: BTB/POZ domain-containing protein...    247   2e-74    Solanum lycopersicum
ref|XP_010314496.1|  PREDICTED: BTB/POZ domain-containing protein...    247   2e-74    Solanum lycopersicum
ref|XP_002961299.1|  ubiquitin-protein ligase, POB1                     240   6e-72    
ref|XP_002983257.1|  ubiquitin-protein ligase, POB1                     240   6e-72    
gb|AAO25541.1|  GAMYB-binding protein                                   228   8e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK44513.1|  unknown                                                 224   1e-69    Lotus japonicus
gb|AFK40268.1|  unknown                                                 219   6e-68    Lotus japonicus
ref|NP_192025.2|  BTB/POZ/Kelch-associated protein                      224   3e-66    Arabidopsis thaliana [mouse-ear cress]
sp|O04615.1|Y4116_ARATH  RecName: Full=BTB/POZ domain-containing ...    224   4e-66    Arabidopsis thaliana [mouse-ear cress]
gb|AFK33622.1|  unknown                                                 221   5e-66    Lotus japonicus
ref|XP_002872906.1|  A_IG002N01.11 protein                              222   3e-65    
ref|XP_006396293.1|  hypothetical protein EUTSA_v10028626mg             219   2e-64    
ref|XP_010466718.1|  PREDICTED: BTB/POZ domain-containing protein...    218   2e-63    Camelina sativa [gold-of-pleasure]
gb|ADG38652.1|  AT3G61600-like protein                                  205   1e-62    Neslia paniculata [ball mustard]
gb|KJB52236.1|  hypothetical protein B456_008G251700                    214   3e-62    Gossypium raimondii
emb|CDX91882.1|  BnaC03g31840D                                          213   3e-62    
ref|XP_006343901.1|  PREDICTED: BTB/POZ domain-containing protein...    212   9e-62    
gb|AEN82266.1|  AT3G61600-like protein                                  202   1e-61    Capsella rubella
gb|ADG38648.1|  AT3G61600-like protein                                  202   1e-61    Capsella grandiflora
gb|ADG38647.1|  AT3G61600-like protein                                  201   2e-61    Capsella grandiflora
ref|XP_007158553.1|  hypothetical protein PHAVU_002G162000g             211   5e-61    Phaseolus vulgaris [French bean]
ref|XP_006344016.1|  PREDICTED: BTB/POZ domain-containing protein...    209   8e-61    Solanum tuberosum [potatoes]
ref|XP_006289543.1|  hypothetical protein CARUB_v10003087mg             209   2e-60    
ref|XP_010456218.1|  PREDICTED: BTB/POZ domain-containing protein...    209   2e-60    Camelina sativa [gold-of-pleasure]
ref|XP_009134517.1|  PREDICTED: BTB/POZ domain-containing protein...    204   7e-59    Brassica rapa
emb|CDX74359.1|  BnaA03g26880D                                          204   7e-59    
gb|KFK30704.1|  hypothetical protein AALP_AA6G016900                    190   3e-53    Arabis alpina [alpine rockcress]
ref|XP_011081133.1|  PREDICTED: BTB/POZ domain-containing protein...    187   8e-53    
gb|KFK30702.1|  hypothetical protein AALP_AA6G016600                    187   5e-52    Arabis alpina [alpine rockcress]
ref|XP_006830391.1|  hypothetical protein AMTR_s00116p00144040          174   2e-49    
ref|XP_006657001.1|  PREDICTED: BTB/POZ domain-containing protein...    166   4e-47    Oryza brachyantha
gb|EMT11867.1|  Kelch-like protein 17                                   168   3e-45    
ref|NP_001057725.1|  Os06g0507300                                       156   2e-43    
emb|CDM81892.1|  unnamed protein product                                156   3e-41    Triticum aestivum [Canadian hard winter wheat]
gb|AEW08883.1|  hypothetical protein CL2108Contig1_02                   144   3e-40    Pinus radiata
gb|EMT12351.1|  Kelch-like ECH-associated protein 1                     153   7e-40    
gb|EMT15015.1|  Kelch-like protein 10                                   149   2e-38    
gb|EMT27655.1|  Kelch repeat and BTB domain-containing protein 8        150   7e-38    
ref|XP_006830377.1|  hypothetical protein AMTR_s00116p00130490          142   3e-37    
gb|KFK40746.1|  hypothetical protein AALP_AA2G035800                    146   4e-37    Arabis alpina [alpine rockcress]
gb|KFK40747.1|  hypothetical protein AALP_AA2G035800                    146   5e-37    Arabis alpina [alpine rockcress]
ref|XP_006830375.1|  hypothetical protein AMTR_s00116p00129050          141   1e-36    
ref|XP_003576856.1|  PREDICTED: BTB/POZ domain-containing protein...    145   1e-36    Brachypodium distachyon [annual false brome]
gb|EMT00090.1|  Kelch-like protein 10                                   143   1e-36    
emb|CBI25638.3|  unnamed protein product                                138   1e-36    Vitis vinifera
ref|XP_003559205.2|  PREDICTED: BTB/POZ domain-containing protein...    144   2e-36    Brachypodium distachyon [annual false brome]
ref|XP_010240164.1|  PREDICTED: BTB/POZ domain-containing protein...    143   2e-36    
emb|CBI34431.3|  unnamed protein product                                144   3e-36    
gb|EMS51786.1|  BTB/POZ domain-containing protein POB1                  144   5e-36    
gb|AEW08881.1|  hypothetical protein CL2108Contig1_01                   131   4e-35    
gb|AEW08882.1|  hypothetical protein CL2108Contig1_01                   130   5e-35    
ref|XP_006830379.1|  hypothetical protein AMTR_s00116p00131680          136   6e-35    
dbj|BAK07029.1|  predicted protein                                      138   2e-34    
gb|KEH31004.1|  BTB/POZ domain protein                                  136   5e-34    
gb|EMS63662.1|  hypothetical protein TRIUR3_11934                       134   5e-34    
gb|EMS63660.1|  hypothetical protein TRIUR3_11932                       133   1e-32    
ref|XP_006830368.1|  hypothetical protein AMTR_s00116p00105540          130   1e-32    
gb|EMT24877.1|  Kelch repeat and BTB domain-containing protein 8        130   1e-31    
ref|XP_010239967.1|  PREDICTED: BTB/POZ domain-containing protein...    128   8e-31    
ref|XP_006854528.1|  hypothetical protein AMTR_s00030p00030100          124   1e-30    
ref|XP_010239944.1|  PREDICTED: BTB/POZ domain-containing protein...    128   1e-30    
ref|XP_010239873.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-30    
ref|XP_006844531.1|  hypothetical protein AMTR_s00016p00163270          117   8e-29    
gb|KFK30703.1|  hypothetical protein AALP_AA6G016700                    113   5e-28    
gb|EMT00482.1|  hypothetical protein F775_17303                         116   6e-27    
ref|XP_003559206.1|  PREDICTED: BTB/POZ domain-containing protein...    111   6e-25    
gb|EMT11871.1|  Kelch-like protein 17                                   109   6e-24    
gb|EMS61484.1|  BTB/POZ domain-containing protein POB1                97.1    5e-20    
gb|EMT13051.1|  Kelch-like protein 7                                  95.9    2e-19    
gb|EMT13053.1|  Kelch-like protein 7                                  92.4    2e-18    
ref|XP_006830384.1|  hypothetical protein AMTR_s00116p00138800        89.7    6e-18    
gb|EMT07019.1|  Kelch-like protein 17                                 84.7    9e-16    
gb|AEW08884.1|  hypothetical protein CL2108Contig1_03                 76.3    1e-14    
gb|EMT13052.1|  Kelch-like protein 7                                  82.0    1e-14    
gb|EMT15016.1|  BTB and MATH domain-containing protein 43             80.1    2e-14    
ref|XP_006830369.1|  hypothetical protein AMTR_s00116p00111830        79.3    2e-14    
gb|EMT15014.1|  hypothetical protein F775_21274                       78.2    8e-14    
gb|ABQ65191.1|  putative protein                                      72.8    2e-13    
gb|EMT08009.1|  Kelch domain-containing protein 6                     78.2    2e-13    
ref|XP_008798396.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    7e-13    
ref|XP_006830366.1|  hypothetical protein AMTR_s00116p00102270        67.8    2e-10    
ref|XP_008798400.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    2e-10    
ref|XP_008810439.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    2e-10    
ref|XP_006854779.1|  hypothetical protein AMTR_s00063p00125100        65.5    6e-10    
gb|EMS45083.1|  BTB/POZ domain-containing protein POB1                65.5    5e-09    
ref|XP_002509901.1|  atpob1, putative                                 63.2    4e-08    
gb|EMS49907.1|  BTB/POZ domain-containing protein POB1                60.5    2e-07    
gb|EMT11872.1|  hypothetical protein F775_22536                       56.2    5e-07    
emb|CBI29690.3|  unnamed protein product                              56.2    6e-06    
ref|XP_010908519.1|  PREDICTED: BTB/POZ domain-containing protein...  55.5    1e-05    



>dbj|BAO57282.1| POZ/BTB containing protein [Ipomoea nil]
Length=549

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA+ S+S S RFVER YKYRPIKV+EFE PRQQC+VYLDLKREEC+NLF
Sbjct  374  KAEAPHRQRTQAAEGSTSASRRFVERAYKYRPIKVVEFEVPRQQCIVYLDLKREECANLF  433

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  434  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  493

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLFG+ WTSFMADDSPYFINGILHLRAELTI+H
Sbjct  494  TEEYISKYKGNYTFTGGKAVGYRNLFGVQWTSFMADDSPYFINGILHLRAELTIRH  549



>gb|KDO86374.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=380

 Score =   328 bits (841),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  205  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  264

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  265  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  324

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  325  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  380



>gb|KDO86375.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=359

 Score =   327 bits (839),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  184  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  243

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  244  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  303

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  304  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  359



>gb|KDO86372.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
 gb|KDO86373.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=413

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  238  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  297

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  298  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  357

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  358  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  413



>gb|KDO86371.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=449

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  274  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  333

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  334  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  393

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  394  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  449



>ref|XP_007135185.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris]
 gb|ESW07179.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris]
Length=551

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+S +HRFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  376  KAEAPHRQRALAAEDSASSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  496  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  551



>ref|XP_008348526.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=556

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S + + RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NLF
Sbjct  381  KAEAPHRQRILAAEESGTLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  500

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEF+SKYKGNYTFTGGKAVGYRNLF I WTSFMADDSP+FING+LHLRAELTIK 
Sbjct  501  TEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSPFFINGVLHLRAELTIKQ  556



>ref|XP_008357345.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=556

 Score =   328 bits (842),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S++ + RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NLF
Sbjct  381  KAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  500

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEF+SKYKGNYTFTGGKAVGYRNLF I WTSF A+DSP+FING+LHLRAELTIKH
Sbjct  501  TEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFTAEDSPFFINGVLHLRAELTIKH  556



>gb|AGV54323.1| BTB/POZ domain-containing protein POB1-like protein [Phaseolus 
vulgaris]
Length=550

 Score =   328 bits (841),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+S +HRFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  375  KAEAPHRQRALAAEDSASSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  435  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  495  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  550



>ref|XP_011023241.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=553

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E  HRQR  AA++S++ + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  378  KGEPPHRQRTLAAEESATLNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ FYCFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFYCFGLFLGMQEKGSVSFAVDYEFAARSKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DSPYFING+LHLRAELTI+H
Sbjct  498  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSPYFINGVLHLRAELTIRH  553



>ref|XP_008233229.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Prunus mume]
Length=557

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S++ + RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NLF
Sbjct  382  KAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  501

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEF+SKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  502  TEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  557



>gb|KHN27269.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=502

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+D++S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  327  KAEAPHRQRSLAAEDTASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNLF  386

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  387  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  446

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTIKH
Sbjct  447  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIKH  502



>gb|KDO86370.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=517

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  342  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  401

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  402  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  461

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  462  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  517



>ref|XP_007218966.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica]
 gb|EMJ20165.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica]
Length=557

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S++ + RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NLF
Sbjct  382  KAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  501

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEF+SKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  502  TEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  557



>ref|XP_006444905.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 ref|XP_006491218.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus 
sinensis]
 gb|ESR58145.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 gb|KDO86369.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=549

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  374  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  433

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  434  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  493

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  494  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  549



>ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 gb|ESR58146.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
Length=550

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S + + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  375  KAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  435  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFINGILHLRAELTI+H
Sbjct  495  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIRH  550



>gb|KHN15978.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  378  KAEAPHRQRSLAAEDSASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTIKH
Sbjct  498  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIKH  553



>ref|XP_003548592.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=553

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  378  KAEAPHRQRSLAAEDSASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTIKH
Sbjct  498  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIKH  553



>ref|XP_002511951.1| atpob1, putative [Ricinus communis]
 gb|EEF50620.1| atpob1, putative [Ricinus communis]
Length=549

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  374  KAEAPHRQRSLAAEESASLNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  433

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  434  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGNVSFAVDYEFAARAKP  493

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFING+LHLRAELTI+H
Sbjct  494  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGVLHLRAELTIRH  549



>ref|XP_003528818.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=550

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+D++S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  375  KAEAPHRQRSLAAEDTASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  435  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTIKH
Sbjct  495  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIKH  550



>ref|XP_009625070.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=552

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PRQQC+VYLDLKR+EC+NLF
Sbjct  377  KAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  497  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  552



>gb|EYU38917.1| hypothetical protein MIMGU_mgv1a0037492mg, partial [Erythranthe 
guttata]
Length=275

 Score =   317 bits (812),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSS-SGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQR QA DDSS S S RFVER YKYRP+KVIEF+ PRQQCVVYLDLKREECSNL
Sbjct  95   KAEAPHRQRTQAIDDSSTSTSRRFVERAYKYRPVKVIEFDLPRQQCVVYLDLKREECSNL  154

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            +PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSK
Sbjct  155  YPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  214

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            P EE++SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFING+LHLRAELTIK
Sbjct  215  PLEEYISKYKGNYTFTGGKAVGYRNLFNIPWTSFVAEDSLYFINGVLHLRAELTIK  270



>ref|XP_006339663.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=552

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA+DSSS SHRFVER YKYRP+KV++F  PRQQCVVYLDLKREEC+NLF
Sbjct  377  KAEAPHRQRTQAAEDSSSTSHRFVERAYKYRPVKVVDFGLPRQQCVVYLDLKREECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAAR+KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSF+A+DSPYF NG+LHLRAELTIK
Sbjct  497  GEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK  551



>ref|XP_007135186.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris]
 gb|ESW07180.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris]
Length=550

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  375  KAEAPHRQRALAAEDSASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  435  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  495  TEEFVSKYKGNYMFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  550



>ref|XP_009625060.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=559

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PRQQC+VYLDLKR+EC+NLF
Sbjct  384  KAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANLF  443

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  444  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  503

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  504  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  559



>ref|XP_002301391.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE80664.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=556

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E  HRQR  AA++S++ + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  381  KGEPPHRQRTLAAEESATLNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  500

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DSPYFING+LHLRAELTI+H
Sbjct  501  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSPYFINGVLHLRAELTIRH  556



>ref|XP_010261456.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Nelumbo nucifera]
 ref|XP_010261457.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Nelumbo nucifera]
Length=433

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ S RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  258  KAEAPHRQRSLAAEESTAVSRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  317

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  318  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  377

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLF I WT+F+A+DS YFINGILHLRAELTIKH
Sbjct  378  TEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTAFVAEDSLYFINGILHLRAELTIKH  433



>gb|KHG17323.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=552

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  377  KAEAPHRQRSLAAEESASLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+H
Sbjct  497  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRH  552



>ref|XP_009377240.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Pyrus 
x bretschneideri]
Length=556

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S++ + RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NLF
Sbjct  381  KAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  500

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEF+SKYKGNYTFTGGKAVGYRNLF I WTSFMADDS +FING+LHLRAELTIK 
Sbjct  501  TEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIKQ  556



>ref|XP_011468961.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S + + RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NLF
Sbjct  383  KAEAPHRQRILAAEESGTLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANLF  442

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  443  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  502

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEF+SKYKGNYTFTGGKAVGYRNLF I WT+FMADDS YFING+LHLRAELTI+H
Sbjct  503  TEEFLSKYKGNYTFTGGKAVGYRNLFAIPWTNFMADDSLYFINGVLHLRAELTIRH  558



>ref|XP_010251562.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Nelumbo nucifera]
Length=553

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ +HRF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  378  KAEAPHRQRSLAAEESAATNHRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFINGILHLRAELTIKH
Sbjct  498  TEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIKH  553



>ref|XP_007051652.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao]
 gb|EOX95809.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao]
Length=380

 Score =   320 bits (820),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLK+EEC+NLF
Sbjct  205  KAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLF  264

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG +SFAVDYEFAARSKP
Sbjct  265  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKP  324

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+ 
Sbjct  325  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ  380



>ref|XP_010326766.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Solanum lycopersicum]
Length=552

 Score =   325 bits (834),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA+DSSS SHRFVER YKYRP+KV++F  PRQQCVVYLDLKREEC+NLF
Sbjct  377  KAEAPHRQRSQAAEDSSSTSHRFVERAYKYRPVKVVDFGLPRQQCVVYLDLKREECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAAR+KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSF+A+DSPYF NG+LHLRAELTIK
Sbjct  497  GEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK  551



>gb|KJB41445.1| hypothetical protein B456_007G104800 [Gossypium raimondii]
Length=552

 Score =   325 bits (834),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  377  KAEAPHRQRSLAAEESASLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+H
Sbjct  497  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRH  552



>ref|XP_010251563.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Nelumbo nucifera]
Length=551

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ +HRF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  376  KAEAPHRQRSLAAEESAATNHRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFINGILHLRAELTIKH
Sbjct  496  TEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIKH  551



>ref|XP_010326760.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Solanum lycopersicum]
Length=557

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA+DSSS SHRFVER YKYRP+KV++F  PRQQCVVYLDLKREEC+NLF
Sbjct  382  KAEAPHRQRSQAAEDSSSTSHRFVERAYKYRPVKVVDFGLPRQQCVVYLDLKREECANLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAAR+KP
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTKP  501

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSF+A+DSPYF NG+LHLRAELTIK
Sbjct  502  GEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK  556



>ref|XP_009789090.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana sylvestris]
Length=552

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PR QC+VYLDLKR+EC+NLF
Sbjct  377  KAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRHQCIVYLDLKRDECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  497  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  552



>emb|CDP08731.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRIQAA+DS+S + R+VER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  379  KAEAPHRQRIQAAEDSTSSNRRYVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTNLF  438

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEF+AR KP
Sbjct  439  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFSARLKP  498

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLFG+ WTSFMA+DS YFINGILHLRAELT++ 
Sbjct  499  TEEYMSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLYFINGILHLRAELTMRR  554



>gb|KJB49507.1| hypothetical protein B456_008G122900 [Gossypium raimondii]
Length=552

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  377  KAEAPHRQRSLAAEESATLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+H
Sbjct  497  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRH  552



>ref|XP_007051651.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
 gb|EOX95808.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
Length=413

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLK+EEC+NLF
Sbjct  238  KAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLF  297

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG +SFAVDYEFAARSKP
Sbjct  298  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKP  357

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+ 
Sbjct  358  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ  413



>ref|XP_009789089.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana sylvestris]
Length=559

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PR QC+VYLDLKR+EC+NLF
Sbjct  384  KAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRHQCIVYLDLKRDECANLF  443

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  444  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  503

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  504  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  559



>gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana]
Length=552

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PRQQC+VYLDLKR+EC+NLF
Sbjct  377  KAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVD EFAAR+KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDSEFAARTKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+H
Sbjct  497  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIRH  552



>ref|XP_011093267.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011093272.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Sesamum indicum]
Length=555

 Score =   323 bits (829),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S+S S RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  380  KAEAPHRQRSHATEESTSTSRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEE++SKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTIK
Sbjct  500  TEEYISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINGILHLRAELTIK  554



>ref|XP_011093257.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093262.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093265.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
Length=562

 Score =   323 bits (829),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S+S S RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  387  KAEAPHRQRSHATEESTSTSRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  446

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  447  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  506

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEE++SKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTIK
Sbjct  507  TEEYISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINGILHLRAELTIK  561



>ref|XP_007051649.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
 gb|EOX95806.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
Length=460

 Score =   320 bits (820),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLK+EEC+NLF
Sbjct  285  KAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLF  344

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG +SFAVDYEFAARSKP
Sbjct  345  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKP  404

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+ 
Sbjct  405  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ  460



>gb|KHG04846.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=552

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  377  KAEAPHRQRSLAAEESATLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  437  PSGRVYSQAFHLSGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+H
Sbjct  497  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRH  552



>gb|ADN34171.1| ATPOB protein binding [Cucumis melo subsp. melo]
Length=552

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRF-VERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQRI AAD++S+ + RF +ER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NL
Sbjct  376  KAEAPHRQRILAADEASTSNRRFFIERAYKYRPVKVVEFDRPRQQCVVYLDLKREECANL  435

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            FPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  495

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            PTEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+
Sbjct  496  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSHYFINGVLHLRAELTIR  551



>ref|XP_008437944.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
melo]
Length=553

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRF-VERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQRI AAD++S+ + RF +ER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NL
Sbjct  377  KAEAPHRQRILAADEASTSNRRFFIERAYKYRPVKVVEFDRPRQQCVVYLDLKREECANL  436

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            FPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSK
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  496

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            PTEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+
Sbjct  497  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSHYFINGVLHLRAELTIR  552



>ref|XP_004133826.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Cucumis 
sativus]
 ref|XP_004155851.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Cucumis 
sativus]
 gb|KGN56452.1| hypothetical protein Csa_3G119820 [Cucumis sativus]
Length=553

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRF-VERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQRI AAD++S+ + RF +ER YKYRP+KV+EF+ PRQQCVVYLDLKREEC+NL
Sbjct  377  KAEAPHRQRILAADEASTSNRRFFIERAYKYRPVKVVEFDRPRQQCVVYLDLKREECANL  436

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            FPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSK
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  496

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            PTEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI++
Sbjct  497  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSHYFINGVLHLRAELTIRN  553



>ref|XP_002320175.2| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE98490.2| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=548

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E  HRQR  AA++S++ + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  373  KGEPPHRQRTLAAEESATSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  432

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  433  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  492

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+
Sbjct  493  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  547



>ref|XP_010261454.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Nelumbo nucifera]
Length=539

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ S RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  364  KAEAPHRQRSLAAEESTAVSRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  423

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  424  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  483

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLF I WT+F+A+DS YFINGILHLRAELTIKH
Sbjct  484  TEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTAFVAEDSLYFINGILHLRAELTIKH  539



>ref|XP_010261455.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Nelumbo nucifera]
Length=537

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S++ S RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  362  KAEAPHRQRSLAAEESTAVSRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  421

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  422  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  481

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLF I WT+F+A+DS YFINGILHLRAELTIKH
Sbjct  482  TEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTAFVAEDSLYFINGILHLRAELTIKH  537



>ref|XP_009772583.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
sylvestris]
Length=545

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++SSS S RFVER YKYRP+KV++FE PRQQCVVYLDLK+EEC+NLF
Sbjct  370  KAEAPHRQRSQAAEESSSPSRRFVERAYKYRPVKVVDFEFPRQQCVVYLDLKQEECANLF  429

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAAR+KP
Sbjct  430  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTKP  489

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I W SF+A+DSPYFING+LHLRAELTI++
Sbjct  490  VEEYVSKYKGNYTFTGGKAVGYRNLFAIPWPSFIAEDSPYFINGMLHLRAELTIRN  545



>ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
 gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
Length=468

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLK+EEC+NLF
Sbjct  293  KAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLF  352

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG +SFAVDYEFAARSKP
Sbjct  353  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKP  412

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+ 
Sbjct  413  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ  468



>ref|XP_011037494.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=553

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E  HRQR  AA++S++ + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  378  KGEPPHRQRTLAAEESAASNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFING+LHLRAELTI+
Sbjct  498  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  552



>ref|XP_010669540.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Beta 
vulgaris subsp. vulgaris]
Length=556

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++S+S + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKR+EC+NLF
Sbjct  381  KAEAPHRQRILAAEESASTNRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKRDECANLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  500

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+F SKYKGNYTF GGKAVGYRNLFGI WTSFMA+DS YFI+GILHLRAELTI+H
Sbjct  501  TEDFQSKYKGNYTFMGGKAVGYRNLFGIPWTSFMAEDSLYFIDGILHLRAELTIRH  556



>gb|KCW78131.1| hypothetical protein EUGRSUZ_D02337 [Eucalyptus grandis]
Length=492

 Score =   319 bits (818),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++ ++ + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREECSNLF
Sbjct  317  KAEAPHRQRTLAAEECTTSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNLF  376

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  377  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  436

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLF I WT+FMA+DS YFINGILHLRAELTI++
Sbjct  437  TEEYISKYKGNYTFTGGKAVGYRNLFAIPWTNFMAEDSHYFINGILHLRAELTIRN  492



>ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Tarenaya hassleriana]
Length=558

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+NLF
Sbjct  378  KAEAPHRQRSLAAEESASLNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECTNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TE+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DSPYFINGILHLRAELTIK
Sbjct  498  TEDFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSPYFINGILHLRAELTIK  552



>ref|XP_009614366.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=539

 Score =   320 bits (821),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++SSS S RFVER YKYRP+KV++FE PRQQCVVYLDLKREEC+NLF
Sbjct  364  KAEAPHRQRNQAAEESSSPSRRFVERSYKYRPVKVVDFELPRQQCVVYLDLKREECANLF  423

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAAR+KP
Sbjct  424  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVAFAVDYEFAARTKP  483

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I W SF+A+DSPYFING+LHLRAELTI++
Sbjct  484  GEEYVSKYKGNYTFTGGKAVGYRNLFAIPWPSFIAEDSPYFINGMLHLRAELTIRN  539



>emb|CBI40464.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   319 bits (818),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+  + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  326  KAEAPHRQRSLAAEDSALTNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECINLF  385

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+  +CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  386  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSIHCFGLFLGMQEKGSVTFAVDYEFAARSKP  445

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFINGILHLRAELTI+H
Sbjct  446  TEEYISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIRH  501



>ref|XP_009614365.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=548

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++SSS S RFVER YKYRP+KV++FE PRQQCVVYLDLKREEC+NLF
Sbjct  373  KAEAPHRQRNQAAEESSSPSRRFVERSYKYRPVKVVDFELPRQQCVVYLDLKREECANLF  432

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAAR+KP
Sbjct  433  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVAFAVDYEFAARTKP  492

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I W SF+A+DSPYFING+LHLRAELTI++
Sbjct  493  GEEYVSKYKGNYTFTGGKAVGYRNLFAIPWPSFIAEDSPYFINGMLHLRAELTIRN  548



>ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao]
 gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao]
Length=525

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLK+EEC+NLF
Sbjct  350  KAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLF  409

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG +SFAVDYEFAARSKP
Sbjct  410  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKP  469

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+ 
Sbjct  470  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ  525



>ref|XP_004138466.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
2 [Cucumis sativus]
 ref|XP_004159779.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
sativus]
 gb|KGN45706.1| hypothetical protein Csa_6G007400 [Cucumis sativus]
Length=550

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA+  HRQR    D+S+S +HRF+ER YKYRP+K+IE E PRQQCVVYLDLKREEC+NLF
Sbjct  375  KADVPHRQRALITDESTSSNHRFIERTYKYRPVKIIELELPRQQCVVYLDLKREECTNLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEF+ARSKP
Sbjct  435  PSGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARSKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +EEF+SKYKGNYTFTGGKAVGYRNLFG+ WTSFMA+DS +FINGILHLRAELTIK
Sbjct  495  SEEFLSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSVHFINGILHLRAELTIK  549



>ref|XP_004138465.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
1 [Cucumis sativus]
Length=552

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA+  HRQR    D+S+S +HRF+ER YKYRP+K+IE E PRQQCVVYLDLKREEC+NLF
Sbjct  377  KADVPHRQRALITDESTSSNHRFIERTYKYRPVKIIELELPRQQCVVYLDLKREECTNLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEF+ARSKP
Sbjct  437  PSGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +EEF+SKYKGNYTFTGGKAVGYRNLFG+ WTSFMA+DS +FINGILHLRAELTIK
Sbjct  497  SEEFLSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSVHFINGILHLRAELTIK  551



>ref|XP_010661871.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Vitis vinifera]
Length=551

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+  + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  376  KAEAPHRQRSLAAEDSALTNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECINLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+  +CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSIHCFGLFLGMQEKGSVTFAVDYEFAARSKP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFINGILHLRAELTI+H
Sbjct  496  TEEYISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIRH  551



>ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Vitis vinifera]
Length=553

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+DS+  + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  378  KAEAPHRQRSLAAEDSALTNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECINLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+  +CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSIHCFGLFLGMQEKGSVTFAVDYEFAARSKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFINGILHLRAELTI+H
Sbjct  498  TEEYISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIRH  553



>ref|XP_010053775.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Eucalyptus 
grandis]
 gb|KCW78130.1| hypothetical protein EUGRSUZ_D02337 [Eucalyptus grandis]
Length=547

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++ ++ + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREECSNLF
Sbjct  372  KAEAPHRQRTLAAEECTTSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNLF  431

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  432  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  491

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++SKYKGNYTFTGGKAVGYRNLF I WT+FMA+DS YFINGILHLRAELTI++
Sbjct  492  TEEYISKYKGNYTFTGGKAVGYRNLFAIPWTNFMAEDSHYFINGILHLRAELTIRN  547



>ref|XP_008458155.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
melo]
Length=550

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA+  HRQR    D+S+S +HRF+ER YKYRP+K+IE E PRQQCVVYLDLKREEC+NLF
Sbjct  375  KADVPHRQRALITDESTSSNHRFIERTYKYRPVKIIELELPRQQCVVYLDLKREECTNLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEF+ARSKP
Sbjct  435  PSGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARSKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +EEF+SKYKGNYTFTGGKAVGYRNLFG+ WTSFMA+DS +FINGILHL+AELTIK
Sbjct  495  SEEFLSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSVHFINGILHLKAELTIK  549



>gb|EYU32197.1| hypothetical protein MIMGU_mgv1a003926mg [Erythranthe guttata]
Length=555

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAES HRQR  A +DS+S S RFVER YKYRP++V+EFE PR+QCVVYLDLKR+EC+NLF
Sbjct  380  KAESPHRQRTYATEDSTSTSRRFVERAYKYRPVRVVEFEQPRKQCVVYLDLKRDECANLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAARSKP
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFVVDYEFAARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+++SKYKGNYTFTGGKAVGYRNLF + WT+FMA+DS YFING+LHLRAELTIK 
Sbjct  500  TEDYISKYKGNYTFTGGKAVGYRNLFSLQWTNFMAEDSLYFINGVLHLRAELTIKQ  555



>ref|XP_007040414.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
 gb|EOY24915.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
Length=461

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC +LF
Sbjct  286  KAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHLF  345

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  346  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  405

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFINGILHLRAELTI+ 
Sbjct  406  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ  461



>ref|XP_007040413.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
 gb|EOY24914.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
Length=460

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC +LF
Sbjct  285  KAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHLF  344

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  345  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  404

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFINGILHLRAELTI+ 
Sbjct  405  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ  460



>ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
 gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
Length=552

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A ++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLK+EEC+NLF
Sbjct  377  KAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG +SFAVDYEFAARSKP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFINGILHLRAELTI+ 
Sbjct  497  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ  552



>emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera]
Length=526

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA+++SS   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  351  KAEAPYRQRSLAAEEASSSYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  410

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  411  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  470

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI W +FMADDS YFINGILHLRAELTI+ 
Sbjct  471  TEEYVSKYKGNYTFTGGKAVGYRNLFGIAWXAFMADDSHYFINGILHLRAELTIRQ  526



>ref|XP_010092900.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB52718.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=552

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQR  A++DS++ +  FVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NL+
Sbjct  377  KAEVPHRQRALASEDSATMNRHFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLY  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ  F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQGSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EEFVSKYKGNYTFTGGKAVGYRNLF + WT+FMA++SPYFING+LHLRAELTIKH
Sbjct  497  AEEFVSKYKGNYTFTGGKAVGYRNLFQLLWTNFMAEESPYFINGVLHLRAELTIKH  552



>gb|KDP25348.1| hypothetical protein JCGZ_20504 [Jatropha curcas]
Length=563

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E+ +RQRI AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  388  KGETPYRQRILAAEEANSAYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  447

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  448  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  507

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFINGILHLRAELTI+ 
Sbjct  508  SEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSLYFINGILHLRAELTIRQ  563



>gb|KDP28535.1| hypothetical protein JCGZ_14306 [Jatropha curcas]
Length=551

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  A ++S+S + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  376  KADAPHRQRTLATEESASLTRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+K 
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVSFAVDYEFAARTKQ  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF + WTSFMADDS YFING+LHLRAELTI+ 
Sbjct  496  TEEFVSKYKGNYTFTGGKAVGYRNLFALPWTSFMADDSLYFINGVLHLRAELTIRQ  551



>ref|XP_010658715.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis 
vinifera]
Length=562

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA+++SS   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  387  KAEAPYRQRSLAAEEASSSYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNLF  446

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  447  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  506

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI W +FMADDS YFINGILHLRAELTI+ 
Sbjct  507  TEEYVSKYKGNYTFTGGKAVGYRNLFGIAWNAFMADDSHYFINGILHLRAELTIRQ  562



>ref|XP_009626291.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
tomentosiformis]
Length=561

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++ S+  HRFVERVYKYRP KV+EFE PRQQC+VYLDLKREEC+NLF
Sbjct  386  KAEAPYRQRSLAAEEGSASHHRFVERVYKYRPAKVVEFELPRQQCIVYLDLKREECNNLF  445

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  446  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  505

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+F+A+DS YFINGILHLRAELTI+ 
Sbjct  506  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVAEDSVYFINGILHLRAELTIRQ  561



>ref|XP_003554745.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
 gb|KHN43127.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S+S +  FVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  379  KAEAPHRQRILAAE-SASFNRLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FMA+DS YFING+LHLRAELTI+H
Sbjct  498  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGVLHLRAELTIRH  553



>gb|KDO76413.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=413

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  238  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  297

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  298  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  357

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  358  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  413



>ref|XP_007040415.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
 gb|EOY24916.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
Length=473

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC +LF
Sbjct  298  KAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHLF  357

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  358  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  417

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFINGILHLRAELTI+ 
Sbjct  418  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ  473



>ref|XP_003637208.1| Kelch-like protein [Medicago truncatula]
 gb|KEH18740.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=551

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQR  AA++ +  S RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREECSNLF
Sbjct  376  KAEVPHRQRSLAAEEPACSSRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAARS+P
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSRP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+D  YFING+LHLRAELTI+ 
Sbjct  496  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIRQ  551



>ref|XP_006358650.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=551

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PRQQC+VYLDLKR+EC+NLF
Sbjct  376  KAEAPHRQRTQAAEESASTSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR+  
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARTTL  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFI G+LHLRAELTI+H
Sbjct  496  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIRH  551



>gb|KEH18742.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=559

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQR  AA++ +  S RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREECSNLF
Sbjct  384  KAEVPHRQRSLAAEEPACSSRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNLF  443

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAARS+P
Sbjct  444  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSRP  503

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+D  YFING+LHLRAELTI+ 
Sbjct  504  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIRQ  559



>ref|XP_011093067.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Sesamum indicum]
Length=476

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADD-SSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQR+ A ++ ++S S RF+ERVYKYRP+KV+EFE PR QCVV+LDLKREEC+NL
Sbjct  298  KAEAPHRQRVHAVEEETTSASRRFIERVYKYRPVKVVEFEFPRHQCVVFLDLKREECANL  357

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            FPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSK
Sbjct  358  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVTFAVDYEFAARSK  417

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            PTE+F+SKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFI  +LHLRAEL+IK
Sbjct  418  PTEDFISKYKGNYTFTGGKAVGYRNLFSIPWTSFMADDSNYFIKDMLHLRAELSIK  473



>ref|XP_003521793.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=553

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S+S +  FVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  379  KAEAPHRQRILAAE-SASFNRLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FMA+DS YFING LHLRAELTI+H
Sbjct  498  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGALHLRAELTIRH  553



>ref|XP_004510713.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cicer 
arietinum]
Length=551

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQR  AA++ +S + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC+ LF
Sbjct  376  KAEVPHRQRSLAAEEPASSNRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECNTLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAARS+P
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSRP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+D  YFING+LHLRAELTI++
Sbjct  496  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIRN  551



>ref|XP_003637209.1| Kelch-like protein [Medicago truncatula]
 gb|KEH18741.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=591

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQR  AA++ +  S RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREECSNLF
Sbjct  416  KAEVPHRQRSLAAEEPACSSRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNLF  475

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAARS+P
Sbjct  476  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSRP  535

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVGYRNLF I WTSFMA+D  YFING+LHLRAELTI+ 
Sbjct  536  TEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIRQ  591



>ref|XP_010522934.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Tarenaya hassleriana]
Length=545

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++ +S +HRFVER Y+YRP+KV+EFE PR QCVVYLDLKREECSNL+
Sbjct  370  KAEAPHRQRILAAEEPASLNHRFVERAYRYRPVKVLEFEAPRPQCVVYLDLKREECSNLY  429

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQN F+CFGLFLGMQEKG VSF VDYEFAARSKP
Sbjct  430  PAGRIYSQAFHLGGQGFFLSAHCNMDQQNSFHCFGLFLGMQEKGSVSFTVDYEFAARSKP  489

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FM+++  YFING+LHLRAELTI+
Sbjct  490  TEEFVSKYKGNYKFTGGKAVGYRNLFAIPWTAFMSEECLYFINGVLHLRAELTIR  544



>ref|XP_004248069.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Solanum lycopersicum]
Length=551

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PRQQC+VYLDLKREEC+NLF
Sbjct  376  KAEAPHRQRTQAAEESASTSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECANLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR+  
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARTTL  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFI G+LHLRAELTI+
Sbjct  496  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIR  550



>ref|XP_007040412.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
 gb|EOY24913.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
Length=564

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC +LF
Sbjct  389  KAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHLF  448

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  449  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSKP  508

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFINGILHLRAELTI+ 
Sbjct  509  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ  564



>ref|XP_007147261.1| hypothetical protein PHAVU_006G109600g [Phaseolus vulgaris]
 gb|ESW19255.1| hypothetical protein PHAVU_006G109600g [Phaseolus vulgaris]
Length=553

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S+S S  FVER YKYRP+KV++FE PRQQCVVYLDLKREEC+NLF
Sbjct  379  KAEAPHRQRILAAE-SASYSRLFVERAYKYRPVKVVDFELPRQQCVVYLDLKREECANLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  SFA+DYEFAARS+P
Sbjct  438  PTGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSTSFAIDYEFAARSRP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FMA+DS YFINGILHLRAELTI+H
Sbjct  498  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGILHLRAELTIRH  553



>ref|XP_006439420.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|ESR52660.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|KDO76411.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=478

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  303  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  362

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  363  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  422

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  423  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  478



>gb|KJB22359.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=382

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ +RQR  AA++S++ +HRFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  205  KADAPYRQRSLAAEESATSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNLF  264

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+C GLFLGMQEKG  SF VDYEFAAR KP
Sbjct  265  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCLGLFLGMQEKGSTSFTVDYEFAARLKP  324

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFV KYKGNYTFTGGKAVGYRNLF + WTSF+A+DS YFING LHLRAELTI+
Sbjct  325  TEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGTLHLRAELTIR  379



>ref|XP_010522933.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Tarenaya hassleriana]
Length=549

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++ +S +HRFVER Y+YRP+KV+EFE PR QCVVYLDLKREECSNL+
Sbjct  374  KAEAPHRQRILAAEEPASLNHRFVERAYRYRPVKVLEFEAPRPQCVVYLDLKREECSNLY  433

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQN F+CFGLFLGMQEKG VSF VDYEFAARSKP
Sbjct  434  PAGRIYSQAFHLGGQGFFLSAHCNMDQQNSFHCFGLFLGMQEKGSVSFTVDYEFAARSKP  493

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FM+++  YFING+LHLRAELTI+
Sbjct  494  TEEFVSKYKGNYKFTGGKAVGYRNLFAIPWTAFMSEECLYFINGVLHLRAELTIR  548



>gb|KHN35353.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S+S +  FVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  379  KAEAPHRQRILAAE-SASFNRLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAA+S+P
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAKSRP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FMA+DS YFING LHLRAELTI+H
Sbjct  498  TEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGALHLRAELTIRH  553



>ref|XP_010522935.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Tarenaya hassleriana]
Length=543

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA++ +S +HRFVER Y+YRP+KV+EFE PR QCVVYLDLKREECSNL+
Sbjct  368  KAEAPHRQRILAAEEPASLNHRFVERAYRYRPVKVLEFEAPRPQCVVYLDLKREECSNLY  427

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQN F+CFGLFLGMQEKG VSF VDYEFAARSKP
Sbjct  428  PAGRIYSQAFHLGGQGFFLSAHCNMDQQNSFHCFGLFLGMQEKGSVSFTVDYEFAARSKP  487

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFVSKYKGNY FTGGKAVGYRNLF I WT+FM+++  YFING+LHLRAELTI+
Sbjct  488  TEEFVSKYKGNYKFTGGKAVGYRNLFAIPWTAFMSEECLYFINGVLHLRAELTIR  542



>ref|XP_010326992.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Solanum lycopersicum]
Length=558

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR QAA++S+S S RFVER YKYRP+KV+EFE PRQQC+VYLDLKREEC+NLF
Sbjct  383  KAEAPHRQRTQAAEESASTSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECANLF  442

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR+  
Sbjct  443  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARTTL  502

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             EE+VSKYKGNYTFTGGKAVGYRNLF I WTSFMA+DS YFI G+LHLRAELTI+
Sbjct  503  AEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIR  557



>gb|KDO76412.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=505

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  330  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  389

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  390  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  449

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  450  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  505



>ref|XP_011093066.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Sesamum indicum]
Length=557

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADD-SSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQR+ A ++ ++S S RF+ERVYKYRP+KV+EFE PR QCVV+LDLKREEC+NL
Sbjct  379  KAEAPHRQRVHAVEEETTSASRRFIERVYKYRPVKVVEFEFPRHQCVVFLDLKREECANL  438

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            FPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSK
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVTFAVDYEFAARSK  498

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            PTE+F+SKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFI  +LHLRAEL+IK
Sbjct  499  PTEDFISKYKGNYTFTGGKAVGYRNLFSIPWTSFMADDSNYFIKDMLHLRAELSIK  554



>gb|AFK39130.1| unknown [Lotus japonicus]
Length=556

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR+ AA+ SSS +  FVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+NLF
Sbjct  382  KAEAPHRQRVLAAEASSS-NRLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARS+P
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSRP  500

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEEFVSKYKGNYTFTGGKAVG RNLF I WTSF+A+DS YFING+LHLRAELTI+ 
Sbjct  501  TEEFVSKYKGNYTFTGGKAVGCRNLFAIPWTSFLAEDSLYFINGVLHLRAELTIRQ  556



>ref|XP_011093065.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
Length=564

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADD-SSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            KAE+ HRQR+ A ++ ++S S RF+ERVYKYRP+KV+EFE PR QCVV+LDLKREEC+NL
Sbjct  386  KAEAPHRQRVHAVEEETTSASRRFIERVYKYRPVKVVEFEFPRHQCVVFLDLKREECANL  445

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSK  346
            FPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSK
Sbjct  446  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVTFAVDYEFAARSK  505

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            PTE+F+SKYKGNYTFTGGKAVGYRNLF I WTSFMADDS YFI  +LHLRAEL+IK
Sbjct  506  PTEDFISKYKGNYTFTGGKAVGYRNLFSIPWTSFMADDSNYFIKDMLHLRAELSIK  561



>gb|KJB52233.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
 gb|KJB52234.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=562

 Score =   313 bits (801),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K+E  HRQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  387  KSEMPHRQRALAAEEANATYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTHLF  446

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQE+G V+FAVDYEFAARSKP
Sbjct  447  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQERGSVTFAVDYEFAARSKP  506

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FM+DDS YFINGILHLRAELTI+ 
Sbjct  507  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMSDDSIYFINGILHLRAELTIRQ  562



>dbj|BAD94357.1| hypothetical protein [Arabidopsis thaliana]
Length=318

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  137  KAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  196

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  197  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDKS  256

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T EE+VSKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS +FINGILHLRAELTIK
Sbjct  257  TKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQHFINGILHLRAELTIK  312



>ref|XP_009104326.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Brassica rapa]
Length=559

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  380  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  500  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  555



>gb|KDO76410.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=554

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  379  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  438

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  439  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  498

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  499  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  554



>ref|XP_010053177.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Eucalyptus 
grandis]
 gb|KCW77441.1| hypothetical protein EUGRSUZ_D01781 [Eucalyptus grandis]
Length=572

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++    RFVER YKYRP+KV+EFE PRQQC+VYLDLKREEC++LF
Sbjct  393  KAEAPYRQRSLAAEEANGIHRRFVERTYKYRPVKVVEFELPRQQCIVYLDLKREECTHLF  452

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  453  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVAFAVDYEFAARSKP  512

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +EE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FM+DD PYFI+GILHLRAELTI+
Sbjct  513  SEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMSDDGPYFIDGILHLRAELTIR  567



>ref|XP_009104323.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Brassica rapa]
 emb|CDY53909.1| BnaA07g38170D [Brassica napus]
Length=562

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  380  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  500  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  555



>ref|XP_010469102.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Camelina sativa]
Length=516

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  337  KAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  396

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  397  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  456

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+ +DS YFINGILHLRAELTIK 
Sbjct  457  AEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIVEDSQYFINGILHLRAELTIKR  512



>ref|XP_009104327.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X4 
[Brassica rapa]
Length=551

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  369  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  428

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  429  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  488

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  489  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  544



>emb|CDY52008.1| BnaC06g42880D [Brassica napus]
Length=562

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  380  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  500  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  555



>ref|XP_006476450.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus 
sinensis]
Length=555

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  380  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  440  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  500  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  555



>ref|XP_009104325.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Brassica rapa]
Length=561

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  379  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  438

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  439  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  498

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  499  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  554



>ref|XP_006439421.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|ESR52661.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|KDO76408.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=555

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  380  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  440  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  500  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  555



>gb|KJB52235.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=574

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K+E  HRQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  399  KSEMPHRQRALAAEEANATYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTHLF  458

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQE+G V+FAVDYEFAARSKP
Sbjct  459  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQERGSVTFAVDYEFAARSKP  518

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FM+DDS YFINGILHLRAELTI+ 
Sbjct  519  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMSDDSIYFINGILHLRAELTIRQ  574



>ref|XP_006293933.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
 gb|EOA26831.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
Length=453

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI A + S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  272  KAEAPHRQRILAGEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  331

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAAR-SK  346
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR +K
Sbjct  332  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFAVDYEFAARENK  391

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            P EEFVSKYKGNYTFTGGKAVGYRNLFG+ WTSFMA+DS +FINGILHLRAELTIK
Sbjct  392  PGEEFVSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLHFINGILHLRAELTIK  447



>ref|XP_010512512.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Camelina 
sativa]
Length=568

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  389  KAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  448

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  449  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  508

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  509  AEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIAEDSQYFINGILHLRAELTIKR  564



>ref|XP_010413379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Camelina sativa]
Length=570

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  391  KAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  450

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  451  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  510

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  511  AEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIAEDSQYFINGILHLRAELTIKR  566



>gb|KJB22358.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=453

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ +RQR  AA++S++ +HRFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  276  KADAPYRQRSLAAEESATSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNLF  335

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+C GLFLGMQEKG  SF VDYEFAAR KP
Sbjct  336  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCLGLFLGMQEKGSTSFTVDYEFAARLKP  395

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFV KYKGNYTFTGGKAVGYRNLF + WTSF+A+DS YFING LHLRAELTI+
Sbjct  396  TEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGTLHLRAELTIR  450



>gb|KDO76409.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=582

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  407  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  466

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  467  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  526

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  527  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  582



>ref|XP_004494778.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cicer 
arietinum]
Length=551

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S+S  H FVER YKYRP+KV+EFE PRQQC+VYLDLKREEC +L+
Sbjct  371  KAEAPHRQRILAAE-SASSRHLFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECGSLY  429

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  SFAVDYEFA RSKP
Sbjct  430  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSASFAVDYEFAVRSKP  489

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+FVSKYKGNYTFTGGKAVGYRNLF   W SFMADDS YFING+LHLRAELTI++
Sbjct  490  TEDFVSKYKGNYTFTGGKAVGYRNLFATPWMSFMADDSLYFINGVLHLRAELTIRN  545



>gb|KDO76407.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=583

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++++S   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  408  KAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHLF  467

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  468  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIKP  527

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING LHLRAELTI+ 
Sbjct  528  TEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIRQ  583



>ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
 gb|ESQ43918.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
Length=603

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  423  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  482

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  483  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  542

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  543  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  598



>ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
 gb|ESQ43919.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
Length=613

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  433  KAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  492

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  493  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  552

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  553  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR  608



>ref|XP_009617879.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
tomentosiformis]
Length=550

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AAD  ++  HR++ER YKYRP+KV+EFE PRQQCV+YLDLK+EEC++LF
Sbjct  375  KAEAPYRQRSIAADAGNALCHRYMERAYKYRPVKVLEFEAPRQQCVIYLDLKKEECASLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  435  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGAVSFAVDYEFAARIKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E++VSKYKGNYTFTGGKAVGYRNLFGIGW +FMADDS YFING+LHLRAELTI+ 
Sbjct  495  NEQYVSKYKGNYTFTGGKAVGYRNLFGIGWNAFMADDSTYFINGLLHLRAELTIRQ  550



>ref|XP_010469101.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Camelina sativa]
Length=565

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  386  KAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  445

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  446  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  505

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+ +DS YFINGILHLRAELTIK 
Sbjct  506  AEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIVEDSQYFINGILHLRAELTIKR  561



>ref|XP_011073542.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Sesamum 
indicum]
Length=546

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR   A+++++   RFVER YKYRP+KV+EFE PRQQC+VYLDL+REEC+ LF
Sbjct  371  KAEAPYRQRSLVAEEANASFRRFVERAYKYRPVKVVEFESPRQQCIVYLDLRREECAQLF  430

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLS HCNMDQQ+ F+CFGLFLGMQEKG V+F VDYEFA+R+KP
Sbjct  431  PAGRVYSQAFHLGGQGFFLSGHCNMDQQSSFHCFGLFLGMQEKGSVAFTVDYEFASRTKP  490

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +E+FVSKYKGNYTFTGGKAVGYRNLFG+ WT+F+ADDSPYFINGILHLRAELTIK
Sbjct  491  SEDFVSKYKGNYTFTGGKAVGYRNLFGVPWTAFIADDSPYFINGILHLRAELTIK  545



>ref|XP_010469099.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Camelina sativa]
Length=569

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  390  KAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  449

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  450  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  509

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+ +DS YFINGILHLRAELTIK 
Sbjct  510  AEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIVEDSQYFINGILHLRAELTIKR  565



>ref|XP_009789895.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana sylvestris]
Length=563

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++ S+  H FVER YKYRP+KV+EFE PRQQC+VYLD KREEC++LF
Sbjct  388  KAEAPYRQRSLAAEEGSASHHCFVERAYKYRPVKVVEFELPRQQCIVYLDTKREECNSLF  447

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  448  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  507

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FMA+DS YFINGILHLRAELTI+ 
Sbjct  508  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMAEDSVYFINGILHLRAELTIRQ  563



>ref|XP_006290834.1| hypothetical protein CARUB_v10016944mg [Capsella rubella]
 gb|EOA23732.1| hypothetical protein CARUB_v10016944mg [Capsella rubella]
Length=562

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++++S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  383  KAEAPHRQRSLAAEETASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECLGLF  442

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  443  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  502

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             E+F+SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFINGILHLRAELTIK
Sbjct  503  AEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIAEDSQYFINGILHLRAELTIK  557



>ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
 gb|EOA26832.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
Length=560

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI A + S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  379  KAEAPHRQRILAGEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  438

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAAR-SK  346
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR +K
Sbjct  439  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFAVDYEFAARENK  498

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            P EEFVSKYKGNYTFTGGKAVGYRNLFG+ WTSFMA+DS +FINGILHLRAELTIK
Sbjct  499  PGEEFVSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLHFINGILHLRAELTIK  554



>gb|KHG04418.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
 gb|KHG04419.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
 gb|KHG30490.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=555

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ +RQR  AA++S++ + RF+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  378  KADAPYRQRSLAAEESATSNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ FYC GLFLGMQEKG  SFAVDYEFAAR KP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFYCLGLFLGMQEKGSASFAVDYEFAARLKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFV KYKGNYTFTGGKAVGYRNLF + WTSF+A+DS YFINGILHLRAELTI+
Sbjct  498  TEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGILHLRAELTIR  552



>emb|CAB71090.1| putative protein [Arabidopsis thaliana]
Length=545

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A+++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  366  KAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGLF  425

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  426  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  485

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             E+F+SKYKGNYTFTGGKAVGYRNLFG+ WTSF+A+DS YFINGILHLRAELTIK
Sbjct  486  AEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIK  540



>ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
 sp|Q9FPW6.2|POB1_ARATH RecName: Full=BTB/POZ domain-containing protein POB1; AltName: 
Full=POZ/BTB CONTAINING-PROTEIN 1; Short=AtPOB1 [Arabidopsis 
thaliana]
 gb|AEE80229.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
Length=561

 Score =   308 bits (788),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A+++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  382  KAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  501

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFG+ WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  502  AEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR  557



>ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
 gb|AAG44951.1|AF292397_1 POZ/BTB containing-protein AtPOB1 [Arabidopsis thaliana]
 gb|ABO38760.1| At3g61600 [Arabidopsis thaliana]
 gb|AEE80230.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
Length=561

 Score =   308 bits (788),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A+++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  382  KAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  501

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFG+ WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  502  AEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR  557



>ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52883.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A+++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  383  KAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGLF  442

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  443  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  502

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+F+SKYKGNYTFTGGKAVGYRNLFG+ WTSF+A+DS YFINGILHLRAELTIK 
Sbjct  503  AEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR  558



>ref|XP_010518296.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 [Camelina 
sativa]
Length=562

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI A + S + + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  381  KAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  440

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  441  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDKK  500

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
              EEFVSKYKGNYTFTGGKAVGYRNLFGI WTSFMA+DSP+FINGILHLRAELTIK
Sbjct  501  AGEEFVSKYKGNYTFTGGKAVGYRNLFGIPWTSFMAEDSPHFINGILHLRAELTIK  556



>gb|KJB22357.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=555

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ +RQR  AA++S++ +HRFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC NLF
Sbjct  378  KADAPYRQRSLAAEESATSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+C GLFLGMQEKG  SF VDYEFAAR KP
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCLGLFLGMQEKGSTSFTVDYEFAARLKP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TEEFV KYKGNYTFTGGKAVGYRNLF + WTSF+A+DS YFING LHLRAELTI+
Sbjct  498  TEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGTLHLRAELTIR  552



>gb|AAM61110.1| unknown [Arabidopsis thaliana]
Length=546

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  365  KAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  424

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  425  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDKS  484

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T EE+VSKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS +FINGILHLRAELTIK
Sbjct  485  TKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQHFINGILHLRAELTIK  540



>ref|NP_566069.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana]
 sp|O82343.2|Y2626_ARATH RecName: Full=BTB/POZ domain-containing protein At2g46260 [Arabidopsis 
thaliana]
 gb|AAK76685.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85129.1| unknown protein [Arabidopsis thaliana]
 gb|AAC62880.2| expressed protein [Arabidopsis thaliana]
 gb|AEC10666.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana]
Length=561

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  380  KAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDKS  499

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T EE+VSKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS +FINGILHLRAELTIK
Sbjct  500  TKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQHFINGILHLRAELTIK  555



>gb|KFK35343.1| hypothetical protein AALP_AA5G272300 [Arabis alpina]
Length=560

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A+++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  380  KAEAPHRQRSLASEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECVGLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  440  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+F SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS  FINGILHLRAELTIK 
Sbjct  500  TEDFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLCFINGILHLRAELTIKR  555



>gb|KFK35342.1| hypothetical protein AALP_AA5G272300 [Arabis alpina]
Length=564

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A+++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  384  KAEAPHRQRSLASEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECVGLF  443

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  444  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  503

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+F SKYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS  FINGILHLRAELTIK 
Sbjct  504  TEDFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLCFINGILHLRAELTIKR  559



>ref|XP_009772687.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
sylvestris]
Length=550

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AAD  ++  HR++ER YKYRP+KV+EFE PRQQCV+YLDLK+EEC++LF
Sbjct  375  KAEAPYRQRSIAADAGNALCHRYMERAYKYRPVKVLEFEAPRQQCVIYLDLKKEECASLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFA R+KP
Sbjct  435  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGAVSFAVDYEFAVRTKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+++SKYKGNYTFTGGKAVGYRNL G+GW++F+ADDS YFING+LHLRAELTI  
Sbjct  495  NEQYMSKYKGNYTFTGGKAVGYRNLLGVGWSAFLADDSAYFINGLLHLRAELTISQ  550



>ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X1 [Camelina sativa]
Length=563

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI A + S + + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  382  KAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREKK  501

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
              +EF SKYKGNYTFTGGKAVGYRNLFGI WTSFMA+DSP+FINGILHLRAELTIK
Sbjct  502  AGDEFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFMAEDSPHFINGILHLRAELTIK  557



>emb|CDX95684.1| BnaC03g25650D [Brassica napus]
Length=539

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI +A+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  363  KAEAPHRQRILSAEGSDSTNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  422

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR KP
Sbjct  423  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARQKP  482

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTI  181
            ++++ SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFING+LHLRAELTI
Sbjct  483  SQDYSSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSQYFINGVLHLRAELTI  536



>ref|XP_011022567.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=561

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+SHRQR  AAD+ ++ + RFVER YKYRP+KV+E E P QQCVVYLDLKREEC+ LF
Sbjct  386  KAETSHRQRAIAADEPNAVNRRFVERAYKYRPVKVVELELPHQQCVVYLDLKREECAQLF  445

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ  ++CFGLFLGMQEKG VSFAVDYEFAARSK 
Sbjct  446  PAGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSVSFAVDYEFAARSKQ  505

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFG+ W +F+ DDS  FINGILHLRAELTI+ 
Sbjct  506  TEEYVSKYKGNYTFTGGKAVGYRNLFGVHWQAFIEDDSNNFINGILHLRAELTIRQ  561



>gb|EYU40044.1| hypothetical protein MIMGU_mgv1a004127mg [Erythranthe guttata]
Length=543

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR   A+++ +   RFVER YKYRP+KV+EF+ PRQQCVVYLDLKREEC  LF
Sbjct  368  KAEAPYRQRSLVAEETKASFRRFVERAYKYRPVKVVEFDSPRQQCVVYLDLKREECVQLF  427

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLS HCNMDQQ+ F+CFG+FLGMQEKG V+F VDYEFA+R+ P
Sbjct  428  PAGRVYSQAFHLGGQGFFLSGHCNMDQQSSFHCFGMFLGMQEKGSVAFTVDYEFASRTSP  487

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +E+FVSKYKGNYTFTGGKAVGYRNLFG  WT+F+ADDSPYFING+LHLRAELTIK
Sbjct  488  SEDFVSKYKGNYTFTGGKAVGYRNLFGTPWTAFIADDSPYFINGVLHLRAELTIK  542



>ref|XP_002303620.1| hypothetical protein POPTR_0003s13510g [Populus trichocarpa]
 gb|EEE78599.1| hypothetical protein POPTR_0003s13510g [Populus trichocarpa]
Length=561

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+SHRQR  AAD+ ++ + RFVER YKYRP+KV+E E P QQCVVYLDLKREEC+ LF
Sbjct  386  KAETSHRQRAIAADEPNAVNRRFVERAYKYRPVKVVELELPHQQCVVYLDLKREECAQLF  445

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ  ++CFGLFLGMQEKG VSFAVDYEFAARSK 
Sbjct  446  PTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSVSFAVDYEFAARSKQ  505

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE+VSKYKGNYTFTGGKAVGYRNLFG+ W +F+ DDS  FINGILHLRAELTI+ 
Sbjct  506  TEEYVSKYKGNYTFTGGKAVGYRNLFGVHWQAFIEDDSNNFINGILHLRAELTIRQ  561



>ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X2 [Camelina sativa]
Length=559

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI A + S + + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  378  KAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREKK  497

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
              +EF SKYKGNYTFTGGKAVGYRNLFGI WTSFMA+DSP+FINGILHLRAELTIK
Sbjct  498  AGDEFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFMAEDSPHFINGILHLRAELTIK  553



>ref|XP_009133768.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Brassica 
rapa]
Length=550

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI +AD S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  374  KAEAPHRQRILSADGSDSTNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  433

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR KP
Sbjct  434  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARQKP  493

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            ++++ SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS Y ING+LHLRAELTI  
Sbjct  494  SQDYSSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSQYLINGVLHLRAELTINR  549



>emb|CDX83375.1| BnaA03g21310D [Brassica napus]
Length=553

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI +A+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  377  KAEAPHRQRILSAEGSDSTNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARQKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            ++++ SKYKGNYTFTGGKAVGYRNLF I WTSF+A+DS YFING+LHLRAELTI  
Sbjct  497  SQDYSSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSQYFINGVLHLRAELTINR  552



>gb|KJB39679.1| hypothetical protein B456_007G025100 [Gossypium raimondii]
 gb|KJB39680.1| hypothetical protein B456_007G025100 [Gossypium raimondii]
Length=562

 Score =   303 bits (776),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ H+QR  A++++++    F+ER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  387  KAETPHKQRALASEEANAPYRHFLERAYKYRPVKVVEFEKPRQQCVVYLDLKREECAHLF  446

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P G+VYSQAFHLGGQGFF SAHC+MDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  447  PGGKVYSQAFHLGGQGFFFSAHCHMDQQSSFHCFGLFLGMQEKGPVTFAVDYEFAARSKP  506

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+++SKYKGNYTFTGGKAVGYRNLFGI WT+FMADDS YFING+LHLRAELT++ 
Sbjct  507  TEDYISKYKGNYTFTGGKAVGYRNLFGIPWTTFMADDSNYFINGVLHLRAELTVRQ  562



>ref|XP_010925791.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Elaeis guineensis]
Length=507

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD+S+S   RFVER YKYRP+KV+EF+ P  QC+VYLDLKREEC+ LF
Sbjct  330  KADAPHRQRALAADESTS--RRFVERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKLF  387

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQN F+CFGLFLGMQEKG +SF VDYEFAAR++P
Sbjct  388  PSGRVYSQAFHLGGQGFFLSAHCNLDQQNSFHCFGLFLGMQEKGSISFTVDYEFAARARP  447

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I WTSFMADDS +FING+LHLRAELTIK 
Sbjct  448  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIKQ  503



>ref|XP_010508047.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Camelina 
sativa]
Length=563

 Score =   303 bits (775),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI A + S + + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  382  KAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  441

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  442  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREKK  501

Query  342  T-EEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
              +EF SKYKGNYTFTGGKAVGYRNLFGI W SFMA+DSP+FINGILHLRAELTIK
Sbjct  502  AGDEFTSKYKGNYTFTGGKAVGYRNLFGIPWISFMAEDSPHFINGILHLRAELTIK  557



>ref|XP_010925790.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Elaeis guineensis]
Length=557

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD+S+S   RFVER YKYRP+KV+EF+ P  QC+VYLDLKREEC+ LF
Sbjct  380  KADAPHRQRALAADESTS--RRFVERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQN F+CFGLFLGMQEKG +SF VDYEFAAR++P
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNLDQQNSFHCFGLFLGMQEKGSISFTVDYEFAARARP  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I WTSFMADDS +FING+LHLRAELTIK 
Sbjct  498  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIKQ  553



>ref|XP_002880228.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56487.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  380  KAEAPHRQRILAAEGSGSLNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARS-K  346
             SGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR  K
Sbjct  440  LSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDKK  499

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             +EE+VSKYKGNYTFTGGKAVGYRNLFGI WTSF+ADDS +FINGILHLRAELTIK
Sbjct  500  SSEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIADDSQHFINGILHLRAELTIK  555



>ref|XP_006842894.1| hypothetical protein AMTR_s00075p00054260 [Amborella trichopoda]
 gb|ERN04569.1| hypothetical protein AMTR_s00075p00054260 [Amborella trichopoda]
Length=280

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 156/176 (89%), Gaps = 3/176 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR   A++S++   RF ER YKYRP+KV+EF+ P  QC+V+LDLKREEC+ LF
Sbjct  102  KAETPHRQRALMAEESAN--RRFAERAYKYRPVKVVEFDSPHTQCIVFLDLKREECAALF  159

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAARSKP
Sbjct  160  PTGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSKP  219

Query  342  TE-EFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T  EFVSKYKGNYTFTGGKAVGYRNLF + WTSFMA+DS YF+NG+LHLRAELTIK
Sbjct  220  TAWEFVSKYKGNYTFTGGKAVGYRNLFQMPWTSFMAEDSHYFVNGVLHLRAELTIK  275



>ref|XP_010676365.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score =   300 bits (769),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  +RQR    D++++  HR++ER YKYRP+KVIEFE PR QC+VYLDLK+EEC NLF
Sbjct  379  KAEPPYRQRALLGDETNTMGHRYMERAYKYRPVKVIEFELPRPQCIVYLDLKKEECQNLF  438

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEF+AR  P
Sbjct  439  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARQSP  498

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             +EF++KY+GNYTF GGKAVGYRNLFG  WTSFMADDS +FING+LHL+AELTIK
Sbjct  499  ADEFITKYRGNYTFMGGKAVGYRNLFGTPWTSFMADDSLFFINGVLHLKAELTIK  553



>ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
 gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
Length=530

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  352  KAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  411

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  412  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK-  470

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             + FVSKY+GNYTFTGGKAVGYRNLFG  WTSF+ADDS YFINGILHLRAELTIK 
Sbjct  471  EKGFVSKYRGNYTFTGGKAVGYRNLFGCPWTSFIADDSQYFINGILHLRAELTIKR  526



>ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
 gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
Length=554

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  376  KAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR K 
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK-  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             + FVSKY+GNYTFTGGKAVGYRNLFG  WTSF+ADDS YFINGILHLRAELTIK 
Sbjct  495  EKGFVSKYRGNYTFTGGKAVGYRNLFGCPWTSFIADDSQYFINGILHLRAELTIKR  550



>ref|XP_006360698.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=546

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++ ++    FVER YKYRPIKV+EFE PRQQC+VYLDLKREEC+NLF
Sbjct  370  KAEAPHRQRSLAAEEGNASRSSFVERAYKYRPIKVVEFELPRQQCMVYLDLKREECNNLF  429

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQN F+CFGLFLGMQEKG VSF VDYEFA  +K 
Sbjct  430  PAGRVYSQAFHLGGQGFFLSAHCNMDQQNAFHCFGLFLGMQEKGSVSFTVDYEFAVWTKL  489

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTI  181
            TE +VSKYKGNYTFTGGKAVGYRNL GI WTSFMA+DS YFINGILHLRA LTI
Sbjct  490  TEGYVSKYKGNYTFTGGKAVGYRNLAGIPWTSFMAEDSVYFINGILHLRAVLTI  543



>gb|KHG30067.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=562

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ H+QR  A++++++    F+ER YKYRP+KV+EFE P+QQCVVYLDLKREEC++LF
Sbjct  387  KAETPHKQRALASEEANAPFRHFLERAYKYRPVKVLEFEKPKQQCVVYLDLKREECAHLF  446

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P G+VYSQAFHLGGQGFF SAHC+MDQQ+ F+CFGLFLGMQEKG V+FAVDYEFAARSKP
Sbjct  447  PGGKVYSQAFHLGGQGFFFSAHCHMDQQSSFHCFGLFLGMQEKGAVTFAVDYEFAARSKP  506

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE++VSKYKGNYTFTG KA+GYRNLFGI WT+FMADDS +FING+LHLRAELT++ 
Sbjct  507  TEDYVSKYKGNYTFTGRKAIGYRNLFGIPWTTFMADDSNFFINGVLHLRAELTVRQ  562



>ref|XP_002299499.2| hypothetical protein POPTR_0001s10190g [Populus trichocarpa]
 gb|EEE84304.2| hypothetical protein POPTR_0001s10190g [Populus trichocarpa]
Length=561

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQ   A D  ++ + RFVER YKYRP+KV++FE P QQCVVYLDLKREEC+ LF
Sbjct  386  KAETPHRQHALAVDVPNAVNRRFVERAYKYRPVKVVDFELPYQQCVVYLDLKREECAQLF  445

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ  ++CFGLFLGMQEKG  SFAVDYEFAARSKP
Sbjct  446  PTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSASFAVDYEFAARSKP  505

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE +V+KYKGNYTFTGGKAVGYRNLF + W +FM DDS YFINGILHLRAELTI+ 
Sbjct  506  TEGYVNKYKGNYTFTGGKAVGYRNLFSVHWEAFMEDDSNYFINGILHLRAELTIRQ  561



>ref|XP_009410864.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=514

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A++ SS+   R+ ER YKYRP+K IEFE P  QC+VYLDLK+EEC +LF
Sbjct  333  KAETPHRQRALASEQSSN--RRYAERAYKYRPVKAIEFELPHPQCIVYLDLKQEECVHLF  390

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR+KP
Sbjct  391  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARAKP  450

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            + EF+SKYKG YTFTGGKAVGYRNLF I WTSFMADDS YFING+LHLRAELTIK
Sbjct  451  SGEFISKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGVLHLRAELTIK  505



>ref|XP_010914379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Elaeis guineensis]
Length=537

 Score =   295 bits (755),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+  RQR  AAD+S++   RF+ER YKYRP+KV+EFE P  QC+VYLDLKR EC NLF
Sbjct  357  KAEAPRRQRALAADESTN--RRFIERAYKYRPVKVVEFELPHPQCIVYLDLKRRECGNLF  414

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PS RVYSQAFHLGGQGFFLSAHCNMD Q+  +CFGLFLGMQEKG VSF VDYEFAAR++P
Sbjct  415  PSARVYSQAFHLGGQGFFLSAHCNMDHQSSCHCFGLFLGMQEKGSVSFTVDYEFAARTRP  474

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLFGI WTSFMADDS YFIN +LHLRAELTIK 
Sbjct  475  SGEFVSKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSLYFINDVLHLRAELTIKQ  530



>ref|XP_011026946.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Populus euphratica]
Length=501

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+  RQR  A D  ++ + RFVER YKYRP+KV++FE P QQCVVYLDLKREEC+ LF
Sbjct  326  KAETPLRQRALAVDVPNAVNRRFVERAYKYRPVKVVDFESPHQQCVVYLDLKREECAQLF  385

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ  ++CFGLFLGMQEKG  SFAVDYEFAARSKP
Sbjct  386  PTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSASFAVDYEFAARSKP  445

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE +V+K KGNYTFTGGKAVGYRNLFG+ W +FM DDS YFING LHLRAELTI+ 
Sbjct  446  TEGYVNKNKGNYTFTGGKAVGYRNLFGVLWEAFMEDDSNYFINGTLHLRAELTIRQ  501



>ref|XP_009410863.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=536

 Score =   295 bits (754),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  A++ SS+   R+ ER YKYRP+K IEFE P  QC+VYLDLK+EEC +LF
Sbjct  355  KAETPHRQRALASEQSSN--RRYAERAYKYRPVKAIEFELPHPQCIVYLDLKQEECVHLF  412

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEFAAR+KP
Sbjct  413  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARAKP  472

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            + EF+SKYKG YTFTGGKAVGYRNLF I WTSFMADDS YFING+LHLRAELTIK
Sbjct  473  SGEFISKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGVLHLRAELTIK  527



>emb|CDX71727.1| BnaC08g31470D [Brassica napus]
Length=554

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ H+QR  AA++S+S     +ER YKYRP+KV+EFE P  QCVVYLDLKREEC  LF
Sbjct  375  KAETPHKQRSLAAEESASVHRHLIERAYKYRPVKVLEFELPMPQCVVYLDLKREECIGLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFH+GGQGFFLSAHCN+DQQ+ FYCFGLFLGMQEKG VSF VDYEF+ARS P
Sbjct  435  PSGRVYSQAFHIGGQGFFLSAHCNLDQQSSFYCFGLFLGMQEKGSVSFGVDYEFSARSNP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            +EEF+SKYKGNYTFTGGKAVGYRNLFGI WTSF+ +D+ YFINGILHL+AELTI+
Sbjct  495  SEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFVEEDNLYFINGILHLKAELTIR  549



>ref|XP_008793877.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Phoenix dactylifera]
Length=557

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  A+D+S+S   RFVER YKYRP+KV+EF+ P  QC+VYLDLKREEC+ LF
Sbjct  380  KADTPHRQRALASDESTS--QRFVERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQN F+CFGLFLGMQEKG +SF VDYEFAAR++ 
Sbjct  438  PSGRVYSQAFHLGGQGFFLSAHCNLDQQNSFHCFGLFLGMQEKGSISFTVDYEFAARTRL  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EF SKYKG YTFTGGKAVGYRNLF I WTSFMADDS +FING+LHLRAELTIK 
Sbjct  498  SGEFASKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIKQ  553



>ref|XP_011026945.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Populus euphratica]
Length=551

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+  RQR  A D  ++ + RFVER YKYRP+KV++FE P QQCVVYLDLKREEC+ LF
Sbjct  376  KAETPLRQRALAVDVPNAVNRRFVERAYKYRPVKVVDFESPHQQCVVYLDLKREECAQLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ  ++CFGLFLGMQEKG  SFAVDYEFAARSKP
Sbjct  436  PTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSASFAVDYEFAARSKP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE +V+K KGNYTFTGGKAVGYRNLFG+ W +FM DDS YFING LHLRAELTI+ 
Sbjct  496  TEGYVNKNKGNYTFTGGKAVGYRNLFGVLWEAFMEDDSNYFINGTLHLRAELTIRQ  551



>ref|XP_009142670.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g46260 [Brassica rapa]
Length=564

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQRI AA+ S S + RF+ER YKYRP+KV+  E PR QCVVYLDLKREEC+ L 
Sbjct  385  KAEAPHRQRILAAEGSDSTNRRFIERAYKYRPVKVVXCELPRPQCVVYLDLKREECTGLC  444

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYS+AFHLGGQG FLSAHCN+D Q+ F+CFGLFLGMQEKG VSF VDYEFAAR KP
Sbjct  445  PSGRVYSKAFHLGGQGLFLSAHCNIDLQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREKP  504

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            ++++  KYKGNYTFTGGKAVGYRNLFGI WTSF+A+DS YFI+GILHLRAELTIK
Sbjct  505  SQDYACKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQYFIDGILHLRAELTIK  559



>ref|XP_008798670.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Phoenix 
dactylifera]
Length=537

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+  RQR  AAD+S++   RF+ER YKYRP+KV+EFE P  QC+V+LDLKR EC NLF
Sbjct  357  KAEAPRRQRALAADESTN--RRFLERAYKYRPVKVVEFELPHPQCIVFLDLKRGECRNLF  414

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PS RVYSQAFHLGGQGFFLSAHCN+D QN  +CFGLFLGMQEKG VSF VDYEFAAR++P
Sbjct  415  PSARVYSQAFHLGGQGFFLSAHCNIDHQNSCHCFGLFLGMQEKGSVSFTVDYEFAARTRP  474

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EF SKYKGNYTFTGGKAVGYRNLFGI WTSFMADDS YFIN +LHLRAELTIK 
Sbjct  475  SGEFASKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSLYFINDVLHLRAELTIKQ  530



>ref|XP_009419784.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  +AD+SS    RF ER YKYRP+KV+EF+ P  QC+VYLDLKREEC+ LF
Sbjct  377  KAEALHRQRAFSADESSH--KRFTERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQ++F+CFGLFLGMQEKG +SF VDYEFAAR+KP
Sbjct  435  PSGRVYSQAFHLGGQGFFLSAHCNLDQQSLFHCFGLFLGMQEKGSISFTVDYEFAARTKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF   WTSFMA+DS +FIN  LHLRAELTIK 
Sbjct  495  SGEFVSKYKGYYTFTGGKAVGYRNLFATPWTSFMAEDSLFFINDTLHLRAELTIKQ  550



>ref|XP_009419783.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  +AD+SS    RF ER YKYRP+KV+EF+ P  QC+VYLDLKREEC+ LF
Sbjct  379  KAEALHRQRAFSADESSH--KRFTERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQ++F+CFGLFLGMQEKG +SF VDYEFAAR+KP
Sbjct  437  PSGRVYSQAFHLGGQGFFLSAHCNLDQQSLFHCFGLFLGMQEKGSISFTVDYEFAARTKP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF   WTSFMA+DS +FIN  LHLRAELTIK 
Sbjct  497  SGEFVSKYKGYYTFTGGKAVGYRNLFATPWTSFMAEDSLFFINDTLHLRAELTIKQ  552



>ref|XP_009380541.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=555

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  +AD+SS    RF ER YKYRP+KV+EFE P  QC+VYLDL R+EC+ LF
Sbjct  375  KAEAPHRQRALSADESSH--KRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKLF  432

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQ ++F+CFGLFLGMQEKG +SF V+YEFAAR+KP
Sbjct  433  PSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTKP  492

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLFGI WTSF+A+DS +FING LHLRAELTIK 
Sbjct  493  SGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIKQ  548



>ref|XP_009380540.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  +AD+SS    RF ER YKYRP+KV+EFE P  QC+VYLDL R+EC+ LF
Sbjct  377  KAEAPHRQRALSADESSH--KRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKLF  434

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQ ++F+CFGLFLGMQEKG +SF V+YEFAAR+KP
Sbjct  435  PSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTKP  494

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLFGI WTSF+A+DS +FING LHLRAELTIK 
Sbjct  495  SGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIKQ  550



>ref|XP_009380539.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=572

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  +AD+SS    RF ER YKYRP+KV+EFE P  QC+VYLDL R+EC+ LF
Sbjct  392  KAEAPHRQRALSADESSH--KRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKLF  449

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQ ++F+CFGLFLGMQEKG +SF V+YEFAAR+KP
Sbjct  450  PSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTKP  509

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLFGI WTSF+A+DS +FING LHLRAELTIK 
Sbjct  510  SGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIKQ  565



>ref|XP_009380538.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=574

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  +AD+SS    RF ER YKYRP+KV+EFE P  QC+VYLDL R+EC+ LF
Sbjct  394  KAEAPHRQRALSADESSH--KRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKLF  451

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQ ++F+CFGLFLGMQEKG +SF V+YEFAAR+KP
Sbjct  452  PSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTKP  511

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLFGI WTSF+A+DS +FING LHLRAELTIK 
Sbjct  512  SGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIKQ  567



>ref|XP_006343902.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343903.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Solanum tuberosum]
Length=552

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++ ++  HR+VER YKYRPIK +EFE P QQCV+YLDLKR+EC++LF
Sbjct  377  KAEAPYRQRSIAAEEGNALYHRYVERAYKYRPIKALEFETPHQQCVIYLDLKRDECASLF  436

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMD Q+ F+CFGLFLGMQEKG VSFAVDYEFAAR  P
Sbjct  437  PAGRVYSQAFHLGGQGFFLSAHCNMDHQSAFHCFGLFLGMQEKGSVSFAVDYEFAARISP  496

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EE+VSKYKG+YTFT GKAVGYRNLFG+ WT F+++DS +FINGILHLRAEL ++ 
Sbjct  497  GEEYVSKYKGDYTFTSGKAVGYRNLFGVAWTPFLSEDSLFFINGILHLRAELRVRE  552



>ref|XP_008238990.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Prunus 
mume]
Length=555

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+  RQR  A      G  RF ER YKYRPIK++EFE PR QC+V+LDLKREEC+ LF
Sbjct  385  KAEAPFRQRSLAL-----GDRRFGERSYKYRPIKLVEFEQPRDQCIVFLDLKREECARLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  440  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFSARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+++SKYKGNYTFTGGKAVGYRNLFGI WTSFMADDS YFI+ +LHL+AELTI+ 
Sbjct  500  GEDYLSKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSIYFIDSVLHLKAELTIRQ  555



>ref|NP_001142262.1| uncharacterized protein LOC100274431 [Zea mays]
 gb|ACF81694.1| unknown [Zea mays]
 gb|ACF88032.1| unknown [Zea mays]
 gb|ACR36259.1| unknown [Zea mays]
 gb|ACR38764.1| unknown [Zea mays]
 gb|AFW71009.1| hypothetical protein ZEAMMB73_641376 [Zea mays]
 gb|AIB05715.1| orphans transcription factor, partial [Zea mays]
Length=539

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  ++   +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  364  KADAPHRQRALAAD--TTTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  421

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  422  PAGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  481

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLFGI W +FMADDS +FI+G+LHLRAELTIK 
Sbjct  482  SGEFVSKYKGNYTFTGGKAVGYRNLFGIPWQAFMADDSLFFIDGMLHLRAELTIKQ  537



>dbj|BAJ92080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  A D  +S   ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREEC  LF
Sbjct  107  KADAPHRQRALATDVLTS--RKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRLF  164

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  165  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  224

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FING+LHLRAELTIK 
Sbjct  225  SGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIKQ  280



>dbj|BAK01214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  A D  +S   ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREEC  LF
Sbjct  184  KADAPHRQRALATDVLTS--RKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRLF  241

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  242  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  301

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FING+LHLRAELTIK 
Sbjct  302  SGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIKQ  357



>ref|XP_004951268.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  365  KADAPHRQRALAAD--AVTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  422

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR++P
Sbjct  423  PSGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTRP  482

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W +FMADDS +FI+G+LHLRAELTIK 
Sbjct  483  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQTFMADDSLFFIDGMLHLRAELTIKQ  538



>ref|XP_004951269.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Setaria italica]
Length=538

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  364  KADAPHRQRALAAD--AVTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  421

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR++P
Sbjct  422  PSGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTRP  481

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W +FMADDS +FI+G+LHLRAELTIK 
Sbjct  482  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQTFMADDSLFFIDGMLHLRAELTIKQ  537



>gb|ABR16891.1| unknown [Picea sitchensis]
Length=430

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+++S    RF ER YKYRP+KV+EF  P QQC+V+LDLKR EC+ LF
Sbjct  256  KAETPHRQRSLAAEETSH--KRFSERAYKYRPVKVVEFNMPHQQCIVFLDLKRGECAGLF  313

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQ + F+CFGLFLGMQEKG VSFAV+YEFA RSKP
Sbjct  314  PSGRVYSQAFHLGGQGFFLSAHCNMDQHSAFHCFGLFLGMQEKGSVSFAVEYEFATRSKP  373

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
              +F  KYKGNYTFTGGKAVGYRNLF   W+SFMA+DSPYFI   LHLRAELTIK
Sbjct  374  LCDFAVKYKGNYTFTGGKAVGYRNLFQTPWSSFMAEDSPYFIRDTLHLRAELTIK  428



>ref|XP_010915728.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Elaeis 
guineensis]
Length=552

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K ++ HRQ     D+ +    +FVER YKYRP+KV+EFE P  QC+VYLDLKREEC+ LF
Sbjct  375  KVDAMHRQHALPTDEPTC--RQFVERAYKYRPLKVVEFERPHPQCIVYLDLKREECAKLF  432

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQ+ F+CFGLFLGMQEKG +SF VDYEFAAR++P
Sbjct  433  PSGRVYSQAFHLGGQGFFLSAHCNLDQQSSFHCFGLFLGMQEKGSISFTVDYEFAARTRP  492

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I WTSFMAD+S +FINGILHLRAELTIK 
Sbjct  493  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWTSFMADNSLFFINGILHLRAELTIKQ  548



>ref|NP_001046484.1| Os02g0260700 [Oryza sativa Japonica Group]
 dbj|BAD20083.1| putative BTB/POZ domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD20129.1| putative BTB/POZ domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF08398.1| Os02g0260700 [Oryza sativa Japonica Group]
 dbj|BAG94789.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56691.1| hypothetical protein OsJ_06150 [Oryza sativa Japonica Group]
Length=558

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD ++    +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  382  KADAPHRQRALAADVTTC--QKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR++P
Sbjct  440  PSGRMYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTRP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W++FMADDS +F++G+LHLRAELTIK 
Sbjct  500  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWSTFMADDSLFFLDGVLHLRAELTIKQ  555



>gb|EPS73437.1| hypothetical protein M569_01319, partial [Genlisea aurea]
Length=475

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 155/183 (85%), Gaps = 8/183 (4%)
 Frame = -1

Query  702  KAESSHRQR-IQAADDSSSGS------HRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKR  544
            KAE+ +RQR I A +D+S+ S      HRFVER YKYRP+KV+EFEHPRQQC+VYLDLKR
Sbjct  292  KAEAPYRQRSIVAEEDASNASSSSSLHHRFVERAYKYRPVKVVEFEHPRQQCIVYLDLKR  351

Query  543  EECSNLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEK-GLVSFAVDY  367
             EC  LFPSGR+YSQAF LGGQGFFLS HCNMDQQ+ F+CFGLFLGMQEK G V+  VDY
Sbjct  352  GECDQLFPSGRIYSQAFQLGGQGFFLSGHCNMDQQSSFHCFGLFLGMQEKGGSVNLTVDY  411

Query  366  EFAARSKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAEL  187
            EFA+R+KP+EEFV KY+GNYTFTGGKAVGYRNLFG+ WT F+A DS YFING LHLRAEL
Sbjct  412  EFASRTKPSEEFVCKYRGNYTFTGGKAVGYRNLFGLPWTEFIAADSSYFINGFLHLRAEL  471

Query  186  TIK  178
            TIK
Sbjct  472  TIK  474



>gb|EEC72875.1| hypothetical protein OsI_06647 [Oryza sativa Indica Group]
Length=558

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD ++    +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  382  KADAPHRQRALAADVTTC--RKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR++P
Sbjct  440  PSGRMYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTRP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W++FMADDS +F++G+LHLRAELTIK 
Sbjct  500  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWSTFMADDSLFFLDGVLHLRAELTIKQ  555



>ref|XP_003572201.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Brachypodium 
distachyon]
Length=552

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER YKYRP+KV+EF+ P  QC+ YLDLKR+ECS LF
Sbjct  378  KADAPHRQRALAAD--TMTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKRDECSRLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR++P
Sbjct  436  PSGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTRP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W++FMADDS +FI+G+LHLRAELTIK 
Sbjct  496  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWSTFMADDSLFFIDGMLHLRAELTIKQ  551



>ref|XP_008392473.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=558

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K+E+ HRQR  AA DS++   RFV+R YKYRP+K++EF  PR QC V+LDLK EEC+ LF
Sbjct  383  KSETPHRQRTLAAADSNAAYRRFVDRSYKYRPVKLVEFVEPRLQCSVFLDLKWEECARLF  442

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQ F LGGQGFFLSAHCN+DQQ++F+CFGLFLGMQEKG  SF VDYEF+ARSKP
Sbjct  443  PAGRVYSQPFFLGGQGFFLSAHCNLDQQSLFHCFGLFLGMQEKGSASFTVDYEFSARSKP  502

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EEF++K+KGNYTFTGGKAVGYRNL GI WT+FMADDS YF+N +LHL+AELTIK 
Sbjct  503  GEEFLTKFKGNYTFTGGKAVGYRNLLGIPWTAFMADDSIYFLNSVLHLKAELTIKQ  558



>ref|XP_007209857.1| hypothetical protein PRUPE_ppa003692mg [Prunus persica]
 gb|EMJ11056.1| hypothetical protein PRUPE_ppa003692mg [Prunus persica]
Length=555

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 149/176 (85%), Gaps = 5/176 (3%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+  RQR  A      G  RF ER YKYRPIK++EFE P  QC+V+LDLKREEC+ LF
Sbjct  385  KAEAPFRQRSLAL-----GDRRFGERSYKYRPIKLVEFEQPHDQCIVFLDLKREECARLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  440  PGGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFSARSKP  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             E+++SKYKGNYTFTGGKAVGYRNLFGI WTSFMADDS YFI+ +LHL+AELTI+ 
Sbjct  500  GEDYLSKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSIYFIDSVLHLKAELTIRQ  555



>ref|XP_002451902.1| hypothetical protein SORBIDRAFT_04g009720 [Sorghum bicolor]
 gb|EES04878.1| hypothetical protein SORBIDRAFT_04g009720 [Sorghum bicolor]
Length=538

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  364  KADAPHRQRALAAD--TVTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  421

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR++P
Sbjct  422  PAGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTRP  481

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W +FMADDS +FI+G+LHLRAELTIK 
Sbjct  482  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQTFMADDSLFFIDGMLHLRAELTIKQ  537



>ref|XP_006648521.1| PREDICTED: BTB/POZ domain-containing protein POB1-like, partial 
[Oryza brachyantha]
Length=491

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD ++    +F ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  315  KADAPHRQRALAADPTTC--RKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  372

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCN++QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR+ P
Sbjct  373  PSGRMYSQAFHLAGQGFFLSAHCNVEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTIP  432

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + +FVSKYKGNYTFTGGKAVGYRNLF I W +FMADDS +FI+G+LHLRAELTIK 
Sbjct  433  SGDFVSKYKGNYTFTGGKAVGYRNLFAIPWATFMADDSLFFIDGVLHLRAELTIKQ  488



>ref|XP_009789894.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana sylvestris]
Length=576

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA++ S+  H FVER YKYRP+KV+EFE PRQQC+VYLD KREEC++LF
Sbjct  388  KAEAPYRQRSLAAEEGSASHHCFVERAYKYRPVKVVEFELPRQQCIVYLDTKREECNSLF  447

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFAAR+KP
Sbjct  448  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKP  507

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYF  220
            TE++VSKYKGNYTFTGGKAVGYRNLFGI WT+FMA+DSPY+
Sbjct  508  TEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMAEDSPYW  548



>gb|EMS60606.1| BTB/POZ domain-containing protein POB1 [Triticum urartu]
Length=434

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  260  KADAPHRQRALAADVLTC--RKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRLF  317

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  318  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  377

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + +FVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  378  SGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  433



>ref|XP_002438463.1| hypothetical protein SORBIDRAFT_10g020060 [Sorghum bicolor]
 gb|EER89830.1| hypothetical protein SORBIDRAFT_10g020060 [Sorghum bicolor]
Length=536

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  362  KADAPHRQRALAADVMTC--RKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  420  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  480  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  535



>ref|XP_004965490.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Setaria italica]
Length=531

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  357  KADAPHRQRALAADVMTC--RKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  414

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  415  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  474

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  475  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  530



>ref|XP_008794992.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Phoenix dactylifera]
Length=569

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K ++  RQR    D+S+    +FVER YKYRP+KV+E + P  QC+VYLDLKREEC+ LF
Sbjct  378  KVDAVRRQRALPTDESTC--RQFVERAYKYRPLKVVELDRPYPQCIVYLDLKREECAKLF  435

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQ+ F+CFGLFLGMQEKG +SF VDYEFAAR++P
Sbjct  436  PSGRVYSQAFHLGGQGFFLSAHCNLDQQSSFHCFGLFLGMQEKGSISFTVDYEFAARTRP  495

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EF SKYKG YTFTGGKAVGYRNLF I WTSFMADDS  FINGILHLRAELTIK 
Sbjct  496  SGEFASKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLLFINGILHLRAELTIKQ  551



>ref|XP_004965489.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Setaria italica]
Length=541

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  367  KADAPHRQRALAADVMTC--RKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  424

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  425  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  484

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  485  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  540



>ref|XP_008794993.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Phoenix dactylifera]
Length=567

 Score =   282 bits (722),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K ++  RQR    D+S+    +FVER YKYRP+KV+E + P  QC+VYLDLKREEC+ LF
Sbjct  376  KVDAVRRQRALPTDESTC--RQFVERAYKYRPLKVVELDRPYPQCIVYLDLKREECAKLF  433

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCN+DQQ+ F+CFGLFLGMQEKG +SF VDYEFAAR++P
Sbjct  434  PSGRVYSQAFHLGGQGFFLSAHCNLDQQSSFHCFGLFLGMQEKGSISFTVDYEFAARTRP  493

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EF SKYKG YTFTGGKAVGYRNLF I WTSFMADDS  FINGILHLRAELTIK 
Sbjct  494  SGEFASKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLLFINGILHLRAELTIKQ  549



>gb|ABK24446.1| unknown [Picea sitchensis]
Length=572

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA+++S    RF ER YKYRP+KV+EF  P QQC+V+LDLKR EC+ LF
Sbjct  398  KAETPHRQRSLAAEETSH--KRFSERAYKYRPVKVVEFNMPHQQCIVFLDLKRGECAGLF  455

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQ + F+CFGLFLGMQEKG VSFAV+YEFA RSKP
Sbjct  456  PSGRVYSQAFHLGGQGFFLSAHCNMDQHSAFHCFGLFLGMQEKGSVSFAVEYEFATRSKP  515

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
              +F  KYKGNYTFTGGKAVGYRNLF   W+SFMA+DSPYFI   LHLRAELTIK
Sbjct  516  LCDFAVKYKGNYTFTGGKAVGYRNLFQTPWSSFMAEDSPYFIRDTLHLRAELTIK  570



>ref|NP_001057726.2| Os06g0507400 [Oryza sativa Japonica Group]
 dbj|BAD61652.1| putative GAMYB-binding protein [Oryza sativa Japonica Group]
 dbj|BAG89960.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80707.1| hypothetical protein OsI_23149 [Oryza sativa Indica Group]
 gb|EEE65789.1| hypothetical protein OsJ_21492 [Oryza sativa Japonica Group]
 dbj|BAF19640.2| Os06g0507400 [Oryza sativa Japonica Group]
Length=536

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  362  KADAPHRQRTLAADVLTC--RKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  420  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W+SFMADDS +FI G+LHLRAELTIK 
Sbjct  480  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWSSFMADDSLFFIEGVLHLRAELTIKQ  535



>ref|XP_008677104.1| PREDICTED: uncharacterized protein LOC100279559 isoform X1 [Zea 
mays]
 gb|ACN28605.1| unknown [Zea mays]
 gb|AFW65828.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=493

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER YKYRP+KV+EF+ P  QC+ YLDLKR+ECS LF
Sbjct  319  KADAPHRQRALAAD--AITCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKRDECSRLF  376

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  377  PAGRIYSQAFHLAGQGFFLSAHCNMEQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  436

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W  F+ADDS +F++G+LHLRAELTIK 
Sbjct  437  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQKFLADDSLFFVDGMLHLRAELTIKQ  492



>dbj|BAJ95490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  A D  +S   ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREEC  LF
Sbjct  363  KADAPHRQRALATDVLTS--RKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRLF  420

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  421  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  480

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FING+LHLRAELTIK 
Sbjct  481  SGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIKQ  536



>ref|XP_003563816.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Brachypodium 
distachyon]
Length=562

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREEC+ LF
Sbjct  388  KADAPHRQRTLAADVLTC--RKYCERAYKYRPLKVVEFDRPYPQCIAYLDLKREECTRLF  445

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  446  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  505

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FING+LHLRAELTIK 
Sbjct  506  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIKQ  561



>gb|AFW65829.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=537

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER YKYRP+KV+EF+ P  QC+ YLDLKR+ECS LF
Sbjct  363  KADAPHRQRALAAD--AITCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKRDECSRLF  420

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  421  PAGRIYSQAFHLAGQGFFLSAHCNMEQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  480

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W  F+ADDS +F++G+LHLRAELTIK 
Sbjct  481  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQKFLADDSLFFVDGMLHLRAELTIKQ  536



>gb|EMT31790.1| Kelch-like protein 26 [Aegilops tauschii]
Length=549

 Score =   280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  A D  +S   ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREEC  LF
Sbjct  375  KADAPHRQRALATDVLTS--RKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRLF  432

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  433  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  492

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FING+LHLRAELTIK 
Sbjct  493  SGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIKQ  548



>gb|AIB05667.1| TRAF transcription factor, partial [Zea mays]
Length=536

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P +QC+ YLDLKREECS LF
Sbjct  362  KADAPHRQRALAADVMTC--RKYAERAYKYRPLKVVEFDRPYRQCIAYLDLKREECSRLF  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCN+DQQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  420  PSGRIYSQAFHLAGQGFFLSAHCNVDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W  FMADDS +FI+G+LHLRAELTIK 
Sbjct  480  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPLFMADDSLFFIDGVLHLRAELTIKQ  535



>ref|NP_001146028.1| hypothetical protein [Zea mays]
 gb|ACL53061.1| unknown [Zea mays]
Length=537

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    +F ER Y+YRP+KV+EF+ P  QC+ YLDLKR+ECS LF
Sbjct  363  KADAPHRQRALAAD--AITCRKFAERAYRYRPLKVVEFDRPYPQCIAYLDLKRDECSRLF  420

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHL GQGFFLSAHCNM+QQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  421  PAGRIYSQAFHLAGQGFFLSAHCNMEQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  480

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKGNYTFTGGKAVGYRNLF I W  F+ADDS +F++G+LHLRAELTIK 
Sbjct  481  SGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQKFLADDSLFFVDGMLHLRAELTIKQ  536



>gb|ACN26008.1| unknown [Zea mays]
 gb|AFW76705.1| GAMYB-binding protein [Zea mays]
Length=536

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P +QC+ YLDLKREECS LF
Sbjct  362  KADAPHRQRALAADVMTC--RKYAERAYKYRPLKVVEFDRPYRQCIAYLDLKREECSRLF  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCN+DQQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  420  PSGRIYSQAFHLAGQGFFLSAHCNVDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W  FMADDS +FI+G+LHLRAELTIK 
Sbjct  480  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPLFMADDSLFFIDGVLHLRAELTIKQ  535



>dbj|BAJ93322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  366  KADAPHRQRALAADVLTC--RKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRLF  423

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  424  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  483

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + +FVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  484  SGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  539



>ref|NP_001148937.1| GAMYB-binding protein [Zea mays]
 gb|ACG33542.1| GAMYB-binding protein [Zea mays]
Length=536

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P +QC+ YLDLKREECS LF
Sbjct  362  KADAPHRQRALAADVMTC--RKYAERAYKYRPLKVVEFDRPYRQCIAYLDLKREECSRLF  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCN+DQQ+ FYCFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  420  PSGRIYSQAFHLAGQGFFLSAHCNVDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTRP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W  FMADDS +FI+G+LHLRAELTIK 
Sbjct  480  SGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPLFMADDSLFFIDGVLHLRAELTIKQ  535



>gb|EPS68073.1| hypothetical protein M569_06692, partial [Genlisea aurea]
Length=577

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 154/188 (82%), Gaps = 13/188 (7%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGS------------HRFVERVYKYRPIKVIEFEHPRQQCVVY  559
            KAE+ +RQR Q++  + + S            HR+ ER YKYR +K++EF+ PR QCVVY
Sbjct  387  KAEAPYRQRTQSSTAAEAPSSSSSSSSSSSTGHRYTERDYKYRSVKLVEFKLPRPQCVVY  446

Query  558  LDLKREECSNLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEK-GLVS  382
            LDLKREEC NLFPSGRVYSQAFHL GQGFFLSAHCN+DQQN F CFGLFLGMQEK G +S
Sbjct  447  LDLKREECGNLFPSGRVYSQAFHLCGQGFFLSAHCNLDQQNSFQCFGLFLGMQEKGGSLS  506

Query  381  FAVDYEFAARSKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILH  202
            FAV+YEF+AR+K TEEFVSKYKGNYTFTGGKAVGYRNLF + W SFMA+DS YFINGILH
Sbjct  507  FAVEYEFSARTKATEEFVSKYKGNYTFTGGKAVGYRNLFSMPWNSFMAEDSNYFINGILH  566

Query  201  LRAELTIK  178
            LRAELTIK
Sbjct  567  LRAELTIK  574



>gb|EMT31791.1| hypothetical protein F775_32011 [Aegilops tauschii]
Length=662

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  488  KADAPHRQRALAADVLTC--RKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRLF  545

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  546  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  605

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + +FVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  606  SGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  661



>gb|AAT40121.1| GAMYB-binding protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  407  KADAPHRQRALAADVLTC--RKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRLF  464

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  465  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  524

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + +FVSKYKG YTFTGGKAVGYRNLF I W SFMADDS +FI+G+LHLRAELTIK 
Sbjct  525  SGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIKQ  580



>ref|XP_004298859.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=543

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K+E+ +RQR+ A +++++    FV+R YKYRP+K++EFE P  QC+VYLDLKREEC+ LF
Sbjct  368  KSETPYRQRLLAVENANATYRGFVDRSYKYRPVKIVEFELPHPQCIVYLDLKREECARLF  427

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAF+LGGQGFFLSAHCNMDQQN F C GLFLGMQEKG VSF VDYEF+ R KP
Sbjct  428  PAGRVYSQAFNLGGQGFFLSAHCNMDQQNSFQCLGLFLGMQEKGSVSFVVDYEFSVRVKP  487

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EEF SK+KG YTFTGGKAVGYRNL  I WT+FMADDS YFIN +LHL+AEL I+ 
Sbjct  488  EEEFQSKHKGTYTFTGGKAVGYRNLLAIPWTTFMADDSIYFINSVLHLQAELIIRQ  543



>ref|XP_011463940.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=548

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K+E+ +RQR+ A +++++    FV+R YKYRP+K++EFE P  QC+VYLDLKREEC+ LF
Sbjct  373  KSETPYRQRLLAVENANATYRGFVDRSYKYRPVKIVEFELPHPQCIVYLDLKREECARLF  432

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAF+LGGQGFFLSAHCNMDQQN F C GLFLGMQEKG VSF VDYEF+ R KP
Sbjct  433  PAGRVYSQAFNLGGQGFFLSAHCNMDQQNSFQCLGLFLGMQEKGSVSFVVDYEFSVRVKP  492

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
             EEF SK+KG YTFTGGKAVGYRNL  I WT+FMADDS YFIN +LHL+AEL I+ 
Sbjct  493  EEEFQSKHKGTYTFTGGKAVGYRNLLAIPWTTFMADDSIYFINSVLHLQAELIIRQ  548



>emb|CAD23158.1| hypothetical protein [Oryza sativa]
Length=163

 Score =   263 bits (673),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  642  HRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLFPSGRVYSQAFHLGGQGFFLS  463
             +F ER YKYRP+KV+EF+ P  QC+ YL LKREECS LFPSGR+YSQAFHL GQGFFLS
Sbjct  5    QKFAERAYKYRPLKVVEFDRPYPQCIAYLGLKREECSRLFPSGRMYSQAFHLAGQGFFLS  64

Query  462  AHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKGNYTFTGGKAV  283
            AHCNM+QQ+ FYCFGLFLGMQEKG +S  VDYEFAAR+ P+ EFVSKYKGNYTFTGGKAV
Sbjct  65   AHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTSPSGEFVSKYKGNYTFTGGKAV  124

Query  282  GYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            GYRNLF I W++FMADDS +F++G+LHLRAELTIK
Sbjct  125  GYRNLFAIPWSTFMADDSLFFLDGVLHLRAELTIK  159



>ref|XP_006656117.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Oryza 
brachyantha]
Length=537

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  362  KADAPHRQRALAADVLTC--RKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRLF  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  V+YEFAAR+KP
Sbjct  420  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVEYEFAARTKP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            + EFVSKYKG YTFTGGKAVGYRNLF I W+SFMADDS +FI+G+LHLRA LTI +
Sbjct  480  SSEFVSKYKGYYTFTGGKAVGYRNLFAIPWSSFMADDSLFFIDGVLHLRAVLTINN  535



>ref|XP_009116827.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Brassica 
rapa]
Length=549

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E+ H+QR  AA++S+S   R VER YKYRP+KV+EFE P   CVVYLDLKREEC  LF
Sbjct  369  KTEAPHKQRSLAAEESASEHRRLVERAYKYRPVKVLEFEFPTPHCVVYLDLKREECIGLF  428

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR++SQAFHLGGQGFFLSAHCNMDQQ+  +CFGLFLGMQEKG + F VDYEF+ARS P
Sbjct  429  PSGRIFSQAFHLGGQGFFLSAHCNMDQQSSDHCFGLFLGMQEKGSMGFGVDYEFSARSSP  488

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFM-ADDSPYFINGILHLRAELTIK  178
            +EEF SKYKGNYTFTGGKA+GYRNLFGI WTSF+  +D+  FINGILHL+AELT++
Sbjct  489  SEEFESKYKGNYTFTGGKAIGYRNLFGIPWTSFVEEEDNVNFINGILHLKAELTVR  544



>emb|CDY11366.1| BnaA09g39320D [Brassica napus]
Length=550

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K E+ H+QR  AA++S+S   R VER YKYRP+KV+EFE P   CVVYLDLKREEC  LF
Sbjct  370  KTEAPHKQRSLAAEESASEHRRLVERAYKYRPVKVLEFEFPTPHCVVYLDLKREECIGLF  429

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR++SQAFHLGGQGFFLSAHCN+DQQ+  +CFGLFLGMQEKG + F VDYEF+ARS P
Sbjct  430  PSGRIFSQAFHLGGQGFFLSAHCNLDQQSSDHCFGLFLGMQEKGSMGFGVDYEFSARSSP  489

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFM-ADDSPYFINGILHLRAELTIK  178
            +EEF SKYKGNYTFTGGKA+GYRNLFGI WTSF+  +D+  FINGILHL+AELT++
Sbjct  490  SEEFESKYKGNYTFTGGKAIGYRNLFGIPWTSFVEEEDNVNFINGILHLKAELTVR  545



>gb|EPS71516.1| hypothetical protein M569_03239, partial [Genlisea aurea]
Length=559

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  660  DSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLFPSGRVYSQAFHLGG  481
            ++S+    FVER Y+YRP+KV+ F+ PR QCVVYLDLKREEC  L+PSGRVYSQAFHLGG
Sbjct  399  NNSNNPASFVERAYRYRPVKVVVFDLPRPQCVVYLDLKREECERLYPSGRVYSQAFHLGG  458

Query  480  QGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKGNYTF  301
            QGFFLSAHCNMDQQ+   CFGLFLGMQEKG V+F VDYEFAAR++ +EEFVSKYKGNYTF
Sbjct  459  QGFFLSAHCNMDQQSSTPCFGLFLGMQEKGSVTFTVDYEFAARTRSSEEFVSKYKGNYTF  518

Query  300  TGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            TGGKAVGYRNLF I W++FMA+DS YFING+LHLRAELT+K
Sbjct  519  TGGKAVGYRNLFSISWSTFMAEDSVYFINGMLHLRAELTVK  559



>emb|CDP12109.1| unnamed protein product [Coffea canephora]
Length=832

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR   A++S++   RFVER YKYRP+KV+EFE PRQQC+VYLDLKREEC+NLF
Sbjct  394  KAEAPYRQRSLVAEESNTSYRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECANLF  453

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSFAVDYEFA+RSKP
Sbjct  454  PAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFASRSKP  513

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWT  250
            TEE+ SKYKGNYTFTGGKAVGYRNLFG+G T
Sbjct  514  TEEYTSKYKGNYTFTGGKAVGYRNLFGMGLT  544



>gb|KHN35061.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=459

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA D+ +   R VER YK R +KV+EF  PR +CVVYLDLK+EEC+  F
Sbjct  284  KAETPYRQRSLAAQDAGTTYSRLVERAYKLRHVKVVEFALPRPRCVVYLDLKKEECAQFF  343

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+ R+YSQAF LG Q FFLSA CNMDQQN  +CFGLFL +Q KG VS  VDYEFAARSK 
Sbjct  344  PNARIYSQAFPLGEQWFFLSARCNMDQQNASHCFGLFLAVQFKGSVSLHVDYEFAARSKS  403

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++S+ KG+YTFT GKAVGYRNLFGI WT+F+ADDS +FI G+LHLRAELTI+ 
Sbjct  404  TEEYISRCKGDYTFTAGKAVGYRNLFGIPWTAFIADDSHFFIKGLLHLRAELTIRQ  459



>ref|XP_001771535.1| predicted protein [Physcomitrella patens]
 gb|EDQ63735.1| predicted protein [Physcomitrella patens]
Length=539

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 140/175 (80%), Gaps = 3/175 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE SHRQR  A +++     R+ ER YKYRP+KV++F+    QC+VYLDLK +EC  L+
Sbjct  363  KAEPSHRQRQLAMEETMH--KRYCERAYKYRPVKVVDFD-TSSQCLVYLDLKLDECRALY  419

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P GRVY+QAFHLGGQGFFLSAHCN+DQQ  + CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  420  PQGRVYTQAFHLGGQGFFLSAHCNLDQQGQYKCFGLFLGMQEKGSVSFAVDYEFAARMKP  479

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T EF  K KG+Y FTGGKAVGYRNLFG+ W  F+A+ SPYF N I+HLRAELTIK
Sbjct  480  TWEFTPKSKGSYVFTGGKAVGYRNLFGMQWQDFIAEGSPYFRNNIVHLRAELTIK  534



>ref|XP_006590500.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=520

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ +RQR  AA D+ +   R VER YK R +KV+EF  PR +CVVYLDLK+EEC+  F
Sbjct  345  KAETPYRQRSLAAQDAGTTYSRLVERAYKLRHVKVVEFALPRPRCVVYLDLKKEECAQFF  404

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+ R+YSQAF LG Q FFLSA CNMDQQN  +CFGLFL +Q KG VS  VDYEFAARSK 
Sbjct  405  PNARIYSQAFPLGEQWFFLSARCNMDQQNASHCFGLFLAVQFKGSVSLHVDYEFAARSKS  464

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TEE++S+ KG+YTFT GKAVGYRNLFGI WT+F+ADDS +FI G+LHLRAELTI+ 
Sbjct  465  TEEYISRCKGDYTFTAGKAVGYRNLFGIPWTAFIADDSHFFIKGLLHLRAELTIRQ  520



>ref|XP_001760430.1| predicted protein [Physcomitrella patens]
 gb|EDQ74821.1| predicted protein [Physcomitrella patens]
Length=542

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 141/175 (81%), Gaps = 3/175 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE SHRQR  A +++     R+ ER YKYRP+KV++F+    QC+VYLDLK +EC  L+
Sbjct  367  KAEPSHRQRQLAMEETMH--KRYCERAYKYRPVKVVDFD-TSSQCLVYLDLKIDECRALY  423

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P GRVYSQAFHLGGQGFFLSAHCN+DQQ    CFGLFLGMQEKG VSFAVDYEFAAR KP
Sbjct  424  PQGRVYSQAFHLGGQGFFLSAHCNLDQQGQCKCFGLFLGMQEKGSVSFAVDYEFAARMKP  483

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T EF+ K KG+Y FTGGKAVGYRNLFG+ W  F+A++SPYF + I+HLRAELTIK
Sbjct  484  TWEFMPKSKGSYVFTGGKAVGYRNLFGMQWQDFIAEESPYFRDSIVHLRAELTIK  538



>emb|CDY42028.1| BnaC04g01060D [Brassica napus]
Length=507

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = -1

Query  594  EFEH--PRQQCVVYLDLKREECSNLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCF  421
            +F+H    +QCVVYLDLKREEC+ LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CF
Sbjct  362  DFDHEVASKQCVVYLDLKREECTGLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCF  421

Query  420  GLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFM  241
            GLFLGMQEKG VSF VDYEFAAR KP++++  KYKGNYTFTGGKAVGYRNLFGI WTSF+
Sbjct  422  GLFLGMQEKGAVSFGVDYEFAAREKPSQDYACKYKGNYTFTGGKAVGYRNLFGIPWTSFI  481

Query  240  ADDSPYFINGILHLRAELTIK  178
            A+DS YFI+GILHLRAELTIK
Sbjct  482  AEDSQYFIDGILHLRAELTIK  502



>emb|CDX80003.1| BnaA05g01530D [Brassica napus]
Length=513

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = -1

Query  594  EFEH--PRQQCVVYLDLKREECSNLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCF  421
            +F+H    +QCVVYLDLKREEC+ LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CF
Sbjct  368  DFDHEVASKQCVVYLDLKREECTGLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCF  427

Query  420  GLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFM  241
            GLFLGMQEKG VSF VDYEFAAR KP++++  KYKGNYTFTGGKAVGYRNLFGI WTSF+
Sbjct  428  GLFLGMQEKGAVSFGVDYEFAAREKPSQDYACKYKGNYTFTGGKAVGYRNLFGIPWTSFI  487

Query  240  ADDSPYFINGILHLRAELTIK  178
            A+DS YFI+GILHLRAELTIK
Sbjct  488  AEDSQYFIDGILHLRAELTIK  508



>ref|XP_010314497.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Solanum lycopersicum]
Length=537

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR+  A++ ++    FVER YK+RPIKV+ FE P QQC+VYLDL R+EC+NLF
Sbjct  362  KAEAPHRQRLLVAEEGNASCSSFVERAYKFRPIKVLNFELPFQQCIVYLDLNRQECNNLF  421

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YS+AFHLGGQGF+LSA CNMDQQN F+ FG+FL MQE+GL +F VD++FAA +  
Sbjct  422  PAGRIYSEAFHLGGQGFYLSARCNMDQQNSFHWFGMFLSMQEQGLETFTVDFDFAALTTL  481

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +E++VS++KG++TFT GK VG+RNL GI WT+F+A  S YFING+L LRA LT + 
Sbjct  482  SEDYVSRFKGSHTFTRGKGVGFRNLVGIPWTTFIAQGSVYFINGVLRLRAVLTARQ  537



>ref|XP_004252576.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Solanum lycopersicum]
Length=555

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR+  A++ ++    FVER YK+RPIKV+ FE P QQC+VYLDL R+EC+NLF
Sbjct  380  KAEAPHRQRLLVAEEGNASCSSFVERAYKFRPIKVLNFELPFQQCIVYLDLNRQECNNLF  439

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YS+AFHLGGQGF+LSA CNMDQQN F+ FG+FL MQE+GL +F VD++FAA +  
Sbjct  440  PAGRIYSEAFHLGGQGFYLSARCNMDQQNSFHWFGMFLSMQEQGLETFTVDFDFAALTTL  499

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +E++VS++KG++TFT GK VG+RNL GI WT+F+A  S YFING+L LRA LT + 
Sbjct  500  SEDYVSRFKGSHTFTRGKGVGFRNLVGIPWTTFIAQGSVYFINGVLRLRAVLTARQ  555



>ref|XP_010314496.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Solanum lycopersicum]
Length=553

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR+  A++ ++    FVER YK+RPIKV+ FE P QQC+VYLDL R+EC+NLF
Sbjct  378  KAEAPHRQRLLVAEEGNASCSSFVERAYKFRPIKVLNFELPFQQCIVYLDLNRQECNNLF  437

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GR+YS+AFHLGGQGF+LSA CNMDQQN F+ FG+FL MQE+GL +F VD++FAA +  
Sbjct  438  PAGRIYSEAFHLGGQGFYLSARCNMDQQNSFHWFGMFLSMQEQGLETFTVDFDFAALTTL  497

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +E++VS++KG++TFT GK VG+RNL GI WT+F+A  S YFING+L LRA LT + 
Sbjct  498  SEDYVSRFKGSHTFTRGKGVGFRNLVGIPWTTFIAQGSVYFINGVLRLRAVLTARQ  553



>ref|XP_002961299.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
 gb|EFJ38838.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
Length=542

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQ+    ++      RF ER YKYRP+KV+EF+ P QQC+V+LDL++EEC  L+
Sbjct  363  KAEPPHRQKHIMVEEIVH--KRFSERAYKYRPVKVVEFDAPYQQCLVFLDLRKEECLTLW  420

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P GRVYSQAFHLGGQ FFLSAHC++DQQ   +CFGLFLGMQEKG VSFAV+YEFAARSK 
Sbjct  421  PQGRVYSQAFHLGGQCFFLSAHCSVDQQTAAHCFGLFLGMQEKGSVSFAVEYEFAARSKQ  480

Query  342  TE-EFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             E +F  + KGNY FTGGKAVGYRNLF   W   M DDS YF   +LHLRAELTIK
Sbjct  481  EEWKFAPRVKGNYVFTGGKAVGYRNLFSCPWQELMKDDSDYFHQNVLHLRAELTIK  536



>ref|XP_002983257.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
 gb|EFJ15599.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
Length=542

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  HRQ+    ++      RF ER YKYRP+KV+EF+ P QQC+V+LDL++EEC  L+
Sbjct  363  KAEPPHRQKHIMVEEIVH--KRFSERAYKYRPVKVVEFDAPYQQCLVFLDLRKEECLTLW  420

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P GRVYSQAFHLGGQ FFLSAHC++DQQ   +CFGLFLGMQEKG VSFAV+YEFAARSK 
Sbjct  421  PQGRVYSQAFHLGGQCFFLSAHCSVDQQTAAHCFGLFLGMQEKGSVSFAVEYEFAARSKQ  480

Query  342  TE-EFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
             E +F  + KGNY FTGGKAVGYRNLF   W   M DDS YF   +LHLRAELTIK
Sbjct  481  EEWKFAPRVKGNYVFTGGKAVGYRNLFSCPWQELMKDDSDYFHQNVLHLRAELTIK  536



>gb|AAO25541.1| GAMYB-binding protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   228 bits (582),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KA++ HRQR  AAD  +    ++ ER YKYRP+KV+EF+ P  QC+ YLDLKREECS LF
Sbjct  100  KADAPHRQRALAADVLTC--RKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRLF  157

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGR+YSQAFHL GQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG  S  VDYEFAAR++P
Sbjct  158  PSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTRP  217

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLF  265
            + +FVSKYKG YTFTGGKAVGYRNLF
Sbjct  218  SGDFVSKYKGYYTFTGGKAVGYRNLF  243



>gb|AFK44513.1| unknown [Lotus japonicus]
Length=199

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  672  QAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLFPSGRVYSQAF  493
            Q+   S+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+ LFPSGRV SQ F
Sbjct  34   QSLTASASLNSRFVERAYKYRPVKVVEFEVPRQQCVVYLDLKREECAALFPSGRVKSQTF  93

Query  492  HLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKG  313
            HL G+ F L   C+++++    CF L +GM++K   SF VD EFAARS+P +EFV+KYK 
Sbjct  94   HLCGRKFLLLGACSLNKRGTSRCFELAVGMKKKSSGSFVVDCEFAARSRPAKEFVTKYKS  153

Query  312  NYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +YTFTGG  VG  NLF + W+ FMA+DSP+FING+LHL+AE T++H
Sbjct  154  HYTFTGGTFVGTGNLFKVTWSKFMAEDSPFFINGVLHLKAEFTVRH  199



>gb|AFK40268.1| unknown [Lotus japonicus]
Length=199

 Score =   219 bits (559),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  672  QAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLFPSGRVYSQAF  493
            Q+   S+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+ LFPSGRV  Q F
Sbjct  34   QSLTASASLNSRFVERAYKYRPVKVVEFEVPRQQCVVYLDLKREECAALFPSGRVKFQTF  93

Query  492  HLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKG  313
            HL G  F L   C+++++    CF L +GM++K   SF VD EFAARS+P +EFV+KYK 
Sbjct  94   HLCGWKFLLLGACSLNKRGTSRCFELAVGMKKKSSGSFVVDCEFAARSRPAKEFVTKYKS  153

Query  312  NYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +YTFTGG  VG  NLF + W+ FMA+DSP+FING+LHL+AE T++H
Sbjct  154  HYTFTGGTFVGTGNLFKVTWSKFMAEDSPFFINGVLHLKAEFTVRH  199



>ref|NP_192025.2| BTB/POZ/Kelch-associated protein [Arabidopsis thaliana]
 gb|AEE81989.1| BTB/POZ/Kelch-associated protein [Arabidopsis thaliana]
Length=505

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = -1

Query  702  KAES-SHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            K ES +H+  + A +  +S S RF +R Y +RPIK++EF  PR QC++YLDLKR+EC ++
Sbjct  327  KTESLAHQHVLLAHEQPASTSRRFAKRAYVHRPIKIVEFAVPRPQCIIYLDLKRKECESI  386

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKG--LVSFAVDYEFAAR  352
            +PS R+ SQ F LGGQGFFLSA CNMD   + +CFGLF+GMQE G    S  VDY+F+ R
Sbjct  387  YPSSRISSQQFTLGGQGFFLSAQCNMDHLCLIHCFGLFIGMQENGSASASVTVDYDFSVR  446

Query  351  SKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            SKPT EFV K+KG YTFT GKAVG RNL GI W  F A + PYFIN +LHLRA+L+I+
Sbjct  447  SKPTMEFVGKFKGIYTFTRGKAVGCRNLLGIPWDIFTAKNCPYFINDVLHLRADLSIR  504



>sp|O04615.1|Y4116_ARATH RecName: Full=BTB/POZ domain-containing protein At4g01160 [Arabidopsis 
thaliana]
 gb|AAB61041.1| A_IG002N01.11 gene product [Arabidopsis thaliana]
 emb|CAB80925.1| predicted protein [Arabidopsis thaliana]
Length=527

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = -1

Query  702  KAES-SHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            K ES +H+  + A +  +S S RF +R Y +RPIK++EF  PR QC++YLDLKR+EC ++
Sbjct  349  KTESLAHQHVLLAHEQPASTSRRFAKRAYVHRPIKIVEFAVPRPQCIIYLDLKRKECESI  408

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKG--LVSFAVDYEFAAR  352
            +PS R+ SQ F LGGQGFFLSA CNMD   + +CFGLF+GMQE G    S  VDY+F+ R
Sbjct  409  YPSSRISSQQFTLGGQGFFLSAQCNMDHLCLIHCFGLFIGMQENGSASASVTVDYDFSVR  468

Query  351  SKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            SKPT EFV K+KG YTFT GKAVG RNL GI W  F A + PYFIN +LHLRA+L+I+
Sbjct  469  SKPTMEFVGKFKGIYTFTRGKAVGCRNLLGIPWDIFTAKNCPYFINDVLHLRADLSIR  526



>gb|AFK33622.1| unknown [Lotus japonicus]
Length=418

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  672  QAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLFPSGRVYSQAF  493
            Q+   S+S + RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC+ LFPSGRV  Q F
Sbjct  253  QSLTASASLNSRFVERAYKYRPVKVVEFEVPRQQCVVYLDLKREECAALFPSGRVKFQTF  312

Query  492  HLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKPTEEFVSKYKG  313
            HL G+ F L   C+++++    CF L +GM++K   SF VD EFAARS+P +EFV+KYK 
Sbjct  313  HLCGRKFLLLGACSLNKRGTSRCFELAVGMKKKSSGSFVVDCEFAARSRPAKEFVTKYKS  372

Query  312  NYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            +YTFTGG  VG  NLF + W+ FMA+DSP+FING+LHL+AE T++H
Sbjct  373  HYTFTGGTFVGTGNLFKVTWSKFMAEDSPFFINGVLHLKAEFTVRH  418



>ref|XP_002872906.1| A_IG002N01.11 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49165.1| A_IG002N01.11 protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = -1

Query  702  KAES-SHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNL  526
            K ES +H++ + A +  +S S  F +R Y  RPIK++EF  PR QC++YLDLKR+EC ++
Sbjct  326  KTESLAHQRFLLAHEQPASTSRWFAKRAYVQRPIKIVEFAAPRPQCIIYLDLKRKECESI  385

Query  525  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVS--FAVDYEFAAR  352
            +P+ R+ SQ F LGGQGFFLSA CNMD   I +CFGLF+GMQE G  S    VDYEF+ R
Sbjct  386  YPASRISSQPFTLGGQGFFLSAQCNMDHLCIIHCFGLFIGMQENGSASATVTVDYEFSVR  445

Query  351  SKPTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            SKPT EFV K+KGNYTF+ GKAVG RNL  I W  F A + PYFIN +LHLRA+L+I+
Sbjct  446  SKPTMEFVGKFKGNYTFSRGKAVGCRNLLAIPWDIFTAKNCPYFINDVLHLRADLSIR  503



>ref|XP_006396293.1| hypothetical protein EUTSA_v10028626mg [Eutrema salsugineum]
 gb|ESQ37746.1| hypothetical protein EUTSA_v10028626mg [Eutrema salsugineum]
Length=476

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAES   +R  A    S     F ER Y++RPIKV+EFE PR+QC+V+LDLK+ EC++L+
Sbjct  301  KAESVTLRRQFATAQPSPYKRWFFERAYRFRPIKVVEFEVPRRQCIVFLDLKQNECADLY  360

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PS R+ SQ F LGGQ F LSA CNMDQ N+ + FGL++ M   G +S  VDYEF+ARSKP
Sbjct  361  PSSRILSQRFPLGGQEFHLSADCNMDQLNLSHRFGLYIWMH--GSMSLTVDYEFSARSKP  418

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIKH  175
            TE+F  K +G YTFTGGKA+G+R++F   W SF+A+DSPYFIN +LHLRAEL+I++
Sbjct  419  TEDFAVKCRGKYTFTGGKAIGFRDMFATPWDSFIAEDSPYFINDVLHLRAELSIRN  474



>ref|XP_010466718.1| PREDICTED: BTB/POZ domain-containing protein At4g01160-like [Camelina 
sativa]
Length=529

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAES  ++R+ A    +S    F ER Y YRPIK++EFE PR QC+VYLDLKR+EC ++ 
Sbjct  357  KAESLDKRRLLAHAQPASW---FAERAYIYRPIKIVEFEVPRHQCIVYLDLKRKECESIR  413

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PS  + SQ F LGGQ F LSAH NMDQ   FYCFGLFL M+E G  S +VD EF+ RSKP
Sbjct  414  PSSWITSQTFSLGGQEFVLSAHRNMDQPGAFYCFGLFLWMRETGSASLSVDLEFSVRSKP  473

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            T EF  K KGNY+FT GK+ G+RNL  I W  F+A++SPYFIN +LHLRA+L+I+
Sbjct  474  TLEFEKKIKGNYSFTRGKSAGFRNLLLIPWDDFVAENSPYFINDVLHLRADLSIR  528



>gb|ADG38652.1| AT3G61600-like protein, partial [Neslia paniculata]
Length=174

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++S+S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC+ LF
Sbjct  54   KAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGLF  113

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  114  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  173

Query  342  T  340
             
Sbjct  174  A  174



>gb|KJB52236.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=514

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            K+E  HRQR  AA+++++   RFVER YKYRP+KV+EFE PRQQCVVYLDLKREEC++LF
Sbjct  387  KSEMPHRQRALAAEEANATYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTHLF  446

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P+GRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQE+G V+FAVDYEFAARSKP
Sbjct  447  PAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQERGSVTFAVDYEFAARSKP  506

Query  342  TEEF  331
            TE++
Sbjct  507  TEDY  510



>emb|CDX91882.1| BnaC03g31840D [Brassica napus]
Length=473

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAESS     QAA  + S   RF+ER Y  RPIK +EFE P +QC+VYLDL R+EC+ L+
Sbjct  299  KAESSLAH--QAAIKADSHDRRFIERGYTCRPIKTVEFEVPHRQCIVYLDLTRKECNALY  356

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGL-VSFAVDYEFAARSK  346
            PS R+YSQ FHLGG+ F LS  CN DQQN F+ FGLFL  QEKG  VS  VDYEF++R K
Sbjct  357  PSNRIYSQKFHLGGKEFLLSPCCNKDQQNRFHHFGLFLWSQEKGTSVSVTVDYEFSSRWK  416

Query  345  PTEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTIK  178
            PT+EF  + KG Y FTG +++G+R++ G  W SF+ +DSPYFIN +LHLRAEL+I+
Sbjct  417  PTQEFAIRRKGKYKFTGVQSIGFRDVLGAPWASFIGEDSPYFINDLLHLRAELSIR  472



>ref|XP_006343901.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=494

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE  ++Q   AA   ++ + R+VER YK RP+K +EFE P QQ VVYLDLK +EC+NLF
Sbjct  318  KAEPPYQQGEIAARVENTFNKRYVERAYKLRPVKALEFEAPHQQSVVYLDLKNDECTNLF  377

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            P G+++SQ FHLGGQ  FLSAHCN++QQ +++C GLFLGMQ +     AVDYEF+ R +P
Sbjct  378  PEGKIFSQGFHLGGQELFLSAHCNIEQQGVYHCLGLFLGMQGEESEPLAVDYEFSVRVRP  437

Query  342  TEEFVSKYKGNYTFTGGKAVGYRNLFGIGWTSFMADDSPYFINGILHLRAELTI  181
              EFVS YKG++T + G  VG  NL G+ W  F+++DS YFI+ ILH+RA++T+
Sbjct  438  DNEFVSMYKGSHTLSSGIVVGCHNLCGVTWIPFLSEDSLYFIDEILHIRADITV  491



>gb|AEN82266.1| AT3G61600-like protein, partial [Capsella rubella]
 gb|AEN82268.1| AT3G61600-like protein, partial [Capsella rubella]
Length=174

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  702  KAESSHRQRIQAADDSSSGSHRFVERVYKYRPIKVIEFEHPRQQCVVYLDLKREECSNLF  523
            KAE+ HRQR  AA++++S + R +ER YKYRP+KV+EFE PR QCVVYLDLKREEC  LF
Sbjct  54   KAEAPHRQRSLAAEETASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECLGLF  113

Query  522  PSGRVYSQAFHLGGQGFFLSAHCNMDQQNIFYCFGLFLGMQEKGLVSFAVDYEFAARSKP  343
            PSGRVYSQAFHLGGQGFFLSAHCNMDQQ+ F+CFGLFLGMQEKG VSF VDYEF+ARSKP
Sbjct  114  PSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSKP  173

Query  342  T  340
             
Sbjct  174  A  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335