BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036P13

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG21667.1|  Heat shock cognate 80                                   267   1e-81   Gossypium arboreum [tree cotton]
gb|EYU33725.1|  hypothetical protein MIMGU_mgv1a002215mg                266   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 266   3e-80   Tarenaya hassleriana [spider flower]
ref|XP_004135777.1|  PREDICTED: heat shock protein 90-2-like            262   1e-79   
ref|NP_001234439.1|  heat shock cognate protein 80                      263   4e-79   Solanum lycopersicum
gb|KGN66050.1|  hypothetical protein Csa_1G569270                       262   6e-79   Cucumis sativus [cucumbers]
ref|XP_010446135.1|  PREDICTED: heat shock protein 90-3-like            255   7e-79   Camelina sativa [gold-of-pleasure]
dbj|BAG16518.1|  putative Hsp90-2                                       261   2e-78   Capsicum chinense [bonnet pepper]
ref|XP_006413166.1|  hypothetical protein EUTSA_v10024564mg             261   3e-78   Eutrema salsugineum [saltwater cress]
ref|XP_010235281.1|  PREDICTED: heat shock protein 81-1-like            260   4e-78   Brachypodium distachyon [annual false brome]
ref|XP_010433476.1|  PREDICTED: heat shock protein 90-2-like            260   5e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010235286.1|  PREDICTED: heat shock protein 81-1-like            259   6e-78   Brachypodium distachyon [annual false brome]
ref|XP_009126978.1|  PREDICTED: heat shock protein 90-2-like            259   8e-78   Brassica rapa
ref|XP_010443242.1|  PREDICTED: heat shock protein 90-2                 259   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010483070.1|  PREDICTED: heat shock protein 90-3-like            259   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006287183.1|  hypothetical protein CARUB_v10000353mg             259   1e-77   Capsella rubella
ref|XP_010438732.1|  PREDICTED: heat shock protein 90-2-like            259   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_002869603.1|  early-responsive to dehydration 8                  258   1e-77   Arabidopsis lyrata subsp. lyrata
gb|KFK25886.1|  hypothetical protein AALP_AA8G175000                    258   2e-77   Arabis alpina [alpine rockcress]
ref|XP_006280103.1|  hypothetical protein CARUB_v10025991mg             257   5e-77   Capsella rubella
ref|XP_006280102.1|  hypothetical protein CARUB_v10025991mg             256   5e-77   
dbj|BAF01967.1|  HEAT SHOCK PROTEIN 81-2                                243   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132299.1|  PREDICTED: heat shock protein 90-2-like            257   5e-77   Brassica rapa
gb|KFK29176.1|  hypothetical protein AALP_AA7G099100                    257   5e-77   Arabis alpina [alpine rockcress]
ref|XP_010443241.1|  PREDICTED: heat shock protein 90-3-like            257   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006413591.1|  hypothetical protein EUTSA_v10024561mg             257   7e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010483071.1|  PREDICTED: heat shock protein 90-3-like            256   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010483069.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    256   9e-77   
gb|KFK40163.1|  hypothetical protein AALP_AA3G338900                    256   9e-77   Arabis alpina [alpine rockcress]
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like            256   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010450563.1|  PREDICTED: heat shock protein 90-3-like            256   1e-76   Camelina sativa [gold-of-pleasure]
gb|AAN77149.1|  fiber protein Fb9                                       240   3e-76   Gossypium barbadense [Egyptian cotton]
ref|XP_006401391.1|  hypothetical protein EUTSA_v10012832mg             255   3e-76   Eutrema salsugineum [saltwater cress]
gb|KFK27172.1|  hypothetical protein AALP_AA8G344900                    255   3e-76   Arabis alpina [alpine rockcress]
gb|AAF31705.1|AF221856_1  heat-shock protein 80                         244   7e-76   Euphorbia esula [wolf's milk]
gb|AAB33937.1|  heat-shock Protein                                      253   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|ACX37413.1|  cytosolic heat shock protein 90.1                       253   1e-75   Dactylis glomerata [cocksfoot]
dbj|BAJ86355.1|  predicted protein                                      253   1e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACX37414.1|  cytosolic heat shock protein 90.2                       253   2e-75   Dactylis glomerata [cocksfoot]
gb|ADF31757.1|  heat shock protein 90                                   253   2e-75   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006280101.1|  hypothetical protein CARUB_v10025990mg             253   3e-75   Capsella rubella
dbj|BAD95027.1|  heat shock protein 90                                  243   5e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AEY83982.1|  heat shock protein 80 KDa                               237   1e-74   Triticum aestivum [Canadian hard winter wheat]
gb|KFK38607.1|  hypothetical protein AALP_AA3G136000                    249   2e-74   Arabis alpina [alpine rockcress]
gb|KJB13948.1|  hypothetical protein B456_002G103000                    248   3e-74   Gossypium raimondii
gb|AAN61003.1|  putative heat shock protein 90                          246   4e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHG19401.1|  Heat shock cognate 80                                   249   4e-74   Gossypium arboreum [tree cotton]
gb|ABF61871.1|  chaperone                                               234   5e-74   Agave tequilana
emb|CAJ19348.1|  heat shock protein 90                                  248   5e-74   Triticum aestivum [Canadian hard winter wheat]
ref|NP_200411.1|  Heat shock protein 90-4                               249   5e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AHM23830.1|  heat shock protein 90                                   242   6e-74   Brassica rapa
gb|AAN31859.1|  putative heat shock protein 81-2 (HSP81-2)              249   6e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AAP87284.1|  cytosolic heat shock protein 90                         249   6e-74   Hordeum vulgare [barley]
gb|ABG57075.1|  heat shock protein 90                                   249   7e-74   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99646.1|  predicted protein                                      249   7e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADF31760.1|  heat shock protein 90                                   249   7e-74   Triticum aestivum [Canadian hard winter wheat]
gb|KHG22758.1|  Heat shock cognate 80                                   249   7e-74   Gossypium arboreum [tree cotton]
gb|KJB13949.1|  hypothetical protein B456_002G103000                    248   1e-73   Gossypium raimondii
gb|EMT17245.1|  Heat shock protein 81-3                                 249   1e-73   
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like      248   1e-73   Sesamum indicum [beniseed]
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              248   1e-73   Cicer arietinum [garbanzo]
ref|NP_001274833.1|  Hsp90-2-like                                       248   2e-73   Solanum tuberosum [potatoes]
gb|AGA62462.1|  heat shock protein 90                                   248   2e-73   Gossypium hirsutum [American cotton]
gb|AAH08189.1|  Unknown (protein for IMAGE:3584589)                     243   2e-73   Mus musculus [mouse]
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            248   2e-73   Phoenix dactylifera
gb|AGT98548.1|  heat shock protein 90                                   237   2e-73   Paeonia lactiflora [common garden peony]
tpg|DAA40367.1|  TPA: putative heat shock protein 90 family protein     239   2e-73   
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80           247   3e-73   Sesamum indicum [beniseed]
gb|KJB22185.1|  hypothetical protein B456_004G034000                    246   4e-73   Gossypium raimondii
ref|NP_200414.1|  heat shock protein 81-2                               247   4e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KHN23824.1|  Heat shock cognate protein 80                           246   5e-73   Glycine soja [wild soybean]
ref|NP_001236599.1|  heat shock protein 90-2                            246   5e-73   
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like      246   5e-73   Glycine max [soybeans]
gb|KDP32613.1|  hypothetical protein JCGZ_13163                         246   6e-73   Jatropha curcas
emb|CAK22426.1|  heat shock protein 83                                  237   6e-73   Beta vulgaris [beet]
ref|NP_001190553.1|  heat shock protein 81-2                            247   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006452664.1|  hypothetical protein CICLE_v10007633mg             246   1e-72   Citrus clementina [clementine]
ref|XP_010252844.1|  PREDICTED: heat shock cognate protein 80-like      245   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_009132342.1|  PREDICTED: heat shock protein 90-2-like            245   1e-72   Brassica rapa
gb|KEH26332.1|  heat shock protein 81-2                                 245   1e-72   Medicago truncatula
ref|XP_009758556.1|  PREDICTED: heat shock cognate protein 80-like      245   2e-72   Nicotiana sylvestris
ref|XP_009594054.1|  PREDICTED: heat shock cognate protein 80-like      245   2e-72   Nicotiana tomentosiformis
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              245   2e-72   
ref|NP_200412.1|  Heat shock protein 90-3                               245   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAL49788.1|  putative heat shock protein 90                          245   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABV89643.1|  heat shock protein 81-4                                 243   2e-72   Brassica rapa
gb|KJB22184.1|  hypothetical protein B456_004G033900                    244   3e-72   Gossypium raimondii
ref|XP_009785111.1|  PREDICTED: heat shock cognate protein 80           244   3e-72   Nicotiana sylvestris
ref|NP_001240230.1|  uncharacterized protein LOC100819568               244   3e-72   Glycine max [soybeans]
gb|EEC84770.1|  hypothetical protein OsI_31800                          231   4e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80           244   4e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN09298.1|  Heat shock protein 83                                   244   5e-72   Glycine soja [wild soybean]
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              244   5e-72   Glycine max [soybeans]
ref|XP_003574727.1|  PREDICTED: heat shock protein 81-1                 244   6e-72   Brachypodium distachyon [annual false brome]
emb|CAA72513.1|  heat shock protein                                     244   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132345.1|  PREDICTED: heat shock protein 90-2                 243   7e-72   Brassica rapa
dbj|BAJ34368.1|  unnamed protein product                                243   7e-72   Eutrema halophilum
dbj|BAO20259.1|  heat shock protein                                     243   7e-72   Brassica rapa subsp. chinensis [bok-choy]
gb|ADU04386.1|  heat shock protein 90-1                                 243   8e-72   Nicotiana attenuata
ref|XP_007020406.1|  Heat shock protein 81.4                            243   8e-72   Theobroma cacao [chocolate]
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             243   8e-72   Eutrema salsugineum [saltwater cress]
emb|CAN70887.1|  hypothetical protein VITISV_005592                     243   1e-71   Vitis vinifera
ref|NP_001275844.1|  HSP90 protein                                      243   1e-71   Citrus sinensis [apfelsine]
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2                 243   1e-71   Prunus mume [ume]
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg             243   1e-71   Prunus persica
ref|XP_002278894.1|  PREDICTED: heat shock protein 83                   243   1e-71   Vitis vinifera
ref|XP_006352548.1|  PREDICTED: heat shock cognate protein 80-like      243   1e-71   Solanum tuberosum [potatoes]
ref|XP_002532177.1|  heat shock protein, putative                       243   1e-71   Ricinus communis
ref|XP_010934626.1|  PREDICTED: heat shock protein 83-like              243   2e-71   Elaeis guineensis
gb|KCW70450.1|  hypothetical protein EUGRSUZ_F03673                     238   2e-71   Eucalyptus grandis [rose gum]
emb|CDP13679.1|  unnamed protein product                                241   3e-71   Coffea canephora [robusta coffee]
gb|AGB76029.1|  heat shock protein 90                                   242   3e-71   Salicornia europaea [chicken-claws]
ref|XP_002864424.1|  heat shock protein 81-3                            241   3e-71   
gb|EYU31897.1|  hypothetical protein MIMGU_mgv1a002208mg                242   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2                 241   4e-71   Pyrus x bretschneideri [bai li]
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2                 242   4e-71   
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2                 241   4e-71   Pyrus x bretschneideri [bai li]
gb|AGU99972.1|  HSP90                                                   241   4e-71   Populus tomentosa [Chinese white poplar]
gb|ADF31754.1|  heat shock protein 90                                   241   4e-71   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like            241   4e-71   Elaeis guineensis
tpg|DAA61993.1|  TPA: putative heat shock protein 90 family protein     234   7e-71   
gb|EMS59444.1|  Heat shock protein 81-3                                 241   7e-71   Triticum urartu
ref|XP_006344905.1|  PREDICTED: heat shock cognate protein 80-like      241   7e-71   Solanum tuberosum [potatoes]
gb|ADF31758.1|  heat shock protein 90                                   241   7e-71   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              241   7e-71   Cucumis sativus [cucumbers]
ref|NP_001234436.1|  molecular chaperone Hsp90-1                        241   7e-71   Solanum lycopersicum
gb|ADU04387.1|  heat shock protein 90-2                                 241   8e-71   Nicotiana attenuata
gb|ADF31773.1|  heat shock protein 90                                   241   8e-71   Triticum urartu
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              241   8e-71   Phoenix dactylifera
emb|CDY27839.1|  BnaC09g28660D                                          241   8e-71   Brassica napus [oilseed rape]
emb|CAA67191.1|  HSP80-2                                                241   8e-71   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003635036.1|  PREDICTED: heat shock cognate protein 80           241   8e-71   Vitis vinifera
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   241   9e-71   Cucumis melo [Oriental melon]
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like            241   9e-71   Elaeis guineensis
ref|XP_008776162.1|  PREDICTED: heat shock protein 81-1                 240   9e-71   Phoenix dactylifera
gb|AAD11549.1|  heat shock protein 80                                   240   1e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004308050.1|  PREDICTED: heat shock protein 83-like              240   1e-70   Fragaria vesca subsp. vesca
ref|XP_011039800.1|  PREDICTED: heat shock protein 90-2                 240   1e-70   Populus euphratica
ref|XP_010276895.1|  PREDICTED: heat shock protein 83-like              240   1e-70   Nelumbo nucifera [Indian lotus]
emb|CAN62488.1|  hypothetical protein VITISV_029391                     240   1e-70   Vitis vinifera
ref|XP_002299048.1|  hypothetical protein POPTR_0001s47020g             240   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002307846.1|  HSP80 family protein                               239   2e-70   Populus trichocarpa [western balsam poplar]
gb|KCW70451.1|  hypothetical protein EUGRSUZ_F03673                     238   2e-70   Eucalyptus grandis [rose gum]
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1                 239   2e-70   Populus euphratica
ref|XP_006373573.1|  HSP80 family protein                               239   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009763345.1|  PREDICTED: heat shock cognate protein 80-like      239   2e-70   Nicotiana sylvestris
ref|XP_011005759.1|  PREDICTED: heat shock cognate protein 80-like      239   2e-70   Populus euphratica
ref|XP_008811143.1|  PREDICTED: heat shock protein 81-1-like            239   2e-70   Phoenix dactylifera
gb|ADF31759.1|  heat shock protein 90                                   239   3e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002273244.1|  PREDICTED: heat shock cognate protein 80-like      239   3e-70   Vitis vinifera
gb|ACX31585.1|  molecular chaperone Hsp90-3                             239   3e-70   Nicotiana benthamiana
gb|EMS66149.1|  Heat shock protein 83                                   238   4e-70   Triticum urartu
ref|XP_004135593.1|  PREDICTED: heat shock cognate protein 80-like      239   4e-70   
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like            239   4e-70   Zea mays [maize]
gb|EYU25148.1|  hypothetical protein MIMGU_mgv1a002213mg                239   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_002866122.1|  heat shock protein 81-4                            239   4e-70   
ref|XP_010063241.1|  PREDICTED: heat shock cognate protein 80-like      239   4e-70   Eucalyptus grandis [rose gum]
gb|ADF31778.1|  heat shock protein 90                                   239   5e-70   Triticum dicoccoides [wild emmer wheat]
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   239   5e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002976693.1|  hypothetical protein SELMODRAFT_151384             238   5e-70   Selaginella moellendorffii
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              238   5e-70   Elaeis guineensis
gb|EMT27103.1|  Heat shock protein 83                                   238   6e-70   
gb|ABB84343.1|  heat shock protein 90                                   238   6e-70   Triticum aestivum [Canadian hard winter wheat]
gb|ADF31772.1|  heat shock protein 90                                   239   6e-70   Triticum urartu
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like            238   6e-70   Tarenaya hassleriana [spider flower]
gb|AAA32822.1|  heat shock protein 83                                   238   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAR12194.1|  molecular chaperone Hsp90-2                             238   6e-70   Nicotiana benthamiana
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    238   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200076.1|  heat shock protein 90.1                               238   6e-70   
ref|XP_002973159.1|  hypothetical protein SELMODRAFT_271009             238   6e-70   Selaginella moellendorffii
dbj|BAA00615.1|  81kDa heat-shock protein                               238   6e-70   Arabidopsis thaliana [mouse-ear cress]
prf||1908431A  heat shock protein HSP81-1                               238   6e-70
gb|ADC53692.1|  heat shock protein 90-1                                 226   7e-70   Cryptocoryne ciliata
gb|ADF31781.1|  heat shock protein 90                                   238   7e-70   Triticum dicoccoides [wild emmer wheat]
gb|ABW96308.1|  heat shock protein 90                                   238   7e-70   Vitis pseudoreticulata
ref|XP_009791186.1|  PREDICTED: heat shock protein 83-like              237   7e-70   Nicotiana sylvestris
ref|XP_009607645.1|  PREDICTED: heat shock cognate protein 80-like      238   8e-70   Nicotiana tomentosiformis
gb|ADF31775.1|  heat shock protein 90                                   238   8e-70   Aegilops tauschii
gb|AIZ68152.1|  heat shock protein 81-1                                 238   8e-70   Ornithogalum longebracteatum [sea-onion]
gb|ADF31756.1|  heat shock protein 90                                   238   9e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002864186.1|  heat shock protein 81-1                            238   9e-70   
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         238   9e-70   Jatropha curcas
dbj|BAD73667.1|  putative heat shock protein 82                         236   1e-69   Oryza sativa Japonica Group [Japonica rice]
gb|AAD30456.1|AF123259_1  heat shock protein 90                         231   1e-69   Solanum lycopersicum
ref|XP_002462554.1|  hypothetical protein SORBIDRAFT_02g028020          238   1e-69   Sorghum bicolor [broomcorn]
ref|XP_008801780.1|  PREDICTED: heat shock protein 83                   238   1e-69   Phoenix dactylifera
gb|KFK26865.1|  hypothetical protein AALP_AA8G303900                    238   1e-69   Arabis alpina [alpine rockcress]
dbj|BAJ85535.1|  predicted protein                                      238   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010928209.1|  PREDICTED: heat shock protein 90-2-like            221   1e-69   
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   237   2e-69   Fragaria vesca subsp. vesca
gb|ADC53691.1|  heat shock protein 90-2                                 224   2e-69   Cryptocoryne ciliata
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              237   2e-69   Setaria italica
ref|XP_006659552.1|  PREDICTED: heat shock protein 81-1-like isof...    237   2e-69   
sp|A2YWQ1.1|HSP81_ORYSI  RecName: Full=Heat shock protein 81-1; S...    237   2e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_006659551.1|  PREDICTED: heat shock protein 81-1-like isof...    237   2e-69   
ref|XP_004500151.1|  PREDICTED: heat shock cognate protein 80-like      236   3e-69   Cicer arietinum [garbanzo]
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1                 236   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              236   3e-69   Nicotiana tomentosiformis
emb|CAA68885.1|  heat shock protein 90A                                 236   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928210.1|  PREDICTED: heat shock protein 90-2-like            220   4e-69   
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like            236   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002509852.1|  heat shock protein, putative                       236   4e-69   Ricinus communis
ref|XP_010103960.1|  Heat shock cognate protein 80                      237   4e-69   
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like            236   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1                 236   4e-69   
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            236   4e-69   Tarenaya hassleriana [spider flower]
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg             236   5e-69   Capsella rubella
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like            236   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like            236   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1                 236   6e-69   Camelina sativa [gold-of-pleasure]
ref|NP_001062159.1|  Os08g0500700                                       235   7e-69   
ref|XP_008355028.1|  PREDICTED: heat shock protein 90-2                 235   7e-69   
ref|XP_006659553.1|  PREDICTED: heat shock protein 81-1-like            235   7e-69   
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like            235   9e-69   Elaeis guineensis
ref|XP_002444804.1|  hypothetical protein SORBIDRAFT_07g028270          234   1e-68   Sorghum bicolor [broomcorn]
prf||1710352A  heat shock protein 83                                    235   1e-68
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              234   2e-68   Sesamum indicum [beniseed]
gb|KHN43913.1|  Heat shock cognate protein 80                           230   2e-68   Glycine soja [wild soybean]
dbj|BAK08741.1|  heat shock protein 90                                  234   2e-68   Chara braunii
dbj|BAK08690.1|  heat shock protein 90                                  234   2e-68   Chara braunii
dbj|BAH97107.1|  heat shock protein of Hsp90                            234   2e-68   Chara braunii
dbj|BAK08691.1|  heat shock protein 90                                  234   3e-68   Chara braunii
dbj|BAD04054.1|  heat shock protein 90                                  234   3e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    234   3e-68   Eucalyptus grandis [rose gum]
ref|NP_001063503.1|  Os09g0482400                                       234   3e-68   
dbj|BAK08728.1|  heat shock protein 90                                  234   3e-68   Chara braunii
ref|XP_004973824.1|  PREDICTED: heat shock protein 81-1-like            234   3e-68   
ref|NP_001063500.1|  Os09g0482100                                       234   3e-68   
gb|KJB24311.1|  hypothetical protein B456_004G138600                    234   3e-68   Gossypium raimondii
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                     233   3e-68   Eucalyptus grandis [rose gum]
ref|XP_010941080.1|  PREDICTED: heat shock protein 83                   233   6e-68   Elaeis guineensis
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2                 233   6e-68   Fragaria vesca subsp. vesca
dbj|BAK08743.1|  heat shock protein 90                                  233   9e-68   Chara braunii
ref|XP_004974826.1|  PREDICTED: heat shock protein 81-1-like            231   9e-68   
ref|NP_001170475.1|  LOC100384473                                       232   9e-68   Zea mays [maize]
dbj|BAK08742.1|  heat shock protein 90                                  232   1e-67   Chara braunii
ref|XP_007142446.1|  hypothetical protein PHAVU_008G281300g             232   1e-67   Phaseolus vulgaris [French bean]
ref|XP_007142447.1|  hypothetical protein PHAVU_008G281400g             232   1e-67   Phaseolus vulgaris [French bean]
gb|KCW90631.1|  hypothetical protein EUGRSUZ_A02734                     232   1e-67   Eucalyptus grandis [rose gum]
ref|XP_010060433.1|  PREDICTED: heat shock protein 83-like              232   2e-67   Eucalyptus grandis [rose gum]
ref|XP_009383207.1|  PREDICTED: heat shock protein 81-1-like            232   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006857538.1|  hypothetical protein AMTR_s00061p00036160          232   2e-67   Amborella trichopoda
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          232   2e-67   Sorghum bicolor [broomcorn]
ref|XP_002981406.1|  hypothetical protein SELMODRAFT_271484             231   2e-67   Selaginella moellendorffii
gb|AGC60019.1|  heat shock protein 90                                   231   2e-67   Saccharum hybrid cultivar SP80-3280
ref|XP_002969937.1|  hypothetical protein SELMODRAFT_267300             231   2e-67   
gb|ADP89125.1|  heat shock protein 90                                   231   3e-67   Cenchrus americanus [bulrush millet]
gb|KJB81563.1|  hypothetical protein B456_013G150300                    231   3e-67   Gossypium raimondii
ref|XP_007152171.1|  hypothetical protein PHAVU_004G107700g             231   3e-67   Phaseolus vulgaris [French bean]
ref|XP_006659612.1|  PREDICTED: heat shock protein 81-1-like            231   3e-67   Oryza brachyantha
gb|ACN27969.1|  unknown                                                 231   5e-67   Zea mays [maize]
gb|KJB81562.1|  hypothetical protein B456_013G150300                    230   5e-67   Gossypium raimondii
ref|NP_001135416.2|  heat shock protein 82                              231   5e-67   
ref|XP_006408893.1|  hypothetical protein EUTSA_v10002229mg             230   6e-67   
gb|AGV54249.1|  heat-shock protein                                      230   7e-67   Phaseolus vulgaris [French bean]
gb|ACN36206.1|  unknown                                                 230   8e-67   Zea mays [maize]
ref|NP_001170480.1|  HSP protein                                        230   8e-67   Zea mays [maize]
gb|AHB36893.1|  heat shock protein 90                                   230   8e-67   Matricaria chamomilla var. recutita [German chamomile]
emb|CDY50297.1|  BnaA10g28410D                                          229   8e-67   Brassica napus [oilseed rape]
ref|XP_007038814.1|  Heat shock protein 90.1 isoform 2                  227   9e-67   
ref|XP_010539340.1|  PREDICTED: heat shock protein 90-2-like            229   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   229   2e-66   Brachypodium distachyon [annual false brome]
ref|XP_009119805.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    229   2e-66   Brassica rapa
ref|XP_010246543.1|  PREDICTED: heat shock cognate protein 80           228   3e-66   Nelumbo nucifera [Indian lotus]
gb|EPS61618.1|  hypothetical protein M569_13176                         228   3e-66   Genlisea aurea
gb|AEK20869.1|  heat shock protein 90-2                                 228   3e-66   Cryptocoryne ciliata
ref|XP_007038813.1|  Heat shock protein 90.1 isoform 1                  228   4e-66   
gb|KDO56797.1|  hypothetical protein CISIN_1g005370mg                   225   7e-66   Citrus sinensis [apfelsine]
gb|AFQ94045.1|  heat shock protein 90                                   227   7e-66   Lactuca sativa [cultivated lettuce]
ref|XP_009377558.1|  PREDICTED: heat shock protein 83-like              226   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_006422036.1|  hypothetical protein CICLE_v10004456mg             226   2e-65   Citrus clementina [clementine]
gb|KDO56796.1|  hypothetical protein CISIN_1g005370mg                   226   2e-65   Citrus sinensis [apfelsine]
ref|XP_002305263.1|  hypothetical protein POPTR_0004s07190g             226   2e-65   Populus trichocarpa [western balsam poplar]
sp|P51819.1|HSP83_IPONI  RecName: Full=Heat shock protein 83            226   3e-65   Ipomoea nil [qian niu]
ref|XP_011035347.1|  PREDICTED: heat shock protein 83-like isofor...    224   3e-65   Populus euphratica
ref|XP_006372391.1|  hypothetical protein POPTR_0017s01160g             226   3e-65   
ref|XP_002460433.1|  hypothetical protein SORBIDRAFT_02g028050          226   3e-65   Sorghum bicolor [broomcorn]
gb|AAR12193.1|  molecular chaperone Hsp90-1                             225   4e-65   Nicotiana benthamiana
gb|ADX06844.1|  molecular chaperone Hsp90                               225   4e-65   Nicotiana tabacum [American tobacco]
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              225   4e-65   
ref|XP_009591410.1|  PREDICTED: heat shock cognate protein 80           225   4e-65   
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            225   5e-65   
gb|KHG00618.1|  Heat shock 90-1 -like protein                           225   5e-65   
gb|AAS79798.1|  heat shock protein 90                                   225   5e-65   
gb|ADF31779.1|  heat shock protein 90                                   224   1e-64   
ref|XP_011035346.1|  PREDICTED: heat shock protein 83-like isofor...    224   1e-64   
ref|XP_002274022.1|  PREDICTED: heat shock protein 83-like              224   1e-64   
emb|CAN73318.1|  hypothetical protein VITISV_007727                     224   1e-64   
ref|XP_010089053.1|  Heat shock protein 83                              224   1e-64   
gb|KDP22224.1|  hypothetical protein JCGZ_26055                         224   1e-64   
ref|XP_003617873.1|  Heat shock protein                                 224   1e-64   
ref|XP_001419938.1|  Heat Shock Protein 90, cytosolic                   224   1e-64   
ref|XP_009368732.1|  PREDICTED: heat shock protein 83                   224   2e-64   
ref|XP_004491530.1|  PREDICTED: heat shock cognate protein 80-lik...    223   2e-64   
gb|KJB52728.1|  hypothetical protein B456_008G274600                    224   2e-64   
ref|XP_001695264.1|  heat shock protein 90A                             223   2e-64   
gb|AIZ68157.1|  heat shock protein 83                                   223   3e-64   
ref|XP_009413748.1|  PREDICTED: heat shock protein 83                   222   5e-64   
ref|XP_010035175.1|  PREDICTED: heat shock protein 83                   222   7e-64   
gb|ADF31755.1|  heat shock protein 90                                   222   7e-64   
ref|XP_008380194.1|  PREDICTED: heat shock protein 83-like              222   8e-64   
ref|XP_008376647.1|  PREDICTED: heat shock protein 83 isoform X1        222   9e-64   
gb|EYU19581.1|  hypothetical protein MIMGU_mgv1a002166mg                222   9e-64   
gb|AAQ08597.1|  heat shock protein                                      221   1e-63   
sp|P36182.1|HSP82_TOBAC  RecName: Full=Heat shock protein 82            217   1e-63   
ref|XP_007040338.1|  Heat shock protein 90.1                            221   1e-63   
ref|XP_011046024.1|  PREDICTED: heat shock protein 83                   221   2e-63   
ref|XP_010261331.1|  PREDICTED: heat shock protein 83                   221   2e-63   
gb|KJB20596.1|  hypothetical protein B456_003G155600                    221   2e-63   
ref|XP_002300303.1|  HSP80 family protein                               221   2e-63   
ref|XP_010089052.1|  Heat shock protein 83                              221   2e-63   
gb|KGN66052.1|  hypothetical protein Csa_1G569290                       219   2e-63   
ref|XP_011030250.1|  PREDICTED: heat shock protein 81-1-like            221   2e-63   
ref|XP_009607669.1|  PREDICTED: heat shock protein 82                   220   3e-63   
gb|ABK21939.1|  unknown                                                 207   4e-63   
emb|CDP05141.1|  unnamed protein product                                220   5e-63   
ref|XP_007220219.1|  hypothetical protein PRUPE_ppa002187mg             220   5e-63   
ref|XP_001777383.1|  predicted protein                                  219   7e-63   
ref|XP_008234835.1|  PREDICTED: heat shock protein 83                   219   7e-63   
gb|ABX76302.1|  heat shock protein 90                                   219   8e-63   
ref|XP_001777414.1|  predicted protein                                  219   8e-63   
gb|AFR60309.1|  HSP90                                                   219   8e-63   
ref|XP_009375529.1|  PREDICTED: heat shock protein 83-like              219   1e-62   
gb|KHN16650.1|  Heat shock protein 81-3                                 217   1e-62   
ref|XP_003058104.1|  predicted protein                                  219   1e-62   
ref|XP_009768512.1|  PREDICTED: heat shock protein 82                   219   1e-62   
ref|XP_011398501.1|  Heat shock protein 90-2                            212   3e-62   
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              217   5e-62   
emb|CAE02770.2|  OSJNBb0085F13.17                                       217   6e-62   
ref|XP_005643103.1|  HSP90-domain-containing protein                    217   6e-62   
gb|EAY92778.1|  hypothetical protein OsI_14582                          217   6e-62   
ref|XP_006476504.1|  PREDICTED: heat shock protein 83-like              216   8e-62   
ref|XP_001779443.1|  predicted protein                                  216   1e-61   
ref|XP_006828794.1|  hypothetical protein AMTR_s00001p00118120          216   1e-61   
ref|XP_004240717.1|  PREDICTED: heat shock protein 83-like              216   2e-61   
gb|KHN31689.1|  Heat shock cognate protein 80                           215   2e-61   
gb|KDO76323.1|  hypothetical protein CISIN_1g005321mg                   215   2e-61   
ref|XP_002499727.1|  predicted protein                                  215   3e-61   
gb|ADC45395.1|  HSP90-1                                                 215   3e-61   
ref|NP_001236612.1|  heat shock protein 90-1                            215   3e-61   
gb|KIY96293.1|  Heat shock protein 82                                   211   4e-61   
ref|XP_010537148.1|  PREDICTED: heat shock protein 83                   213   1e-60   
ref|XP_009802902.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    213   1e-60   
ref|XP_002513649.1|  heat shock protein, putative                       213   1e-60   
ref|XP_011084460.1|  PREDICTED: heat shock protein 83-like              213   2e-60   
ref|XP_006439485.1|  hypothetical protein CICLE_v10019095mg             213   2e-60   
ref|XP_001766228.1|  predicted protein                                  213   2e-60   
gb|AEP39605.1|  heat shock protein 90                                   212   3e-60   
ref|XP_011076104.1|  PREDICTED: heat shock protein 83                   212   3e-60   
gb|AFK31312.1|  heat shock protein 90                                   211   9e-60   
ref|XP_005703696.1|  molecular chaperone HtpG                           211   1e-59   
ref|XP_005841337.1|  hypothetical protein GUITHDRAFT_83993              210   2e-59   
ref|XP_003081563.1|  Molecular chaperone (HSP90 family) (ISS)           204   3e-59   
ref|XP_008238949.1|  PREDICTED: heat shock protein 90-1-like            209   3e-59   
gb|KFG42944.1|  heat shock protein HSP90                                199   5e-59   
ref|XP_006362664.1|  PREDICTED: heat shock protein 83-like              209   5e-59   
ref|XP_004234218.1|  PREDICTED: heat shock protein 83                   209   5e-59   
ref|XP_001780981.1|  predicted protein                                  209   5e-59   
dbj|BAF75058.1|  heat shock protein                                     194   9e-59   
ref|XP_003592196.1|  Heat shock protein                                 208   1e-58   
gb|ACH59910.1|  heat shock protein 90 kDa                               193   1e-58   
ref|XP_005715129.1|  unnamed protein product                            208   2e-58   
ref|XP_007510316.1|  predicted protein                                  206   6e-58   
emb|CEF99333.1|  Histidine kinase-like ATPase, ATP-binding domain       206   7e-58   
ref|XP_005911315.1|  PREDICTED: heat shock protein HSP 90-alpha-like    192   1e-57   
gb|AAY67878.1|  heat shock protein 90                                   205   1e-57   
gb|KDD75584.1|  heat shock protein 90 Hsp90                             204   2e-57   
ref|XP_676736.1|  hypothetical protein                                  194   2e-57   
ref|XP_729156.1|  heat shock 90 kDa protein                             195   3e-57   
ref|XP_005777261.1|  hypothetical protein EMIHUDRAFT_443778             204   4e-57   
ref|XP_005764796.1|  hypothetical protein EMIHUDRAFT_437342             203   5e-57   
emb|CAA34748.1|  heat shock-like protein                                194   6e-57   
emb|CAG01829.1|  unnamed protein product                                191   7e-57   
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                   196   1e-56   
gb|AAM93928.1|  heat-shock protein 90                                   191   1e-56   
emb|CDW75268.1|  heat shock protein 90                                  202   2e-56   
ref|XP_004363302.1|  heat shock protein 90a                             201   2e-56   
gb|KJE92655.1|  heat shock protein 90a                                  202   3e-56   
gb|AAQ63041.1|  heat shock protein HSP 90 alpha                         189   4e-56   
gb|ACO58580.1|  heat shock protein 90                                   194   4e-56   
gb|AAH07989.2|  HSP90AA1 protein                                        195   8e-56   
ref|XP_002368278.1|  heat shock protein 90                              200   1e-55   
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha         196   1e-55   
gb|ETW57274.1|  hypothetical protein PFUGPA_00763                       190   1e-55   
ref|XP_001740319.1|  heat shock protein                                 188   1e-55   
ref|XP_003881046.1|  hsp90, related                                     199   2e-55   
ref|XP_008889030.1|  heat shock protein HSP90                           199   2e-55   
gb|AIY24626.1|  heat shock protein 90                                   199   2e-55   
emb|CAC29071.1|  heat shock protein 90                                  189   2e-55   
ref|XP_005805661.1|  PREDICTED: heat shock protein HSP 90-alpha-like    199   2e-55   
pdb|3Q6M|A  Chain A, Crystal Structure Of Human Mc-hsp90 In C2221...    194   2e-55   
dbj|BAH71458.1|  ACYPI002010                                            189   3e-55   
gb|EJY88528.1|  Heat shock protein 90                                   198   3e-55   
gb|AFK31313.1|  heat shock protein 90                                   198   3e-55   
ref|XP_005841364.1|  heat shock protein Hsp90, cytosolic protein        198   4e-55   
gb|AAB23704.1|  HSP90                                                   186   4e-55   
gb|EDL97505.1|  rCG27814, isoform CRA_c                                 194   4e-55   
gb|EDL18665.1|  mCG14932, isoform CRA_a                                 194   5e-55   
sp|P20147.1|HSP90_PLAFP  RecName: Full=Heat shock 90 kDa protein ...    186   5e-55   
gb|AER28025.1|  heat shock protein 83S2                                 198   5e-55   
gb|ADQ20111.1|  heat shock protein 90                                   198   5e-55   
ref|XP_002888790.1|  hypothetical protein ARALYDRAFT_339306             196   6e-55   
gb|AEF33377.1|  heat shock protein 90                                   185   6e-55   
ref|XP_009702297.1|  PREDICTED: heat shock protein HSP 90-alpha         196   7e-55   
gb|KFP61130.1|  Heat shock protein HSP 90-alpha                         196   7e-55   
gb|AAH00987.1|  HSP90AA1 protein                                        195   8e-55   
ref|XP_006001581.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    197   9e-55   
ref|XP_002672583.1|  predicted protein                                  197   1e-54   
ref|XP_008311363.1|  PREDICTED: heat shock protein HSP 90-alpha         197   1e-54   
gb|AAZ17404.1|  90 kDa heat shock protein                               192   1e-54   
ref|XP_008396615.1|  PREDICTED: heat shock protein HSP 90-alpha         197   1e-54   
emb|CBJ23502.1|  heat shock protein 90                                  187   1e-54   
gb|EJY69804.1|  Heat shock protein 90                                   197   1e-54   
gb|EUD73992.1|  heat shock protein 90                                   197   1e-54   
ref|XP_007577309.1|  PREDICTED: heat shock protein HSP 90-alpha         197   1e-54   
gb|AAH49951.1|  Hsp90ab1 protein                                        190   1e-54   
ref|XP_008627985.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    196   1e-54   
gb|AER28022.1|  heat shock protein 83P1                                 197   1e-54   
ref|XP_010152348.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   1e-54   
ref|XP_005483288.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
ref|XP_008700790.1|  PREDICTED: heat shock protein HSP 90-alpha-like    184   2e-54   
ref|XP_005417950.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
ref|NP_001016282.1|  heat shock protein 90kDa alpha (cytosolic), ...    196   2e-54   
gb|ACY66376.1|  HSP90                                                   192   2e-54   
ref|XP_007488498.1|  PREDICTED: heat shock protein HSP 90-alpha-like    193   2e-54   
ref|XP_006018082.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
gb|KGL98099.1|  Heat shock protein HSP 90-alpha                         196   2e-54   
ref|XP_009580794.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
gb|AAC25497.1|  Hsp89-alpha-delta-N                                     194   2e-54   
ref|NP_001085598.1|  heat shock protein 90kDa alpha (cytosolic), ...    196   2e-54   
ref|XP_010020311.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
emb|CAG01828.1|  unnamed protein product                                194   2e-54   
ref|XP_008498249.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
ref|XP_009953881.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
ref|XP_010393468.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
gb|EOB00416.1|  Heat shock protein HSP 90-alpha                         196   2e-54   
gb|AFN89572.1|  HSP90                                                   196   2e-54   
dbj|BAB15121.1|  unnamed protein product                                189   2e-54   
gb|KFQ82066.1|  Heat shock protein HSP 90-alpha                         196   2e-54   
gb|KFP47363.1|  Heat shock protein HSP 90-alpha                         196   2e-54   
ref|XP_009279122.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
dbj|BAF83423.1|  unnamed protein product                                189   2e-54   
ref|XP_010292573.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
ref|NP_001274200.1|  heat shock protein 90kDa alpha (cytosolic), ...    196   2e-54   
ref|XP_007886533.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
ref|XP_009972463.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
gb|AAH44888.1|  Hsp90ab1 protein                                        190   2e-54   
ref|XP_009099985.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
ref|XP_005020783.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
ref|XP_009996302.1|  PREDICTED: heat shock protein HSP 90-alpha         196   2e-54   
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              196   2e-54   
ref|NP_001103255.1|  heat shock protein HSP 90-alpha                    196   2e-54   
ref|XP_010126476.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    196   2e-54   
dbj|BAE87688.1|  unnamed protein product                                189   2e-54   
ref|XP_005047661.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   2e-54   
gb|KFQ27573.1|  Heat shock protein HSP 90-alpha                         196   2e-54   
emb|CDR12458.1|  heat shock protein 90, putative                        196   3e-54   
ref|XP_010213538.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
gb|KFP83054.1|  Heat shock protein HSP 90-alpha                         196   3e-54   
ref|XP_010132756.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
gb|KFU89878.1|  Heat shock protein HSP 90-alpha                         196   3e-54   
ref|XP_005149613.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
ref|XP_004645488.1|  PREDICTED: heat shock protein HSP 90-alpha         195   3e-54   
ref|XP_009903372.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
gb|KFQ56441.1|  Heat shock protein HSP 90-alpha                         196   3e-54   
gb|KFP45671.1|  Heat shock protein HSP 90-alpha                         196   3e-54   
ref|XP_009953880.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   3e-54   
ref|XP_009326272.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
ref|XP_005417949.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   3e-54   
gb|KFQ77344.1|  Heat shock protein HSP 90-alpha                         196   3e-54   
ref|XP_008498248.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   3e-54   
ref|XP_005506149.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   3e-54   
ref|XP_009889390.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
ref|XP_009075831.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
ref|XP_005483287.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   3e-54   
ref|XP_004169486.1|  PREDICTED: heat shock cognate protein 80-like      182   3e-54   
ref|XP_002200608.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
dbj|BAE48212.1|  heat shock protein 90 beta                             188   3e-54   
ref|XP_008623748.1|  heat shock protein 90                              196   3e-54   
ref|XP_010173602.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
gb|EDL97503.1|  rCG27814, isoform CRA_a                                 194   3e-54   
ref|XP_008936282.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    196   3e-54   
ref|XP_004083819.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
ref|XP_005562292.1|  PREDICTED: heat shock protein HSP 90-alpha i...    195   3e-54   
ref|XP_005341052.1|  PREDICTED: heat shock protein HSP 90-alpha i...    195   3e-54   
gb|EGW01344.1|  Heat shock protein HSP 90-beta                          191   3e-54   
ref|XP_010902984.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
gb|EDL18667.1|  mCG14932, isoform CRA_c                                 195   3e-54   
ref|XP_009673798.1|  PREDICTED: heat shock protein HSP 90-alpha         196   3e-54   
emb|CDS46141.1|  heat shock protein 90, putative                        196   3e-54   
ref|XP_011369249.1|  PREDICTED: heat shock protein HSP 90-alpha         194   3e-54   
ref|XP_005506148.1|  PREDICTED: heat shock protein HSP 90-alpha i...    196   3e-54   
ref|XP_010351937.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    196   3e-54   
ref|XP_010010145.1|  PREDICTED: heat shock protein HSP 90-beta          195   3e-54   
ref|XP_005410794.1|  PREDICTED: heat shock protein HSP 90-alpha i...    195   4e-54   
gb|AER28024.1|  heat shock protein 83S1                                 196   4e-54   
ref|XP_001712605.1|  hsp90                                              195   4e-54   
gb|AIC63037.1|  HSP90AA1                                                195   4e-54   
gb|KFZ48776.1|  Heat shock protein HSP 90-alpha                         196   4e-54   
gb|ETB60437.1|  hsp90-like protein                                      196   4e-54   



>gb|KHG21667.1| Heat shock cognate 80 [Gossypium arboreum]
Length=615

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  459  CKVIKDVLGDKVEKVLVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  518

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  519  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  578

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  579  LKLGLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  615



>gb|EYU33725.1| hypothetical protein MIMGU_mgv1a002215mg [Erythranthe guttata]
Length=700

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+D    ADV+MPALE+   DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDESGEADVDMPALEEVDADAEGSKMEEVD  700



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDVAGEADSDMPPLEDDVDAEGSKMEEVD  699



>ref|XP_004135777.1| PREDICTED: heat shock protein 90-2-like [Cucumis sativus]
Length=611

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+D+SMAGYMSSK
Sbjct  455  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDNSMAGYMSSK  514

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  515  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRM  574

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDE+AG+  D EMP LED   DAEGSKMEEVD
Sbjct  575  LKLGLSIDEEAGE-GDSEMPPLEDADADAEGSKMEEVD  611



>ref|NP_001234439.1| heat shock cognate protein 80 [Solanum lycopersicum]
 sp|P36181.1|HSP80_SOLLC RecName: Full=Heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAB01376.1| heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAR12196.1| molecular chaperone Hsp90-2 [Solanum lycopersicum]
 prf||1909348A heat shock protein hsp80
Length=699

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDE++GD AD +MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEESGD-ADADMPALEDPEADAEGSKMEEVD  699



>gb|KGN66050.1| hypothetical protein Csa_1G569270 [Cucumis sativus]
Length=699

 Score =   262 bits (670),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+D+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDE+AG+  D EMP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEEAGE-GDSEMPPLEDADADAEGSKMEEVD  699



>ref|XP_010446135.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=437

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  281  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  340

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  341  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  400

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  401  LKLGLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  437



>dbj|BAG16518.1| putative Hsp90-2 [Capsicum chinense]
Length=699

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  543  CKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDE+ GD ADV+MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEEGGD-ADVDMPPLEDPEADAEGSKMEEVD  699



>ref|XP_006413166.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
 gb|ESQ54619.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
Length=700

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDDDAGEGEADADMPPLEDDAEAEGSKMEEVD  700



>ref|XP_010235281.1| PREDICTED: heat shock protein 81-1-like [Brachypodium distachyon]
Length=700

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 145/156 (93%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED   +A D +MPALEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDETAEADDTDMPALEDDAGESKMEEVD  700



>ref|XP_010433476.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448245.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448246.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448248.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010491086.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=701

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  604  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  664  LKLGLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  701



>ref|XP_010235286.1| PREDICTED: heat shock protein 81-1-like [Brachypodium distachyon]
Length=699

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  544  CKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  604  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  663

Query  271  LKLGLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED   +A D +MPALEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDETAEADDTDMPALEDDAGESKMEEVD  699



>ref|XP_009126978.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=696

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  540  CKVIKDILGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  599

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  600  KTMEINPENAIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  659

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED     D EMP LED  DAEGSKMEEVD
Sbjct  660  LKLGLSIDEDDAVEGDAEMPPLEDDADAEGSKMEEVD  696



>ref|XP_010443242.1| PREDICTED: heat shock protein 90-2 [Camelina sativa]
Length=699

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_010483070.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_006287183.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
 gb|EOA20081.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
Length=699

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_010438732.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=706

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMK+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  549  CKVMKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  608

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  609  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  668

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  669  LKLGLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  706



>ref|XP_002869603.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45862.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=700

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  700



>gb|KFK25886.1| hypothetical protein AALP_AA8G175000 [Arabis alpina]
Length=700

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 147/158 (93%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+  GYMSSK
Sbjct  543  CKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNTGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD EMP LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDDDAGETEADAEMPPLEDDAEAEGSKMEEVD  700



>ref|XP_006280103.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13001.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=699

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DA+GSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADADGSKMEEVD  699



>ref|XP_006280102.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13000.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=658

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  502  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  561

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  562  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  621

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DA+GSKMEEVD
Sbjct  622  LKLGLSIDEDDAVEADAEMPPLEDDADADGSKMEEVD  658



>dbj|BAF01967.1| HEAT SHOCK PROTEIN 81-2 [Arabidopsis thaliana]
Length=218

 Score =   243 bits (621),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  62   CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  121

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  122  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  181

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  182  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  218



>ref|XP_009132299.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=699

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KFK29176.1| hypothetical protein AALP_AA7G099100 [Arabis alpina]
Length=700

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  700



>ref|XP_010443241.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_006413591.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
 gb|ESQ55044.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
Length=700

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 148/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  700



>ref|XP_010483071.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   256 bits (655),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDTVEADAEMPLLEDDADAEGSKMEEVD  699



>ref|XP_010483069.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-3-like 
[Camelina sativa]
Length=699

 Score =   256 bits (655),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KFK40163.1| hypothetical protein AALP_AA3G338900 [Arabis alpina]
Length=701

 Score =   256 bits (655),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 148/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  544  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  604  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDA-ADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+DAG+  AD +MP LED  DAEGSKMEEVD
Sbjct  664  LKLGLSIDDDAGETEADADMPPLEDDADAEGSKMEEVD  701



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 145/156 (93%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KT+EINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  605  KTLEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED     D +MP+LE+ DAE SKMEEVD
Sbjct  665  LKLGLSIDEDE-KVEDTDMPSLEEADAEESKMEEVD  699



>ref|XP_010450563.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSIDED    ADVE+P LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADVELPPLEDDAEAEGSKMEEVD  699



>gb|AAN77149.1| fiber protein Fb9 [Gossypium barbadense]
Length=176

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 151/157 (96%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  20   CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  79

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+NPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  80   KTMEINPDNPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  139

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  140  LKLGLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  176



>ref|XP_006401391.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
 dbj|BAJ33984.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42844.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
Length=699

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KFK27172.1| hypothetical protein AALP_AA8G344900 [Arabis alpina]
Length=699

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|AAF31705.1|AF221856_1 heat-shock protein 80 [Euphorbia esula]
Length=320

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  164  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  223

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  224  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  283

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+  D +MPALE+   DAEGSKMEEVD
Sbjct  284  LKLGLSIDEDAGE-GDADMPALEEADADAEGSKMEEVD  320



>gb|AAB33937.1| heat-shock Protein [Arabidopsis thaliana]
Length=699

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRV+DSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVLDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENLIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSI+ED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIEEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|ACX37413.1| cytosolic heat shock protein 90.1 [Dactylis glomerata]
Length=699

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED     D +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDEAPENDTDMPPLEDDAGESKMEEVD  699



>dbj|BAJ86355.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=700

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED   A AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDDEPAEADTDMPPLEEDAGESKMEEVD  700



>gb|ACX37414.1| cytosolic heat shock protein 90.2 [Dactylis glomerata]
Length=699

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  544  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  604  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  663

Query  271  LKLGLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED   +A D +MP LEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDEPAEADDTDMPPLEDDAGESKMEEVD  699



>gb|ADF31757.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31766.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31780.1| heat shock protein 90 [Triticum dicoccoides]
Length=700

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED   A AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAGADTDMPPLEEDAGESKMEEVD  700



>ref|XP_006280101.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
 gb|EOA12999.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
Length=699

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSS   YMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSTGSYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMNELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>dbj|BAD95027.1| heat shock protein 90 [Arabidopsis thaliana]
Length=373

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  217  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  276

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  277  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  336

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  337  LKLGLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  373



>gb|AEY83982.1| heat shock protein 80 KDa, partial [Triticum aestivum]
 gb|AEY83983.1| heat shock protein 80 KDa, partial [Triticum aestivum]
 gb|AEY83984.1| heat shock protein 80 KDa, partial [Triticum aestivum]
Length=212

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  57   CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  116

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  117  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  176

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  177  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  212



>gb|KFK38607.1| hypothetical protein AALP_AA3G136000 [Arabis alpina]
Length=655

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 142/156 (91%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSD VVDSPCCLVTGEYGWTANMERIMKAQALRDS M GYMSSK
Sbjct  499  CKVIKDVLGDKVEKVIVSDHVVDSPCCLVTGEYGWTANMERIMKAQALRDSGMGGYMSSK  558

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  559  KTMEINPENSIMDELRKRAEADKNDKSVKDLVVLLFETALLTSGFSLDEPNTFGSRIHRM  618

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEV  170
            LKLGLSIDED    AD EMP LED  DAEGSKMEEV
Sbjct  619  LKLGLSIDEDDTVEADTEMPPLEDDADAEGSKMEEV  654



>gb|KJB13948.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=594

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  438  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  497

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  498  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  557

Query  271  LKLGLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSI ++     AD +MP LED D EGSKMEEVD
Sbjct  558  LKLGLSIDEDAGDADADADMPPLEDADGEGSKMEEVD  594



>gb|AAN61003.1| putative heat shock protein 90 [Arabidopsis thaliana]
 gb|AAN64168.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=526

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  370  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  429

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  430  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  489

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  490  LKLGLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  526



>gb|KHG19401.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 149/157 (95%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVMVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADV-EMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAGDA    E+P LED DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGDADADSEIPPLEDADAEGSKMEEVD  699



>gb|ABF61871.1| chaperone [Agave tequilana]
Length=174

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  MK++LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD++M+ YMSSK
Sbjct  20   CKTMKEILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNNMSAYMSSK  79

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  80   KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAGRIHRM  139

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGL+IDED   A D EMPALE+D  E SKMEEVD
Sbjct  140  LKLGLNIDEDET-AEDAEMPALEEDGNEESKMEEVD  174



>emb|CAJ19348.1| heat shock protein 90 [Triticum aestivum]
Length=658

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  503  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  562

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  563  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  622

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  623  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  658



>ref|NP_200411.1| Heat shock protein 90-4 [Arabidopsis thaliana]
 sp|O03986.1|HS904_ARATH RecName: Full=Heat shock protein 90-4; Short=AtHSP90.4; AltName: 
Full=Heat shock protein 81-4; Short=HSP81-4 [Arabidopsis 
thaliana]
 emb|CAA72514.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAB09282.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAE99287.1| heat shock protein [Arabidopsis thaliana]
 gb|AED96708.1| Heat shock protein 90-4 [Arabidopsis thaliana]
Length=699

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+DS+  GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDSNTGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSI+ED    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIEEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|AHM23830.1| heat shock protein 90, partial [Brassica rapa]
Length=421

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  265  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  324

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  325  KTMEINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  384

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  385  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  421



>gb|AAN31859.1| putative heat shock protein 81-2 (HSP81-2) [Arabidopsis thaliana]
Length=699

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|AAP87284.1| cytosolic heat shock protein 90 [Hordeum vulgare]
Length=700

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>gb|ABG57075.1| heat shock protein 90 [Triticum aestivum]
 gb|ABG57076.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31761.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31762.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31770.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31771.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31777.1| heat shock protein 90 [Aegilops tauschii]
 gb|ADF31783.1| heat shock protein 90 [Triticum dicoccoides]
 gb|AEK01109.1| heat shock protein 90 [Triticum aestivum]
 gb|AFH40333.1| heat shock protein 90 [Secale cereale]
Length=700

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>dbj|BAJ99646.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=700

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>gb|ADF31760.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31769.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31774.1| heat shock protein 90 [Triticum urartu]
 gb|ADF31782.1| heat shock protein 90 [Triticum dicoccoides]
 gb|EMS53579.1| Heat shock protein 81-3 [Triticum urartu]
Length=700

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>gb|KHG22758.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRAD DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADTDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSI ++     AD +MP LED DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGDADADADMPPLEDADAEGSKMEEVD  699



>gb|KJB13949.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=699

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSI ++     AD +MP LED D EGSKMEEVD
Sbjct  663  LKLGLSIDEDAGDADADADMPPLEDADGEGSKMEEVD  699



>gb|EMT17245.1| Heat shock protein 81-3 [Aegilops tauschii]
Length=720

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  565  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  624

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  625  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  684

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  685  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  720



>ref|XP_011097724.1| PREDICTED: heat shock cognate protein 80-like [Sesamum indicum]
Length=699

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ ADV+MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGE-ADVDMPPLEDADADAEGSKMEEVD  699



>ref|XP_004516872.1| PREDICTED: heat shock protein 83-like [Cicer arietinum]
Length=699

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CRVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  664  LKLGLSIDEDETGGDDVDMPPLEEDGAEESKMEEVD  699



>ref|NP_001274833.1| Hsp90-2-like [Solanum tuberosum]
 gb|ABB55365.1| Hsp90-2-like [Solanum tuberosum]
Length=700

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 145/159 (91%), Gaps = 5/159 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDP-NTFGNRIHR  275
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETA LTSGFSL++P +   NRIHR
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETAFLTSGFSLEEPKHLLANRIHR  662

Query  274  MLKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            MLKLGLSIDE++GD  D +MPALED   DAEGSKMEEVD
Sbjct  663  MLKLGLSIDEESGD-VDADMPALEDPEADAEGSKMEEVD  700



>gb|AGA62462.1| heat shock protein 90 [Gossypium hirsutum]
Length=699

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  699



>gb|AAH08189.1| Unknown (protein for IMAGE:3584589), partial [Mus musculus]
Length=491

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSK
Sbjct  336  CKVMKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSK  395

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLL ETALLTSGFSLDDPNTFGNRIHRM
Sbjct  396  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLHETALLTSGFSLDDPNTFGNRIHRM  455

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSID+DA    DV+MPALE+ DAE SKMEEVD
Sbjct  456  LKLGLSIDDDAAGEVDVDMPALEEADAEESKMEEVD  491



>ref|XP_008811147.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=701

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKDVLGDKVEKVMVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KR++ DKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRM
Sbjct  605  KTMEINPENPIMEELRKRSEVDKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRM  664

Query  271  LKLGLSIDE-DAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDE DA   AD +MP+LED +AEGSKMEEVD
Sbjct  665  LKLGLSIDEDDATGDADTDMPSLEDAEAEGSKMEEVD  701



>gb|AGT98548.1| heat shock protein 90, partial [Paeonia lactiflora]
Length=302

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  145  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  204

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL +RA+ADKNDKSVKDLV+LLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  205  KTMEINPENSIMEELRERAEADKNDKSVKDLVVLLFETSLLTSGFSLDEPNTFGNRIHRM  264

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+  D +MPALE+   DA+GSKMEEVD
Sbjct  265  LKLGLSIDEDAGEGDDADMPALEEADVDADGSKMEEVD  302



>tpg|DAA40367.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=365

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  211  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  270

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  271  KTMEINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRM  330

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  331  LKLGLSIDEDEPVEAEAEMPQLEDDAGESKMEEVD  365



>ref|XP_011089536.1| PREDICTED: heat shock cognate protein 80 [Sesamum indicum]
Length=699

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ ADV+MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGE-ADVDMPPLEDADADAEGSKMEEVD  699



>gb|KJB22185.1| hypothetical protein B456_004G034000 [Gossypium raimondii]
Length=666

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 151/157 (96%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  510  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  569

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  570  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  629

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  630  LKLGLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  666



>ref|NP_200414.1| heat shock protein 81-2 [Arabidopsis thaliana]
 sp|P55737.1|HS902_ARATH RecName: Full=Heat shock protein 90-2; Short=AtHSP90.2; AltName: 
Full=Heat shock protein 81-2; Short=HSP81-2; AltName: Full=Protein 
EARLY-RESPONSIVE TO DEHYDRATION 8; AltName: Full=Protein 
LOSS OF RECOGNITION OF AVRRPM1 2 [Arabidopsis thaliana]
 dbj|BAB09285.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAL32828.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAM91205.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AAN71943.1| putative heat-shock protein HSP81-2 [Arabidopsis thaliana]
 gb|AAO00895.1| Unknown protein [Arabidopsis thaliana]
 gb|AED96711.1| heat shock protein 81-2 [Arabidopsis thaliana]
 prf||1908431B heat shock protein HSP81-2
Length=699

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KHN23824.1| Heat shock cognate protein 80 [Glycine soja]
Length=695

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  539  CHVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  598

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  599  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  658

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ AD +MP LED   DAEGSKMEEVD
Sbjct  659  LKLGLSIDEDAGE-ADADMPPLEDADADAEGSKMEEVD  695



>ref|NP_001236599.1| heat shock protein 90-2 [Glycine max]
 gb|ACI31551.1| heat shock protein 90-2 [Glycine max]
Length=700

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CHVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ AD +MP LED   DAEGSKMEEVD
Sbjct  664  LKLGLSIDEDAGE-ADADMPPLEDADADAEGSKMEEVD  700



>ref|XP_003544594.1| PREDICTED: heat shock cognate protein 80-like [Glycine max]
Length=700

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CHVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ AD +MP LED   DAEGSKMEEVD
Sbjct  664  LKLGLSIDEDAGE-ADADMPPLEDADADAEGSKMEEVD  700



>gb|KDP32613.1| hypothetical protein JCGZ_13163 [Jatropha curcas]
Length=699

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+  D +MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGE-GDADMPALEDADVDAEGSKMEEVD  699



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 144/157 (92%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM  YMSSK
Sbjct  196  CKVIKDVLGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGAYMSSK  255

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  256  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRM  315

Query  271  LKLGLSIDE-DAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSI+E DAG+ AD  MPALE+D AE SKMEEVD
Sbjct  316  LKLGLSIEEDDAGEDAD--MPALEEDTAEESKMEEVD  350



>ref|NP_001190553.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AED96712.1| heat shock protein 81-2 [Arabidopsis thaliana]
Length=728

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  572  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  631

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  632  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  691

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  692  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  728



>ref|XP_006452664.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|AFF58923.1| Hsp90 [Citrus sinensis]
 gb|ESR65904.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|KDO59214.1| hypothetical protein CISIN_1g045760mg [Citrus sinensis]
Length=700

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  544  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALE---DDAEGSKMEEVD  167
            LKLGLSI+EDAGD AD +MP LE   DDAEGSKMEEVD
Sbjct  664  LKLGLSIEEDAGD-ADADMPPLEDAADDAEGSKMEEVD  700



>ref|XP_010252844.1| PREDICTED: heat shock cognate protein 80-like [Nelumbo nucifera]
Length=699

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 150/157 (96%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDE+ G+A AD +MP LED DAEGSKMEEVD
Sbjct  663  LKLGLSIDEEGGEADADTDMPPLEDADAEGSKMEEVD  699



>ref|XP_009132342.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=698

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  542  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  601

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  602  KTMEINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  661

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  662  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  698



>gb|KEH26332.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMK++LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CRVMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KR++ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTF  RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRSEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFAGRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED   A DV+MP LE+D AE SKMEEVD
Sbjct  664  LKLGLSIDEDETGADDVDMPPLEEDGAEESKMEEVD  699



>ref|XP_009758556.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_009594054.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_003533977.1| PREDICTED: heat shock protein 83-like [Glycine max]
 gb|KHN42443.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  664  LKLGLSIDEDDNGGDDVDMPPLEEDGAEESKMEEVD  699



>ref|NP_200412.1| Heat shock protein 90-3 [Arabidopsis thaliana]
 sp|P51818.2|HS903_ARATH RecName: Full=Heat shock protein 90-3; Short=AtHSP90.3; AltName: 
Full=HSP81.2; AltName: Full=Heat shock protein 81-3; Short=HSP81-3 
[Arabidopsis thaliana]
 dbj|BAB09283.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL32910.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL91191.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AED96709.1| heat shock protein 81-3 [Arabidopsis thaliana]
Length=699

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  699



>gb|AAL49788.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=699

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  699



>gb|ABV89643.1| heat shock protein 81-4 [Brassica rapa]
Length=613

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  457  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  516

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  517  KTMEINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  576

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  577  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  613



>gb|KJB22184.1| hypothetical protein B456_004G033900 [Gossypium raimondii]
Length=699

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADA+KNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADAEKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAG+  AD +MP LED DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGEGEADADMPPLEDADAEGSKMEEVD  699



>ref|XP_009785111.1| PREDICTED: heat shock cognate protein 80 [Nicotiana sylvestris]
Length=699

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|NP_001240230.1| uncharacterized protein LOC100819568 [Glycine max]
 gb|ADC45396.1| HSP90-2 [Glycine max]
 gb|KHN01774.1| Heat shock cognate protein 80 [Glycine soja]
Length=699

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ AD EMP LE+   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGE-ADAEMPPLEEAEADAEGSKMEEVD  699



>gb|EEC84770.1| hypothetical protein OsI_31800 [Oryza sativa Indica Group]
Length=243

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  89   CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  148

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRM
Sbjct  149  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRM  208

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  209  LKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD  243



>ref|XP_010675973.1| PREDICTED: heat shock cognate protein 80 [Beta vulgaris subsp. 
vulgaris]
Length=698

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVMKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLL ETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLHETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSID+DA    DV+MPALE+ DAE SKMEEVD
Sbjct  663  LKLGLSIDDDAAGEVDVDMPALEEADAEESKMEEVD  698



>gb|KHN09298.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K++LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  664  LKLGLSIDEDDNGGDDVDMPPLEEDGAEESKMEEVD  699



>ref|XP_006599549.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=699

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K++LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  664  LKLGLSIDEDDNGGDDVDMPPLEEDGAEESKMEEVD  699



>ref|XP_003574727.1| PREDICTED: heat shock protein 81-1 [Brachypodium distachyon]
Length=699

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  544  CKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRAD DKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  604  KTMEINPENAIMEELRKRADDDKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  663

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++A DA D +MPALEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDEAADADDTDMPALEDDAGESKMEEVD  699



>emb|CAA72513.1| heat shock protein [Arabidopsis thaliana]
Length=699

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDLLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  699



>ref|XP_009132345.1| PREDICTED: heat shock protein 90-2 [Brassica rapa]
Length=699

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>dbj|BAJ34368.1| unnamed protein product [Thellungiella halophila]
Length=705

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MPALE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPALEEDAAEESKMEEVD  705



>dbj|BAO20259.1| heat shock protein [Brassica rapa subsp. chinensis]
Length=699

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|ADU04386.1| heat shock protein 90-1 [Nicotiana attenuata]
Length=699

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 151/158 (96%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KR+DADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRSDADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_007020406.1| Heat shock protein 81.4 [Theobroma cacao]
 gb|EOY11931.1| Heat shock protein 81.4 [Theobroma cacao]
Length=699

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ AD +MP LED   +AEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGE-ADADMPPLEDADAEAEGSKMEEVD  699



>ref|XP_006401798.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
 gb|ESQ43251.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
Length=707

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  552  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  611

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  612  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  671

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MPALE+D AE SKMEEVD
Sbjct  672  LKLGLSIDEDENVEEDGDMPALEEDAAEESKMEEVD  707



>emb|CAN70887.1| hypothetical protein VITISV_005592 [Vitis vinifera]
Length=690

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VS+R+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  535  CKTIKDILGDKVEKVVVSERIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGSYMSSK  594

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+NPIMEEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG RIHRM
Sbjct  595  KTMEINPDNPIMEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGARIHRM  654

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED     D EMP LE++  E SKMEEVD
Sbjct  655  LKLGLSIDEDEAGGDDTEMPPLEEEGNEESKMEEVD  690



>ref|NP_001275844.1| HSP90 protein [Citrus sinensis]
 gb|AFF58924.1| Hsp90 [Citrus sinensis]
Length=700

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  544  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVK LVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENPIMEELRKRADADKNDKSVKGLVLLLFETALLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALE---DDAEGSKMEEVD  167
            LKLGLSI+EDAGD AD +MP LE   DDAEGSKMEEVD
Sbjct  664  LKLGLSIEEDAGD-ADADMPPLEDAADDAEGSKMEEVD  700



>ref|XP_008218765.1| PREDICTED: heat shock protein 90-2 [Prunus mume]
Length=699

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+DA D  D EMP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDAVD-GDAEMPPLEDADADAEGSKMEEVD  699



>ref|XP_007208337.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
 gb|EMJ09536.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
Length=699

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+DA D  D EMP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDAVD-GDAEMPPLEDADADAEGSKMEEVD  699



>ref|XP_002278894.1| PREDICTED: heat shock protein 83 [Vitis vinifera]
Length=703

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VS+R+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  548  CKTIKDILGDKVEKVVVSERIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGSYMSSK  607

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+NPIMEEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG RIHRM
Sbjct  608  KTMEINPDNPIMEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGARIHRM  667

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED     D EMP LE++  E SKMEEVD
Sbjct  668  LKLGLSIDEDEAGGDDTEMPPLEEEGNEESKMEEVD  703



>ref|XP_006352548.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA D  DV+MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDASD-VDVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_002532177.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30214.1| heat shock protein, putative [Ricinus communis]
Length=698

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSK
Sbjct  542  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSK  601

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  602  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  661

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+  D +MP LED   DAEGSKMEEVD
Sbjct  662  LKLGLSIDEDAGE-GDGDMPPLEDAEVDAEGSKMEEVD  698



>ref|XP_010934626.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
 ref|XP_010934627.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=702

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQAL+D+SM  YMSSK
Sbjct  547  CKVMKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALKDNSMGSYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEE+ KRA+ADKNDKSVKDLVLLLFETA+LTSGFSLDDPNTF  RIHRM
Sbjct  607  KTMEINPENGIMEEMRKRAEADKNDKSVKDLVLLLFETAILTSGFSLDDPNTFAGRIHRM  666

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED     D +MPALE+D  E SKMEEVD
Sbjct  667  LKLGLSIDEDEAAGDDTDMPALEEDGNEESKMEEVD  702



>gb|KCW70450.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=518

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  362  CKVVKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  421

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  422  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  481

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA D  D +MP LED   +AEGSKMEEVD
Sbjct  482  LKLGLSIDEDAPD-GDADMPPLEDAEVEAEGSKMEEVD  518



>emb|CDP13679.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 137/155 (88%), Gaps = 16/155 (10%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLS   DA             DAEGSKMEEVD
Sbjct  663  LKLGLS---DA-------------DAEGSKMEEVD  681



>gb|AGB76029.1| heat shock protein 90 [Salicornia europaea]
Length=696

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSK
Sbjct  542  CKVVKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSK  601

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLL+ETALLTSGFSLD+PNTFGNRIHRM
Sbjct  602  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLYETALLTSGFSLDEPNTFGNRIHRM  661

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSID+DAG+  DV+MPALE+ D EGSKMEEVD
Sbjct  662  LKLGLSIDDDAGE-VDVDMPALEEADTEGSKMEEVD  696



>ref|XP_002864424.1| heat shock protein 81-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40683.1| heat shock protein 81-3 [Arabidopsis lyrata subsp. lyrata]
Length=685

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  529  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  588

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  589  KTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  648

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LE+  DAEGSKMEEVD
Sbjct  649  LKLGLSIDDDDAVEADAEMPPLEEDADAEGSKMEEVD  685



>gb|EYU31897.1| hypothetical protein MIMGU_mgv1a002208mg [Erythranthe guttata]
Length=701

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+ SS  GYM+SK
Sbjct  544  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKGSSAGGYMASK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRAD+DKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRI RM
Sbjct  604  KTMEINPENSIMDELRKRADSDKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIFRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+D G  AD++MP LE+   DA+GSKMEEVD
Sbjct  664  LKLGLSIDDDEGGDADLDMPELEEVVADADGSKMEEVD  701



>ref|XP_009367265.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+DA +  D EMP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDAVE-GDAEMPPLEDVDADAEGSKMEEVD  699



>ref|XP_008384610.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=720

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  564  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  623

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRM
Sbjct  624  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRM  683

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+DA +  D EMP LED   DAEGSKMEEVD
Sbjct  684  LKLGLSIDDDAVE-GDAEMPPLEDADADAEGSKMEEVD  720



>ref|XP_009362097.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+DA +  D EMP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDAVE-GDAEMPPLEDADADAEGSKMEEVD  699



>gb|AGU99972.1| HSP90 [Populus tomentosa]
Length=699

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA + AD EMP LE+   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAVE-ADAEMPPLEEADADAEGSKMEEVD  699



>gb|ADF31754.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31763.1| heat shock protein 90 [Triticum aestivum]
Length=707

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C ++KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  552  CKIIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  611

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  612  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  671

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  672  LKLGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  707



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  547  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  607  KTMEINPENPIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  666

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  667  LKLGLSIDEDEIVDADADMPSLEDADAEGSKMEEVD  702



>tpg|DAA61993.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=429

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C ++K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  275  CKIIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  334

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG RIHRM
Sbjct  335  KTMEINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGTRIHRM  394

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  395  LKLGLSIDEDKSAEAEAEMPPLEDDAGESKMEEVD  429



>gb|EMS59444.1| Heat shock protein 81-3 [Triticum urartu]
Length=700

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_006344905.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 150/158 (95%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED+GD A+ +MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSGD-AEADMPALEDPEVDAEGSKMEEVD  699



>gb|ADF31758.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31767.1| heat shock protein 90 [Triticum aestivum]
Length=700

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_004140753.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004157188.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 gb|KGN57413.1| hypothetical protein Csa_3G183950 [Cucumis sativus]
Length=703

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSK
Sbjct  548  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGAYMSSK  607

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  608  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  667

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDE+  +  D +MPALE+DA E SKMEEVD
Sbjct  668  LKLGLSIDEEENEGDDADMPALEEDATEESKMEEVD  703



>ref|NP_001234436.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
 gb|AAR12195.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
Length=699

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED GD A+ +MPALED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDGGD-AEADMPALEDPEADAEGSKMEEVD  699



>gb|ADU04387.1| heat shock protein 90-2 [Nicotiana attenuata]
Length=699

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED+GD A+ +MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSGD-AEADMPPLEDPEADAEGSKMEEVD  699



>gb|ADF31773.1| heat shock protein 90 [Triticum urartu]
Length=700

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_008797179.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=701

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDS+M+ YMSSK
Sbjct  547  CKVMKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSTMSAYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  607  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAGRIHRM  666

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGL+IDED     D EMP LE+D  E SKMEEVD
Sbjct  667  LKLGLNIDEDET-GEDAEMPTLEEDGNEESKMEEVD  701



>emb|CDY27839.1| BnaC09g28660D [Brassica napus]
Length=705

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ DKNDKSVKDLV+LLFETALLTSGFSLD+PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEVDKNDKSVKDLVMLLFETALLTSGFSLDEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MPALE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPALEEDAAEESKMEEVD  705



>emb|CAA67191.1| HSP80-2 [Triticum aestivum]
Length=700

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGE GWT NMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGENGWTPNMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADK+DKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELPKRADADKSDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>ref|XP_003635036.1| PREDICTED: heat shock cognate protein 80 [Vitis vinifera]
Length=699

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            +KLGLSIDED G  AD +MP LE+   DAEGSKMEEVD
Sbjct  663  MKLGLSIDED-GPEADTDMPPLEEADADAEGSKMEEVD  699



>ref|XP_008439282.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=703

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV++SDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSK
Sbjct  548  CKTIKDILGDKVEKVVISDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGAYMSSK  607

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  608  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  667

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDE+  +  D +MPALE+D AE SKMEEVD
Sbjct  668  LKLGLSIDEEENEGDDADMPALEEDAAEESKMEEVD  703



>ref|XP_010913223.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSL+DPNTFGNRIHRM
Sbjct  605  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFGNRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  665  LKLGLSIDEDETVDADTDMPSLEDADAEGSKMEEVD  700



>ref|XP_008776162.1| PREDICTED: heat shock protein 81-1 [Phoenix dactylifera]
Length=700

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSD VVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDHVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRA+ADKNDKSVKDLVLLLF+T+LLTSGFSL+DPNTFGNRIHRM
Sbjct  605  KTMEINPENPIMEELRKRAEADKNDKSVKDLVLLLFDTSLLTSGFSLEDPNTFGNRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  665  LKLGLSIDEDETVDADTDMPSLEDADAEGSKMEEVD  700



>gb|AAD11549.1| heat shock protein 80 [Triticum aestivum]
Length=700

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFE +LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFENSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_004308050.1| PREDICTED: heat shock protein 83-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGDR+EK +VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSK
Sbjct  546  CKTIKDILGDRIEKAVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGSYMSSK  605

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RI+RM
Sbjct  606  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRINRM  665

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED     D +MP LED AE SKMEEVD
Sbjct  666  LKLGLSIDEDEAAVEDADMPELEDAAEESKMEEVD  700



>ref|XP_011039800.1| PREDICTED: heat shock protein 90-2 [Populus euphratica]
Length=699

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA + AD EMP LE+   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAVE-ADAEMPPLEEADADAEGSKMEEVD  699



>ref|XP_010276895.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=701

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM+GYMSSK
Sbjct  546  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMSGYMSSK  605

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  606  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRM  665

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDE+   A D +MP LEDD  E SKMEEVD
Sbjct  666  LKLGLSIDEEETAADDTDMPPLEDDGNEESKMEEVD  701



>emb|CAN62488.1| hypothetical protein VITISV_029391 [Vitis vinifera]
Length=699

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 147/158 (93%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            +KLGLSIDED G  AD  MP LE+   DAEGSKMEEVD
Sbjct  663  MKLGLSIDED-GPEADXXMPPLEEADADAEGSKMEEVD  699



>ref|XP_002299048.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
 gb|EEE83853.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
Length=699

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA + AD EMP LE+   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAVE-ADAEMPPLEEAEADAEGSKMEEVD  699



>ref|XP_002307846.1| HSP80 family protein [Populus trichocarpa]
 gb|ABK95597.1| unknown [Populus trichocarpa]
 gb|EEE91369.1| HSP80 family protein [Populus trichocarpa]
Length=699

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRD+SMAGYMSSK
Sbjct  545  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDNSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  605  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED+GD AD +MP LED A EGSKMEEVD
Sbjct  665  LKLGLSIDEDSGD-ADTDMPPLEDAAEEGSKMEEVD  699



>gb|KCW70451.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=619

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  463  CKVVKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  522

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  523  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  582

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA D  D +MP LED   +AEGSKMEEVD
Sbjct  583  LKLGLSIDEDAPD-GDADMPPLEDAEVEAEGSKMEEVD  619



>ref|XP_011040123.1| PREDICTED: heat shock protein 81-1 [Populus euphratica]
Length=698

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 148/157 (94%), Gaps = 3/157 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALE--DDAEGSKMEEVD  167
            LKLGLSIDED+ D AD +MP LE  DDAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSAD-ADTDMPPLEDADDAEGSKMEEVD  698



>ref|XP_006373573.1| HSP80 family protein [Populus trichocarpa]
 gb|ERP51370.1| HSP80 family protein [Populus trichocarpa]
Length=698

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 3/157 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSM GYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETA+LTSGFSLDDPNTFG+RIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETAMLTSGFSLDDPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALE--DDAEGSKMEEVD  167
            LKLGLSIDED+ D AD +MP LE  DDAEGSKMEEVD
Sbjct  663  LKLGLSIDEDSAD-ADTDMPPLEDADDAEGSKMEEVD  698



>ref|XP_009763345.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED GD A+ +MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDCGD-AEADMPPLEDPEADAEGSKMEEVD  699



>ref|XP_011005759.1| PREDICTED: heat shock cognate protein 80-like [Populus euphratica]
Length=699

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRD+SMAGYMSSK
Sbjct  545  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDNSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  605  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED+GD AD +MP LED A EGSKMEEVD
Sbjct  665  LKLGLSIDEDSGD-ADTDMPPLEDAAEEGSKMEEVD  699



>ref|XP_008811143.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=700

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+MAGYMSSK
Sbjct  545  CKVVKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLF+TALLTSGFSLDDPNTFGNRIHRM
Sbjct  605  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFDTALLTSGFSLDDPNTFGNRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDE     AD +MP+LED DAEGSKMEEVD
Sbjct  665  LKLGLSIDEGETVDADADMPSLEDADAEGSKMEEVD  700



>gb|ADF31759.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31768.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31776.1| heat shock protein 90 [Aegilops tauschii]
 gb|EMT03701.1| Heat shock protein 81-3 [Aegilops tauschii]
Length=700

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRAD DKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADVDKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_002273244.1| PREDICTED: heat shock cognate protein 80-like [Vitis vinifera]
Length=704

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLG+RVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  548  CKVMKDVLGERVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  607

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KR D DKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  608  KTMEINPENPIMEELRKRTDVDKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRM  667

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGL+IDE+AGD  DV+MP LE+   +AEGSKMEEVD
Sbjct  668  LKLGLNIDEEAGD-VDVDMPPLEEADAEAEGSKMEEVD  704



>gb|ACX31585.1| molecular chaperone Hsp90-3 [Nicotiana benthamiana]
Length=700

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 148/159 (93%), Gaps = 5/159 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALE----DDAEGSKMEEVD  167
            LKLGLSIDED GD A+ +MP LE    DDAEGSKMEEVD
Sbjct  663  LKLGLSIDEDCGD-AEADMPPLEDTEADDAEGSKMEEVD  700



>gb|EMS66149.1| Heat shock protein 83 [Triticum urartu]
Length=658

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  503  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  562

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  563  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRM  622

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  623  LKLGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  658



>ref|XP_004135593.1| PREDICTED: heat shock cognate protein 80-like [Cucumis sativus]
Length=699

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+D+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDNSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDE++G+  D EMP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEESGE-GDSEMPPLEDADADAEGSKMEEVD  699



>ref|XP_008670278.1| PREDICTED: heat shock protein 81-1-like [Zea mays]
 tpg|DAA40366.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=698

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDEPVEAEAEMPQLEDDAGESKMEEVD  698



>gb|EYU25148.1| hypothetical protein MIMGU_mgv1a002213mg [Erythranthe guttata]
Length=700

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  544  CKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGSYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF +RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFASRIHRM  663

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDE +     DVEMP LE++  E SKMEEVD
Sbjct  664  LKLGLSIDEVEEESGEDVEMPGLEEEGNEESKMEEVD  700



>ref|XP_002866122.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42381.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 143/157 (91%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+   YMSSK
Sbjct  543  CKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNTGSYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  603  KTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  663  LKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_010063241.1| PREDICTED: heat shock cognate protein 80-like [Eucalyptus grandis]
 gb|KCW70449.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=703

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  547  CKVVKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  607  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  666

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA D  D +MP LED   +AEGSKMEEVD
Sbjct  667  LKLGLSIDEDAPD-GDADMPPLEDAEVEAEGSKMEEVD  703



>gb|ADF31778.1| heat shock protein 90 [Triticum dicoccoides]
Length=712

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  557  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  616

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  617  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRM  676

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  677  LKLGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  712



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 144/157 (92%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM  YMSSK
Sbjct  549  CKVIKDVLGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGAYMSSK  608

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  609  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRM  668

Query  271  LKLGLSIDE-DAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSI+E DAG+ AD  MPALE+D AE SKMEEVD
Sbjct  669  LKLGLSIEEDDAGEDAD--MPALEEDVAEESKMEEVD  703



>ref|XP_002976693.1| hypothetical protein SELMODRAFT_151384 [Selaginella moellendorffii]
 gb|EFJ22362.1| hypothetical protein SELMODRAFT_151384 [Selaginella moellendorffii]
Length=704

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  547  CKVVKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  607  KTMEINPDNTIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  666

Query  271  LKLGLSIDED-AGDAADVEMPALE--DDAEGSKMEEVD  167
            LKLGLSID+D +GDAADVEMP LE  +DAEGSKMEEVD
Sbjct  667  LKLGLSIDDDVSGDAADVEMPPLEEGNDAEGSKMEEVD  704



>ref|XP_010934628.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=701

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKD+LGDRVEKV+VS+R+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  547  CKVMKDILGDRVEKVVVSERIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IM+EL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLDDPNTF  RIHRM
Sbjct  607  KTMEINPDNGIMDELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDDPNTFAGRIHRM  666

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGL+IDE+     D EMPALE+D  E SKMEEVD
Sbjct  667  LKLGLNIDEEET-GEDAEMPALEEDVNEESKMEEVD  701



>gb|EMT27103.1| Heat shock protein 83 [Aegilops tauschii]
Length=679

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  523  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  582

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  583  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  642

Query  271  LKLGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+ A  +  D +MPALE++ AE SKMEEVD
Sbjct  643  LKLGLNIDDQADAEEEDADMPALEEEGAEESKMEEVD  679



>gb|ABB84343.1| heat shock protein 90 [Triticum aestivum]
Length=659

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  509  CKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  568

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  569  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  628

Query  271  LKLGLSIDE-DAGDAADVEMPALEDDA  194
            LKLGLSIDE D     D +MP LEDDA
Sbjct  629  LKLGLSIDEDDEAPENDTDMPPLEDDA  655



>gb|ADF31772.1| heat shock protein 90 [Triticum urartu]
Length=712

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  557  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  616

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  617  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRM  676

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  677  LKLGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  712



>ref|XP_010536759.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
 ref|XP_010536760.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  603  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  167
            LKLGLSID++AG+   D +MP LEDD  AEGSKMEEVD
Sbjct  663  LKLGLSIDDEAGETEGDADMPPLEDDAEAEGSKMEEVD  700



>gb|AAA32822.1| heat shock protein 83 [Arabidopsis thaliana]
Length=705

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>gb|AAR12194.1| molecular chaperone Hsp90-2 [Nicotiana benthamiana]
Length=699

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED GD A+ +MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDCGD-AEADMPPLEDPEADAEGSKMEEVD  699



>sp|P27323.3|HS901_ARATH RecName: Full=Heat shock protein 90-1; Short=AtHSP90.1; AltName: 
Full=Heat shock protein 81-1; Short=HSP81-1; AltName: Full=Heat 
shock protein 83 [Arabidopsis thaliana]
Length=700

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  545  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  605  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  665  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  700



>ref|NP_200076.1| heat shock protein 90.1 [Arabidopsis thaliana]
 dbj|BAA98082.1| heat-shock protein [Arabidopsis thaliana]
 gb|AAM91104.1| AT5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AAN46890.1| At5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AED96244.1| heat shock protein 90.1 [Arabidopsis thaliana]
Length=705

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>ref|XP_002973159.1| hypothetical protein SELMODRAFT_271009 [Selaginella moellendorffii]
 gb|EFJ25533.1| hypothetical protein SELMODRAFT_271009 [Selaginella moellendorffii]
Length=705

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 3/158 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  548  CKVVKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSK  607

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  608  KTMEINPDNSIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  667

Query  271  LKLGLSIDED-AGDAADVEMPALE--DDAEGSKMEEVD  167
            LKLGLSID+D +GDAADVEMP LE  +DAEGSKMEEVD
Sbjct  668  LKLGLSIDDDVSGDAADVEMPPLEEGNDAEGSKMEEVD  705



>dbj|BAA00615.1| 81kDa heat-shock protein [Arabidopsis thaliana]
Length=700

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  545  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  605  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  665  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  700



>prf||1908431A heat shock protein HSP81-1
Length=705

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>gb|ADC53692.1| heat shock protein 90-1 [Cryptocoryne ciliata]
Length=254

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 148/157 (94%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRDSSMAGYMSSK
Sbjct  98   CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDSSMAGYMSSK  157

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  158  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  217

Query  271  LKLGLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSI ++DA   AD +MP LED DAEGSKMEEVD
Sbjct  218  LKLGLSIDEDDAPADADADMPTLEDADAEGSKMEEVD  254



>gb|ADF31781.1| heat shock protein 90 [Triticum dicoccoides]
Length=700

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  545  CKVIKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGF LDDPNTFG RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFCLDDPNTFGTRIHRM  664

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  665  LKLGLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>gb|ABW96308.1| heat shock protein 90 [Vitis pseudoreticulata]
Length=699

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKDVLG+RVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVMKDVLGERVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KR + DKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRTEVDKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGL+IDE+AGD  DV+MP LE+   +AEGSKMEEVD
Sbjct  663  LKLGLNIDEEAGD-VDVDMPPLEEADAEAEGSKMEEVD  699



>ref|XP_009791186.1| PREDICTED: heat shock protein 83-like, partial [Nicotiana sylvestris]
Length=658

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  503  CKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSK  562

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ DKNDKSVKDLVLLL+ETALLTSGFSLDDPN F  RIHRM
Sbjct  563  KTMEINPDNGIMEELRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNAFAARIHRM  622

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLS++ED     D EMP LE++  E SKMEEVD
Sbjct  623  LKLGLSVEEDEASGDDTEMPVLEEEGIEESKMEEVD  658



>ref|XP_009607645.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   238 bits (607),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 147/158 (93%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDED GD  + +MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDCGD-GETDMPPLEDPEADAEGSKMEEVD  699



>gb|ADF31775.1| heat shock protein 90 [Aegilops tauschii]
Length=713

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  557  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  616

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  617  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  676

Query  271  LKLGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+ A  +  D +MPALE++ AE SKMEEVD
Sbjct  677  LKLGLNIDDQADAEEEDADMPALEEEGAEESKMEEVD  713



>gb|AIZ68152.1| heat shock protein 81-1 [Ornithogalum saundersiae]
Length=700

 Score =   238 bits (607),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CKVIKEVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENAIMEELRKRAEADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED   A AD +MP LED DAEGSKMEEVD
Sbjct  664  LKLGLSIDEDETVADADTDMPPLEDADAEGSKMEEVD  700



>gb|ADF31756.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31765.1| heat shock protein 90 [Triticum aestivum]
Length=713

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  557  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  616

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  617  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  676

Query  271  LKLGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+ID+ A  +  D +MPALE++ AE SKMEEVD
Sbjct  677  LKLGLNIDDQADAEEEDADMPALEEEGAEESKMEEVD  713



>ref|XP_002864186.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40445.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLD+PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGAMPELEEDAAEESKMEEVD  705



>gb|KDP25390.1| hypothetical protein JCGZ_20546 [Jatropha curcas]
Length=706

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K+VLGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSK
Sbjct  550  CKTIKEVLGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMSAYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            K MEINP+NPIM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  610  KIMEINPDNPIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRM  669

Query  271  LKLGLSIDED-AGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGL IDED +G+  D++MPALE+   E SKMEEVD
Sbjct  670  LKLGLGIDEDESGEQEDIDMPALEEGGNEESKMEEVD  706



>dbj|BAD73667.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD73668.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
Length=614

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  460  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  519

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  520  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  579

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  580  LKLGLSIDEDETAEADTDMPPLEDDAGESKMEEVD  614



>gb|AAD30456.1|AF123259_1 heat shock protein 90 [Solanum lycopersicum]
Length=406

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQAL+D+SM+ YMSS+
Sbjct  251  CKVIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALKDNSMSSYMSSE  310

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N I+EEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  311  KTMEINPDNGIVEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRM  370

Query  271  LKLGLSIDEDAGDAADV-EMPALEDDAEGSKMEEVD  167
            LKLGLSIDE+     DV +MP LED  E SKMEEVD
Sbjct  371  LKLGLSIDEEEEAGVDVDDMPPLEDVGEESKMEEVD  406



>ref|XP_002462554.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
 gb|EER99075.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
Length=699

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRA+ADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENPIMDELRKRAEADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD EMP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDESAEADAEMPPLEDDAGESKMEEVD  699



>ref|XP_008801780.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=703

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+ M+ YMSSK
Sbjct  547  CKVMKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNGMSSYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSL+DPNTF  RIHRM
Sbjct  607  KTMEINPENGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFAGRIHRM  666

Query  271  LKLGLSIDED--AGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED  AGD  D ++P LE+D  E SKMEEVD
Sbjct  667  LKLGLSIDEDEAAGD-GDTDLPDLEEDGNEESKMEEVD  703



>gb|KFK26865.1| hypothetical protein AALP_AA8G303900 [Arabis alpina]
Length=705

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD++EKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSK
Sbjct  550  CKTIKDILGDKIEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPELEEDVAEESKMEEVD  705



>dbj|BAJ85535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSK
Sbjct  560  CKTIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSK  619

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  620  KTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  679

Query  271  LKLGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  167
            L+LGL+ID+ A  +  D +MP+LE++ AE SKMEEVD
Sbjct  680  LRLGLNIDDQADAEEEDADMPSLEEEGAEESKMEEVD  716



>ref|XP_010928209.1| PREDICTED: heat shock protein 90-2-like, partial [Elaeis guineensis]
Length=132

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = -3

Query  559  PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELCKRADADKN  380
            PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEEL KRA+ADKN
Sbjct  1    PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKN  60

Query  379  DKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGDAADVEMPALED  200
            DKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDED    AD EMP+LED
Sbjct  61   DKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDETVDADAEMPSLED  120

Query  199  -DAEGSKMEEVD  167
             DAEGSKMEEVD
Sbjct  121  ADAEGSKMEEVD  132



>ref|XP_004308051.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=703

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRD+SM  YMSSK
Sbjct  550  CKTIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDNSMGAYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTF +RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFASRIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSI+ED     D +MP LED AE SKMEEVD
Sbjct  670  LKLGLSIEEDET-VEDADMPELEDAAEESKMEEVD  703



>gb|ADC53691.1| heat shock protein 90-2 [Cryptocoryne ciliata]
Length=236

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 148/157 (94%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  80   CKVVKDILGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  139

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  140  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  199

Query  271  LKLGLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSI +EDA   AD +MP+LED D EGSKMEEVD
Sbjct  200  LKLGLSIDEEDAPADADADMPSLEDADGEGSKMEEVD  236



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K++LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YM+SK
Sbjct  554  CKVIKEILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMASK  613

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+AD+NDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  614  KTMEINPDNGIMEELRKRAEADRNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRM  673

Query  271  LKLGLSIDEDAGDAADVEMPAL-EDDAEGSKMEEVD  167
            LKLGL+IDE+A    D +MPAL E  AE SKMEEVD
Sbjct  674  LKLGLNIDEEAAPEDDADMPALDEGAAEESKMEEVD  709



>ref|XP_006659552.1| PREDICTED: heat shock protein 81-1-like isoform X2 [Oryza brachyantha]
Length=699

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDETAEADTDMPPLEDDAGESKMEEVD  699



>sp|A2YWQ1.1|HSP81_ORYSI RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Indica Group]
 sp|Q0J4P2.2|HSP81_ORYSJ RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Japonica Group]
 emb|CAA77978.1| heat shock protein 82 (HSP82) [Oryza sativa]
 dbj|BAD08818.1| heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD08897.1| heat shock protein 82 [Oryza sativa Japonica Group]
 gb|EAZ07512.1| hypothetical protein OsI_29768 [Oryza sativa Indica Group]
 gb|ADM86854.1| 82kDa heat shock protein [Oryza sativa Japonica Group]
Length=699

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDETAEADTDMPPLEDDAGESKMEEVD  699



>ref|XP_006659551.1| PREDICTED: heat shock protein 81-1-like isoform X1 [Oryza brachyantha]
Length=699

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDETAEADTDMPPLEDDAGESKMEEVD  699



>ref|XP_004500151.1| PREDICTED: heat shock cognate protein 80-like [Cicer arietinum]
Length=699

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADAD+NDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRM
Sbjct  603  KTMEINPENSIMEELRKRADADRNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDAG+ A+ +MP LE+   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDAGE-AEADMPPLEEADADAEGSKMEEVD  699



>ref|XP_009417329.1| PREDICTED: heat shock protein 81-1 [Musa acuminata subsp. malaccensis]
Length=699

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 144/156 (92%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  605  KTMEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED     D +MP LED DAE SKMEEVD
Sbjct  665  LKLGLSIDEDE-KVEDTDMPTLEDADAEESKMEEVD  699



>ref|XP_009628903.1| PREDICTED: heat shock protein 83-like [Nicotiana tomentosiformis]
Length=703

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  548  CKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSK  607

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPN F  RIHRM
Sbjct  608  KTMEINPDNGIMEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNAFAARIHRM  667

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSI+ED     D EMP LE+   E SKMEEVD
Sbjct  668  LKLGLSIEEDEASGDDTEMPVLEEVGKEESKMEEVD  703



>emb|CAA68885.1| heat shock protein 90A [Arabidopsis thaliana]
Length=704

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  549  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  608

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IME+L KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  609  KTMEINPDNGIMEDLRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  668

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  669  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  704



>ref|XP_010928210.1| PREDICTED: heat shock protein 90-2-like, partial [Elaeis guineensis]
Length=132

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = -3

Query  559  PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELCKRADADKN  380
            PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEEL KRA+ADKN
Sbjct  1    PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKN  60

Query  379  DKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKLGLSIDEDAGDAADVEMPALED  200
            DKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKLGLSIDED    AD EMP+LED
Sbjct  61   DKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDEDETVDADAEMPSLED  120

Query  199  -DAEGSKMEEVD  167
             DAEGSKMEEVD
Sbjct  121  ADAEGSKMEEVD  132



>ref|XP_009390627.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  605  KTMEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSIDED     D +MP LED  DAE SKMEEVD
Sbjct  665  LKLGLSIDEDE-KVEDTDMPTLEDAADAEESKMEEVD  700



>ref|XP_002509852.1| heat shock protein, putative [Ricinus communis]
 gb|EEF51239.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  549  CKKIKEILGDRVEKVMVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSK  608

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            K MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  609  KIMEINPDNSIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRM  668

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGL I+ED   A  +EMP LE++   SKMEEVD
Sbjct  669  LKLGLGIEEDEAGAEYIEMPVLEEENAESKMEEVD  703



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 147/157 (94%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEV  170
            LKLGLSIDEDA +  D +MP LED   +AEGSKMEE+
Sbjct  663  LKLGLSIDEDAVE-GDADMPPLEDADAEAEGSKMEEL  698



>ref|XP_009420064.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=698

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 145/156 (93%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  604  KTMEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED   A D +MP LE+ DAE SKMEEVD
Sbjct  664  LKLGLSIDEDE-KAEDTDMPPLEEADAEESKMEEVD  698



>ref|XP_008652859.1| PREDICTED: heat shock protein 81-1 [Zea mays]
 tpg|DAA61991.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C ++K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  545  CKIIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG RIHRM
Sbjct  605  KTMEINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDKSAEAEAEMPPLEDDAGESKMEEVD  699



>ref|XP_010545291.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  544  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRAD DKNDKSVKDLV LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  604  KTMEINPENPIMDELRKRADEDKNDKSVKDLVHLLFETALLTSGFSLDDPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAE--GSKMEEVD  167
            LKLGLSID++AG+    +MP LEDDAE  GSKMEEVD
Sbjct  664  LKLGLSIDDEAGETEADDMPPLEDDAEADGSKMEEVD  700



>ref|XP_006280097.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
 gb|EOA12995.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
Length=705

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  705



>ref|XP_010442803.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=705

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  705



>ref|XP_010445119.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=706

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  551  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  610

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRM
Sbjct  611  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRM  670

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  671  LKLGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  706



>ref|XP_010482633.1| PREDICTED: heat shock protein 90-1 [Camelina sativa]
Length=705

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  705



>ref|NP_001062159.1| Os08g0500700 [Oryza sativa Japonica Group]
 dbj|BAF24073.1| Os08g0500700, partial [Oryza sativa Japonica Group]
Length=694

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  540  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  599

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  600  KTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  659

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  660  LKLGLSIDEDETAEADTDMPPLEDDAGESKMEEVD  694



>ref|XP_008355028.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=694

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 145/158 (92%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  538  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  597

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KR DADKNDKSVKDLVLLLFET LLTSGFSLDDPNTFGNRIHRM
Sbjct  598  KTMEINPENPIMEELRKRXDADKNDKSVKDLVLLLFETXLLTSGFSLDDPNTFGNRIHRM  657

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSID+D  +  D +MP LED   DAEGSKMEEVD
Sbjct  658  LKLGLSIDDDTVE-GDADMPPLEDADADAEGSKMEEVD  694



>ref|XP_006659553.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=699

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  605  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDE+    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEEETAEADTDMPPLEDDAGESKMEEVD  699



>ref|XP_010913224.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+NPIM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSL+DPNTFG+RIHRM
Sbjct  605  KTMEINPDNPIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFGSRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  665  LKLGLSIDEDETVDADTDMPSLEDADAEGSKMEEVD  700



>ref|XP_002444804.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
 gb|EES14299.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
Length=698

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  604  KTMEINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDEAPEADTDMPPLEDDAGESKMEEVD  698



>prf||1710352A heat shock protein 83
Length=705

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSP CLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  550  CKTIKEILGDKVEKVVVSDRIVDSPSCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRM  669

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  670  LKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>ref|XP_011080917.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=704

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  549  CKVIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSK  608

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ DKNDKSVKDLVLLL+ETALLTSGFSLDDPNTF  RIHRM
Sbjct  609  KTMEINPDNGIMEELRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNTFAARIHRM  668

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSID+D     D EMPALE+DA E SKMEEVD
Sbjct  669  LKLGLSIDDDETATDDTEMPALEEDANEESKMEEVD  704



>gb|KHN43913.1| Heat shock cognate protein 80 [Glycine soja]
Length=494

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 6/155 (4%)
 Frame = -3

Query  616  DVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEI  437
            DVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEI
Sbjct  341  DVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEI  400

Query  436  NPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKLGL  257
            NPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGL
Sbjct  401  NPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGL  460

Query  256  SIDEDAGDAADVEMPALE-----DDAEGSKMEEVD  167
            SIDEDAG+ AD +MP LE      DAEGSKMEEVD
Sbjct  461  SIDEDAGE-ADADMPPLEDADADADAEGSKMEEVD  494



>dbj|BAK08741.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SK
Sbjct  545  CKLMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>dbj|BAK08690.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08693.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SK
Sbjct  545  CKLMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAATEEGSRMEEVD  701



>dbj|BAH97107.1| heat shock protein of Hsp90 [Chara braunii]
 dbj|BAK08668.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08669.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08670.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08671.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08672.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08673.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08674.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08675.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08676.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08677.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08678.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08679.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08680.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08681.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08682.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08683.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08684.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08685.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08686.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08687.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08688.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08689.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08692.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08694.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08695.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08696.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08697.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08698.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08699.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08700.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08701.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08702.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08703.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08704.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08705.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08706.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08707.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08708.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08709.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08710.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08711.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08712.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08713.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08714.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08715.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08716.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08717.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08718.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08719.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08720.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08721.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08722.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08723.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08724.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08725.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08726.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08727.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08729.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08730.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08731.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08732.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08733.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08736.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08737.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08738.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08739.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08740.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08832.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08833.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08834.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08835.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08836.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08837.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08838.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08839.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08840.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SK
Sbjct  545  CKLMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>dbj|BAK08691.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08734.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08735.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SK
Sbjct  545  CKLMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>dbj|BAD04054.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|EAZ09522.1| hypothetical protein OsI_31797 [Oryza sativa Indica Group]
Length=699

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD  699



>ref|XP_010047845.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like 
[Eucalyptus grandis]
Length=702

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 6/160 (4%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  544  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  604  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALED-----DAEGSKMEEVD  167
            LKLGLSIDEDAG+  D +MP LED     +AEGSKMEEVD
Sbjct  664  LKLGLSIDEDAGE-GDADMPPLEDAEAEAEAEGSKMEEVD  702



>ref|NP_001063503.1| Os09g0482400 [Oryza sativa Japonica Group]
 ref|NP_001175894.1| Os09g0482610 [Oryza sativa Japonica Group]
 sp|Q07078.2|HSP83_ORYSJ RecName: Full=Heat shock protein 81-3; Short=HSP81-3; AltName: 
Full=Gravity-specific protein GSC 381 [Oryza sativa Japonica 
Group]
 dbj|BAD33409.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25417.1| Os09g0482400 [Oryza sativa Japonica Group]
 gb|ACJ54894.1| heat shock protein [Oryza sativa Japonica Group]
 dbj|BAG88166.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94622.1| Os09g0482610 [Oryza sativa Japonica Group]
Length=699

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD  699



>dbj|BAK08728.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SK
Sbjct  545  CKLMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>ref|XP_004973824.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=698

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  604  KTMEINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDETPEADTDMPPLEDDAGESKMEEVD  698



>ref|NP_001063500.1| Os09g0482100 [Oryza sativa Japonica Group]
 sp|Q69QQ6.1|HSP82_ORYSJ RecName: Full=Heat shock protein 81-2; Short=HSP81-2; AltName: 
Full=Heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD33406.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25414.1| Os09g0482100 [Oryza sativa Japonica Group]
Length=699

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  545  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRM
Sbjct  605  KTMEINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  665  LKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD  699



>gb|KJB24311.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=704

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSK
Sbjct  549  CKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMSAYMSSK  608

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IME L KRA+ DKNDKSVKDLVLLL+ETALLTSGFSLDDPNTF  RIHRM
Sbjct  609  KTMEINPDNGIMEALRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRM  668

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED     DV+MP+LE++  E SKMEEVD
Sbjct  669  LKLGLSIDEDETAVDDVDMPSLEEETNEESKMEEVD  704



>gb|KCW79839.1| hypothetical protein EUGRSUZ_C01179 [Eucalyptus grandis]
Length=691

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 6/160 (4%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  533  CKVIKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  592

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  593  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  652

Query  271  LKLGLSIDEDAGDAADVEMPALED-----DAEGSKMEEVD  167
            LKLGLSIDEDAG+  D +MP LED     +AEGSKMEEVD
Sbjct  653  LKLGLSIDEDAGE-GDADMPPLEDAEAEAEAEGSKMEEVD  691



>ref|XP_010941080.1| PREDICTED: heat shock protein 83 [Elaeis guineensis]
Length=702

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C VMKD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  547  CKVMKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSK  606

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN I+EEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG RIHRM
Sbjct  607  KTMEINPENGIIEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGGRIHRM  666

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSIDED     D +MPALE+D  E SKMEEVD
Sbjct  667  LKLGLSIDEDEAAGEDTDMPALEEDGNEESKMEEVD  702



>ref|XP_004294900.1| PREDICTED: heat shock protein 90-2 [Fragaria vesca subsp. vesca]
Length=697

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 147/157 (94%), Gaps = 3/157 (2%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  542  CKVVKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  601

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  602  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  661

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEG-SKMEEVD  167
            LKLGLSID+DA +  D +MP LED DAE  SKMEEVD
Sbjct  662  LKLGLSIDDDAVE-GDADMPPLEDIDAEAESKMEEVD  697



>dbj|BAK08743.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQ LRDSSM+ YM+SK
Sbjct  545  CKLMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQTLRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>ref|XP_004974826.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=643

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  489  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  548

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLD+PNTFG+RIHRM
Sbjct  549  KTMEINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDEPNTFGSRIHRM  608

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    A+ +MP LEDDA  SKMEEVD
Sbjct  609  LKLGLSIDEDETTEAETDMPPLEDDAGESKMEEVD  643



>ref|NP_001170475.1| LOC100384473 [Zea mays]
 gb|ACO35045.1| heat shock protein 90 [Zea mays]
Length=697

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  543  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG RIHRM
Sbjct  603  KTMEINPDNAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGGRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  663  LKLGLSIDEDEAPEADTDMPPLEDDAGESKMEEVD  697



>dbj|BAK08742.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C +MK++LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SK
Sbjct  545  CKLMKEILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSK  604

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTME+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM
Sbjct  605  KTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRM  664

Query  271  LKLGLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  167
            +KLGLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  665  IKLGLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>ref|XP_007142446.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
 gb|ESW14440.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
Length=699

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  543  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA   AD +MP LED   DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDA-ADADADMPPLEDVDADAEGSKMEEVD  699



>ref|XP_007142447.1| hypothetical protein PHAVU_008G281400g [Phaseolus vulgaris]
 gb|ESW14441.1| hypothetical protein PHAVU_008G281400g [Phaseolus vulgaris]
Length=698

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK
Sbjct  542  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  601

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  602  KTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  661

Query  271  LKLGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  167
            LKLGLSIDEDA   AD +MP LED   DAEGSKMEEVD
Sbjct  662  LKLGLSIDEDA-ADADADMPPLEDVDADAEGSKMEEVD  698



>gb|KCW90631.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=691

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSK
Sbjct  537  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGSYMSSK  596

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+A+KNDKSVKDL +LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  597  KTMEINPDNGIMEELRKRAEAEKNDKSVKDLTMLLFETALLTSGFSLDDPNTFAARIHRM  656

Query  271  LKLGLSIDED-AGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDE  AGD AD  MP LE+  AE SKMEEVD
Sbjct  657  LKLGLSIDEGAAGDDAD--MPPLEEGVAEESKMEEVD  691



>ref|XP_010060433.1| PREDICTED: heat shock protein 83-like [Eucalyptus grandis]
 gb|KCW90632.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=704

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C  +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSK
Sbjct  550  CKTIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGSYMSSK  609

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+A+KNDKSVKDL +LLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  610  KTMEINPDNGIMEELRKRAEAEKNDKSVKDLTMLLFETALLTSGFSLDDPNTFAARIHRM  669

Query  271  LKLGLSIDED-AGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGLSIDE  AGD AD  MP LE+  AE SKMEEVD
Sbjct  670  LKLGLSIDEGAAGDDAD--MPPLEEGVAEESKMEEVD  704



>ref|XP_009383207.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 2/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAG+MSSK
Sbjct  546  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGHMSSK  605

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDL LLLFET+LLTSGFSLDDPNTFGNRIHRM
Sbjct  606  KTMEINPENQIMEELRKRADADKNDKSVKDLTLLLFETSLLTSGFSLDDPNTFGNRIHRM  665

Query  271  LKLGLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED     D EMP+LE+ DAE SKMEEVD
Sbjct  666  LKLGLSIDEDE-KVEDTEMPSLEEADAEESKMEEVD  700



>ref|XP_006857538.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
 gb|ERN19005.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
Length=699

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+M+GYMSSK
Sbjct  543  CKVIKDILGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNMSGYMSSK  602

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRAD DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  603  KTMEINPENAIMEELRKRADVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  662

Query  271  LKLGLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  167
            LKLGLSIDED   A  D +MP LED DAEGSKMEEVD
Sbjct  663  LKLGLSIDEDDTAAEQDSDMPPLEDIDAEGSKMEEVD  699



>ref|XP_002447413.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
 gb|EES11741.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
Length=716

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  561  CKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSK  620

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+AD+NDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRM
Sbjct  621  KTMEINPDNGIMEELRKRAEADRNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRM  680

Query  271  LKLGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  167
            LKLGL+IDEDA    D +MPALE+  AE SKMEEVD
Sbjct  681  LKLGLNIDEDAAADEDADMPALEEGAAEESKMEEVD  716



>ref|XP_002981406.1| hypothetical protein SELMODRAFT_271484 [Selaginella moellendorffii]
 gb|EFJ17594.1| hypothetical protein SELMODRAFT_271484 [Selaginella moellendorffii]
Length=704

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 4/159 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  546  CKVIKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSK  605

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  606  KTMEINPDNSIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  665

Query  271  LKLGLSIDED--AGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D  AG  ADV+MP LE+  DAEGSKMEEVD
Sbjct  666  LKLGLSIDDDVGAGADADVDMPPLEEGADAEGSKMEEVD  704



>gb|AGC60019.1| heat shock protein 90 [Saccharum hybrid cultivar SP80-3280]
Length=698

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+ IHRM
Sbjct  604  KTMEINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSPIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  664  LKLGLSIDEDEAPEADTDMPPLEDDAGESKMEEVD  698



>ref|XP_002969937.1| hypothetical protein SELMODRAFT_267300 [Selaginella moellendorffii]
 gb|EFJ29061.1| hypothetical protein SELMODRAFT_267300 [Selaginella moellendorffii]
Length=691

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 4/159 (3%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSK
Sbjct  533  CKVIKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSK  592

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  593  KTMEINPDNSIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRM  652

Query  271  LKLGLSIDED--AGDAADVEMPALED--DAEGSKMEEVD  167
            LKLGLSID+D  AG  ADV+MP LE+  DAEGSKMEEVD
Sbjct  653  LKLGLSIDDDVGAGADADVDMPPLEEGADAEGSKMEEVD  691



>gb|ADP89125.1| heat shock protein 90 [Cenchrus americanus]
 gb|ADP89126.1| heat shock protein 90 [Cenchrus americanus]
Length=698

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSK
Sbjct  544  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  604  KTMEINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  663

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED    A+ +MP LE+DA  SKMEEVD
Sbjct  664  LKLGLSIDEDETAEAETDMPPLEEDAGESKMEEVD  698



>gb|KJB81563.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=684

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 149/157 (95%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSK
Sbjct  528  CKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSK  587

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM
Sbjct  588  KTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRM  647

Query  271  LKLGLSIDEDAGDAADV-EMPALED-DAEGSKMEEVD  167
            LKLGLSIDEDAGDA    EMP LED DAEGSKMEEVD
Sbjct  648  LKLGLSIDEDAGDADADSEMPPLEDADAEGSKMEEVD  684



>ref|XP_007152171.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
 gb|ESW24165.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
Length=700

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 143/157 (91%), Gaps = 2/157 (1%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSK
Sbjct  544  CKVIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGGYMSSK  603

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRM
Sbjct  604  KTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRM  663

Query  271  LKLGLSI-DEDAGDAADVEMPALEDDA-EGSKMEEVD  167
            LKLGLSI +++ G   DV+MP LE+D  E SKMEEVD
Sbjct  664  LKLGLSIDEDENGGDDDVDMPPLEEDGTEESKMEEVD  700



>ref|XP_006659612.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=686

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  CTVMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSK  452
            C V+K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAG MSSK
Sbjct  532  CKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGDMSSK  591

Query  451  KTMEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRM  272
            KTMEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRM
Sbjct  592  KTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRM  651

Query  271  LKLGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  167
            LKLGLSIDED     D +MP LEDDA  SKMEEVD
Sbjct  652  LKLGLSIDEDEAAEVDTDMPPLEDDAGESKMEEVD  686



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380