BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036O16

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    182   4e-51   
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    182   2e-50   Nicotiana sylvestris
ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    180   2e-49   Nicotiana tomentosiformis
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    176   3e-48   Solanum lycopersicum
gb|KDP47121.1|  hypothetical protein JCGZ_22117                         174   4e-47   Jatropha curcas
emb|CDP02523.1|  unnamed protein product                                171   2e-46   Coffea canephora [robusta coffee]
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                170   9e-46   Erythranthe guttata [common monkey flower]
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...    169   9e-46   Solanum tuberosum [potatoes]
gb|KJB77660.1|  hypothetical protein B456_012G149500                    166   8e-45   Gossypium raimondii
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             166   1e-44   Eutrema salsugineum [saltwater cress]
gb|KCW54907.1|  hypothetical protein EUGRSUZ_I00886                     160   2e-44   Eucalyptus grandis [rose gum]
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...    164   4e-44   Solanum lycopersicum
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...    166   5e-44   Eucalyptus grandis [rose gum]
gb|KDP47120.1|  hypothetical protein JCGZ_22116                         164   5e-44   Jatropha curcas
emb|CDX92324.1|  BnaA05g20830D                                          164   6e-44   
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       164   6e-44   Brassica rapa
dbj|BAH19934.1|  AT1G49750                                              160   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    164   1e-43   Sesamum indicum [beniseed]
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...    161   1e-43   
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   164   2e-43   Citrus sinensis [apfelsine]
gb|AEI72268.1|  leucine-rich repeat family protein                      162   2e-43   Citrus trifoliata [hardy orange]
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             163   4e-43   Citrus clementina [clementine]
emb|CDX99236.1|  BnaC05g33510D                                          162   5e-43   
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...    161   7e-43   
gb|KGN43906.1|  hypothetical protein Csa_7G073420                       162   9e-43   Cucumis sativus [cucumbers]
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg             161   1e-42   Eutrema salsugineum [saltwater cress]
ref|NP_188563.1|  leucine-rich repeat-containing protein                161   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...    160   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...    160   3e-42   Sesamum indicum [beniseed]
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein              160   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...    159   6e-42   Vitis vinifera
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...    159   9e-42   Ricinus communis
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...    158   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...    159   1e-41   
ref|XP_002885307.1|  leucine-rich repeat family protein                 159   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    158   1e-41   Tarenaya hassleriana [spider flower]
emb|CDY43618.1|  BnaC09g17570D                                          151   3e-41   Brassica napus [oilseed rape]
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...    157   4e-41   Nicotiana sylvestris
gb|AIE39583.1|  LRR receptor-like protein kinase                        149   4e-41   Humulus lupulus [common hop]
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...    156   5e-41   Nicotiana tomentosiformis
ref|XP_007157235.1|  hypothetical protein PHAVU_002G054000g             155   6e-41   Phaseolus vulgaris [French bean]
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg             156   8e-41   Capsella rubella
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107             156   8e-41   
ref|XP_011467740.1|  PREDICTED: uncharacterized protein At4g06744       156   1e-40   Fragaria vesca subsp. vesca
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                    155   1e-40   Arabis alpina [alpine rockcress]
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...    154   1e-40   Populus euphratica
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...    154   2e-40   Populus euphratica
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g             154   3e-40   Populus trichocarpa [western balsam poplar]
gb|KJB12258.1|  hypothetical protein B456_002G008600                    155   3e-40   Gossypium raimondii
ref|XP_010691719.1|  PREDICTED: uncharacterized protein At4g06744...    154   4e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                    154   7e-40   Arabis alpina [alpine rockcress]
emb|CDY20865.1|  BnaC05g26270D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...    154   1e-39   Brassica rapa
gb|KDP41695.1|  hypothetical protein JCGZ_16102                         152   2e-39   Jatropha curcas
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...    151   2e-39   Prunus mume [ume]
emb|CDY29337.1|  BnaA05g16040D                                          152   3e-39   Brassica napus [oilseed rape]
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...    152   3e-39   
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...    152   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg             152   4e-39   Prunus persica
gb|KJB32334.1|  hypothetical protein B456_005G236100                    150   7e-39   Gossypium raimondii
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg             150   9e-39   Capsella rubella
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative       150   1e-38   
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg             149   2e-38   
ref|XP_003607916.1|  Receptor protein kinase                            148   2e-38   
emb|CDP01296.1|  unnamed protein product                                149   2e-38   Coffea canephora [robusta coffee]
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg             148   3e-38   Citrus clementina [clementine]
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...    148   3e-38   
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...    149   4e-38   Camelina sativa [gold-of-pleasure]
gb|KHN05611.1|  Hypothetical protein glysoja_047056                     148   4e-38   Glycine soja [wild soybean]
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...    148   4e-38   Glycine max [soybeans]
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...    147   4e-38   Fragaria vesca subsp. vesca
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg             149   5e-38   
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...    148   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_007017157.1|  Leucine-rich repeat family protein                 147   8e-38   
emb|CDO97205.1|  unnamed protein product                                147   1e-37   Coffea canephora [robusta coffee]
gb|AES90113.2|  Serine/Threonine kinase, plant-type protein, puta...    147   1e-37   Medicago truncatula
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...    148   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...    147   1e-37   Populus euphratica
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...    147   1e-37   Ricinus communis
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...    147   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...    147   2e-37   Nelumbo nucifera [Indian lotus]
gb|KDP24991.1|  hypothetical protein JCGZ_23974                         146   2e-37   Jatropha curcas
emb|CDY32853.1|  BnaC08g02750D                                          146   3e-37   Brassica napus [oilseed rape]
ref|XP_010107857.1|  Uncharacterized protein L484_027444                145   3e-37   Morus notabilis
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...    145   3e-37   Cucumis sativus [cucumbers]
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...    146   3e-37   Prunus mume [ume]
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                   145   3e-37   Citrus sinensis [apfelsine]
gb|KJB14612.1|  hypothetical protein B456_002G134000                    145   4e-37   Gossypium raimondii
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...    145   4e-37   
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...    145   4e-37   Cucumis melo [Oriental melon]
gb|KDP24986.1|  hypothetical protein JCGZ_23969                         145   4e-37   Jatropha curcas
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...    145   4e-37   Camelina sativa [gold-of-pleasure]
gb|KGN43905.1|  hypothetical protein Csa_7G073410                       145   6e-37   Cucumis sativus [cucumbers]
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...    145   6e-37   
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744       145   1e-36   Brassica rapa
gb|KJB14611.1|  hypothetical protein B456_002G133900                    144   1e-36   Gossypium raimondii
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...    143   1e-36   Nicotiana tomentosiformis
ref|XP_004505256.1|  PREDICTED: uncharacterized protein At4g06744...    144   2e-36   Cicer arietinum [garbanzo]
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...    144   2e-36   Camelina sativa [gold-of-pleasure]
emb|CDY16514.1|  BnaA08g02530D                                          144   2e-36   Brassica napus [oilseed rape]
gb|KHN30415.1|  Hypothetical protein glysoja_033153                     142   3e-36   Glycine soja [wild soybean]
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...    142   3e-36   Glycine max [soybeans]
ref|XP_003516778.2|  PREDICTED: uncharacterized protein At4g06744...    143   4e-36   Glycine max [soybeans]
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...    142   4e-36   Solanum tuberosum [potatoes]
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...    142   5e-36   Sesamum indicum [beniseed]
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...    142   5e-36   
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...    142   6e-36   Populus euphratica
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g             142   6e-36   
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...    142   7e-36   
gb|KHN12808.1|  Hypothetical protein glysoja_008771                     137   9e-36   Glycine soja [wild soybean]
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744       142   1e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|ADN33724.1|  LRR-family protein                                      142   1e-35   Cucumis melo subsp. melo
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g             141   1e-35   Phaseolus vulgaris [French bean]
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...    142   1e-35   
gb|KDP41694.1|  hypothetical protein JCGZ_16101                         140   3e-35   Jatropha curcas
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...    139   3e-35   Solanum tuberosum [potatoes]
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g             140   4e-35   Phaseolus vulgaris [French bean]
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...    139   5e-35   Populus euphratica
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...    139   8e-35   Vitis vinifera
gb|EPS58531.1|  hypothetical protein M569_16282                         137   8e-35   Genlisea aurea
ref|XP_010094651.1|  Uncharacterized protein L484_008883                139   8e-35   Morus notabilis
gb|KHN22492.1|  Hypothetical protein glysoja_041167                     139   9e-35   Glycine soja [wild soybean]
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...    139   9e-35   Vitis vinifera
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg             137   1e-34   
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Glycine max [soybeans]
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744       138   1e-34   Solanum lycopersicum
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...    138   1e-34   
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g             138   1e-34   
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                   137   2e-34   Citrus sinensis [apfelsine]
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   Nicotiana sylvestris
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   Prunus mume [ume]
gb|KCW68710.1|  hypothetical protein EUGRSUZ_F02313                     137   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010094650.1|  Uncharacterized protein L484_008882                137   2e-34   Morus notabilis
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...    138   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...    138   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...    137   3e-34   Citrus sinensis [apfelsine]
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...    137   3e-34   Medicago truncatula
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...    137   5e-34   Glycine max [soybeans]
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...    137   5e-34   
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...    137   5e-34   Eucalyptus grandis [rose gum]
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...    137   6e-34   Glycine max [soybeans]
gb|KHN43047.1|  Hypothetical protein glysoja_007577                     137   7e-34   Glycine soja [wild soybean]
ref|XP_007017156.1|  LRR-family protein                                 136   7e-34   
ref|XP_004238131.2|  PREDICTED: probable inactive receptor kinase...    140   8e-34   
gb|KJB32335.1|  hypothetical protein B456_005G236200                    136   9e-34   Gossypium raimondii
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...    135   2e-33   Nicotiana tomentosiformis
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...    135   2e-33   Fragaria vesca subsp. vesca
ref|XP_008456159.1|  PREDICTED: uncharacterized protein At4g06744...    133   3e-33   Cucumis melo [Oriental melon]
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...    135   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554992.1|  PREDICTED: uncharacterized protein At4g06744       134   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...    134   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...    134   4e-33   Nicotiana sylvestris
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...    134   4e-33   Cicer arietinum [garbanzo]
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...    134   5e-33   
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...    133   6e-33   
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...    134   7e-33   Elaeis guineensis
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...    133   9e-33   
ref|XP_007157715.1|  hypothetical protein PHAVU_002G092200g             134   9e-33   Phaseolus vulgaris [French bean]
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative       133   1e-32   
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...    133   1e-32   Elaeis guineensis
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...    133   2e-32   Glycine max [soybeans]
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...    132   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953109.1|  PREDICTED: uncharacterized protein At4g06744...    132   3e-32   Setaria italica
ref|XP_002452450.1|  hypothetical protein SORBIDRAFT_04g026020          132   3e-32   Sorghum bicolor [broomcorn]
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg               130   9e-32   Erythranthe guttata [common monkey flower]
ref|XP_003575360.1|  PREDICTED: uncharacterized protein At4g06744...    130   9e-32   
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                  130   1e-31   Medicago truncatula
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...    130   2e-31   Cicer arietinum [garbanzo]
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...    129   2e-31   Phoenix dactylifera
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...    129   2e-31   Cucumis sativus [cucumbers]
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...    129   2e-31   
ref|XP_003575361.1|  PREDICTED: uncharacterized protein At4g06744...    129   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...    129   5e-31   Setaria italica
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...    129   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...    128   8e-31   Cucumis sativus [cucumbers]
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...    127   1e-30   Cucumis melo [Oriental melon]
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...    127   1e-30   Tarenaya hassleriana [spider flower]
gb|AFW62989.1|  leucine-rich repeat (LRR) family protein                127   2e-30   
ref|NP_001148637.1|  LOC100282253                                       127   2e-30   
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg             127   2e-30   
dbj|BAJ86461.1|  predicted protein                                      127   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_849339.1|  Leucine-rich repeat-containing protein                126   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870          127   2e-30   Sorghum bicolor [broomcorn]
gb|EMT03089.1|  hypothetical protein F775_11041                         127   3e-30   
gb|ACF84038.1|  unknown                                                 126   3e-30   Zea mays [maize]
ref|NP_001241706.1|  uncharacterized protein LOC100856884               126   3e-30   
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...    127   3e-30   
ref|XP_006647518.1|  PREDICTED: uncharacterized protein At4g06744...    126   4e-30   Oryza brachyantha
gb|ACF79045.1|  unknown                                                 126   4e-30   Zea mays [maize]
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...    126   4e-30   Oryza brachyantha
ref|XP_008677766.1|  PREDICTED: uncharacterized protein LOC100856...    126   5e-30   
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg                125   6e-30   Erythranthe guttata [common monkey flower]
emb|CAE02949.1|  OSJNBa0014K14.21                                       125   7e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    125   7e-30   Vitis vinifera
gb|ACG34018.1|  protein binding protein                                 125   8e-30   Zea mays [maize]
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744       125   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...    125   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744       125   9e-30   Camelina sativa [gold-of-pleasure]
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                    124   1e-29   Arabis alpina [alpine rockcress]
ref|XP_004953107.1|  PREDICTED: uncharacterized protein At4g06744...    124   2e-29   
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...    124   2e-29   Brassica rapa
ref|XP_002874478.1|  leucine-rich repeat family protein                 123   3e-29   
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...    124   3e-29   Oryza brachyantha
gb|EAY86685.1|  hypothetical protein OsI_08067                          123   3e-29   Oryza sativa Indica Group [Indian rice]
gb|EAY86686.1|  hypothetical protein OsI_08068                          123   4e-29   Oryza sativa Indica Group [Indian rice]
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor             123   5e-29   Oryza minuta
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor             123   5e-29   Oryza officinalis
dbj|BAD21636.1|  leucine-rich repeat-like protein                       122   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...    122   7e-29   Eucalyptus grandis [rose gum]
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...    122   8e-29   Eucalyptus grandis [rose gum]
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg             122   9e-29   Eutrema salsugineum [saltwater cress]
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...    121   2e-28   
ref|NP_001150111.1|  protein binding protein precursor                  121   2e-28   
gb|EEC73254.1|  hypothetical protein OsI_07372                          119   3e-28   Oryza sativa Indica Group [Indian rice]
gb|AFW72330.1|  leucine-rich repeat (LRR) family protein                118   3e-28   
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor             120   6e-28   Oryza punctata
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor             119   8e-28   Oryza minuta
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                     119   9e-28   Eucalyptus grandis [rose gum]
gb|EMT04546.1|  hypothetical protein F775_44003                         119   9e-28   
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                       119   1e-27   Triticum urartu
gb|ABS78922.1|  At4g06744-like protein                                  114   1e-27   Arabidopsis lyrata subsp. petraea
ref|XP_006648837.1|  PREDICTED: uncharacterized protein At4g06744...    119   2e-27   Oryza brachyantha
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744       118   2e-27   Brachypodium distachyon [annual false brome]
gb|ABS78920.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. petraea
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                       118   2e-27   Triticum urartu
gb|ABS78915.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. lyrata
gb|ABS78911.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. lyrata
gb|ABS78910.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. lyrata
gb|ABS78905.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. petraea
gb|ABS78900.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. petraea
gb|ABS78901.1|  At4g06744-like protein                                  114   2e-27   Arabidopsis lyrata subsp. petraea
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...    117   4e-27   Cucumis melo [Oriental melon]
ref|NP_001141180.1|  uncharacterized protein LOC100273267 precursor     117   5e-27   Zea mays [maize]
gb|ABS78902.1|  At4g06744-like protein                                  113   5e-27   Arabidopsis lyrata subsp. petraea
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg             117   7e-27   Capsella rubella
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557    120   7e-27   
dbj|BAJ86489.1|  predicted protein                                      117   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABS78906.1|  At4g06744-like protein                                  112   1e-26   Arabidopsis lyrata subsp. petraea
gb|EMT08852.1|  hypothetical protein F775_11606                         117   1e-26   
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...    116   1e-26   
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...    119   2e-26   
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310          115   2e-26   Sorghum bicolor [broomcorn]
gb|ACG42798.1|  leucine-rich repeat, plant specific                     115   3e-26   Zea mays [maize]
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...    115   3e-26   Zea mays [maize]
gb|ABS78899.1|  At4g06744-like protein                                  110   4e-26   Arabidopsis halleri subsp. halleri
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744       114   5e-26   Vitis vinifera
dbj|BAJ91151.1|  predicted protein                                      115   6e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC78222.1|  hypothetical protein OsI_17861                          114   6e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001054210.2|  Os04g0670100                                       114   7e-26   
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580          114   7e-26   Amborella trichopoda
gb|EAZ32358.1|  hypothetical protein OsJ_16568                          114   1e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                            114   1e-25   Oryza sativa [red rice]
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                    114   1e-25   Oryza glaberrima
emb|CAN61023.1|  hypothetical protein VITISV_001143                     112   3e-25   Vitis vinifera
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...    104   2e-22   Brassica rapa
emb|CDY72552.1|  BnaCnng78240D                                          103   3e-22   Brassica napus [oilseed rape]
emb|CDY18974.1|  BnaC01g20940D                                          103   3e-22   Brassica napus [oilseed rape]
emb|CDY49661.1|  BnaC09g41390D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_006851044.1|  hypothetical protein AMTR_s00025p00231860          100   2e-20   
gb|AFW62990.1|  leucine-rich repeat (LRR) family protein              98.2    2e-20   
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                 97.8    3e-20   Citrus sinensis [apfelsine]
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             100   3e-20   Phaseolus vulgaris [French bean]
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg           97.1    6e-20   Citrus clementina [clementine]
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...  96.7    8e-20   Citrus sinensis [apfelsine]
ref|XP_006451101.1|  hypothetical protein CICLE_v100107082mg          95.1    8e-20   
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    9e-20   Nicotiana tomentosiformis
gb|ACU18125.1|  unknown                                               96.3    1e-19   Glycine max [soybeans]
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    1e-19   Nicotiana tomentosiformis
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    2e-19   Cicer arietinum [garbanzo]
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...  97.4    2e-19   
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...  97.4    3e-19   Nicotiana sylvestris
emb|CBI32375.3|  unnamed protein product                              94.4    3e-19   Vitis vinifera
ref|XP_002515589.1|  LRX1, putative                                   96.3    4e-19   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...  96.7    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...  93.2    9e-19   
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    1e-18   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g           92.8    1e-18   
ref|XP_003620502.1|  Extensin-like protein                            95.5    1e-18   
gb|KEH27082.1|  LRR extensin-like protein                             95.1    1e-18   
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    2e-18   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    2e-18   
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    2e-18   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...  94.7    2e-18   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099           94.4    2e-18   
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2         94.7    2e-18   
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g          94.0    2e-18   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                  94.4    2e-18   
emb|CBI26296.3|  unnamed protein product                              92.8    2e-18   
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    3e-18   
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    3e-18   
emb|CDX94809.1|  BnaC03g43790D                                        93.2    4e-18   
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    4e-18   
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    4e-18   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    4e-18   
emb|CDY12948.1|  BnaA09g13260D                                        93.6    4e-18   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    4e-18   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    4e-18   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    4e-18   
emb|CDX88190.1|  BnaA06g27810D                                        92.0    4e-18   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    5e-18   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    5e-18   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    5e-18   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg          92.4    6e-18   
ref|XP_010501433.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    6e-18   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4      93.2    7e-18   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    7e-18   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    8e-18   
emb|CDX93014.1|  BnaA03g37360D                                        91.7    8e-18   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                       90.5    9e-18   
dbj|BAF48663.1|  leucine-rich repeat/extensin                         92.4    1e-17   
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...  92.4    1e-17   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    1e-17   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...  92.4    1e-17   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    1e-17   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    1e-17   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g           91.3    1e-17   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g           91.7    1e-17   
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    1e-17   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg           90.5    2e-17   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    2e-17   
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
gb|KGN56949.1|  hypothetical protein Csa_3G146350                     89.4    2e-17   
emb|CDY19550.1|  BnaC09g13530D                                        91.7    2e-17   
emb|CDX80525.1|  BnaC07g29190D                                        89.7    2e-17   
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg              89.4    2e-17   
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g           91.7    2e-17   
ref|XP_002440709.1|  hypothetical protein SORBIDRAFT_09g005520        89.7    3e-17   
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    3e-17   
ref|XP_009390486.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    3e-17   
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    3e-17   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    3e-17   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  90.9    3e-17   
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4         90.1    3e-17   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    3e-17   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg          89.7    3e-17   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    3e-17   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                       90.9    3e-17   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    3e-17   
ref|XP_006300825.1|  hypothetical protein CARUB_v10019913mg           90.9    3e-17   
emb|CDP14269.1|  unnamed protein product                              90.9    4e-17   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051           90.5    4e-17   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g           90.1    4e-17   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    4e-17   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g           88.6    5e-17   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg          88.6    5e-17   
ref|XP_002885650.1|  predicted protein                                89.4    6e-17   
ref|XP_006360809.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    6e-17   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g           87.8    7e-17   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3         90.1    7e-17   
emb|CDO99097.1|  unnamed protein product                              88.6    8e-17   
ref|XP_010695983.1|  PREDICTED: leucine-rich repeat extensin-like...  87.4    8e-17   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    9e-17   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    9e-17   
gb|KDP27758.1|  hypothetical protein JCGZ_19787                       89.7    9e-17   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    1e-16   
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    1e-16   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    1e-16   
gb|KJB54162.1|  hypothetical protein B456_009G023700                  89.0    1e-16   
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    1e-16   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g           88.6    1e-16   
gb|EYU41449.1|  hypothetical protein MIMGU_mgv1a007525mg              87.8    1e-16   
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    1e-16   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg           87.4    1e-16   
ref|XP_007013226.1|  Leucine-rich repeat family protein               89.4    1e-16   
ref|XP_007042323.1|  Leucine-rich repeat family protein               89.0    1e-16   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    1e-16   
gb|KJB54163.1|  hypothetical protein B456_009G023700                  89.0    1e-16   
gb|KJB79256.1|  hypothetical protein B456_013G040400                  88.2    1e-16   
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                   86.3    1e-16   
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    1e-16   
ref|NP_001131493.1|  leucine-rich repeat (LRR) family protein pre...  87.4    1e-16   
ref|XP_004247590.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    2e-16   
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                  87.8    2e-16   
ref|XP_009758506.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    2e-16   
ref|NP_001150408.1|  receptor-like protein kinase precursor           87.4    2e-16   
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    2e-16   
gb|ACL53978.1|  unknown                                               87.4    2e-16   
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...  88.2    2e-16   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    2e-16   
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    2e-16   
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg           87.4    2e-16   
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                       88.6    2e-16   
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...  89.0    2e-16   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein            86.7    2e-16   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...  87.4    2e-16   
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    2e-16   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    2e-16   
ref|XP_004960846.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    2e-16   
ref|XP_002519151.1|  protein binding protein, putative                88.6    3e-16   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  87.8    3e-16   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...  88.6    3e-16   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg              87.0    3e-16   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  87.8    3e-16   
ref|XP_010938335.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  86.3    3e-16   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    3e-16   
emb|CDY02276.1|  BnaA03g38910D                                        87.8    3e-16   
ref|XP_010501434.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    4e-16   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    4e-16   
ref|XP_002867451.1|  leucine-rich repeat family protein               85.9    4e-16   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                     87.8    4e-16   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...  87.4    4e-16   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    4e-16   
ref|XP_002517082.1|  serine-threonine protein kinase, plant-type,...  85.5    4e-16   
emb|CDX89681.1|  BnaC03g45950D                                        87.8    4e-16   
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg           87.8    4e-16   
ref|XP_006381178.1|  hypothetical protein POPTR_0006s08110g           85.9    5e-16   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg           85.9    5e-16   
ref|XP_009413897.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    5e-16   
ref|XP_002872172.1|  leucine-rich repeat family protein               86.3    5e-16   
gb|EEE62542.1|  hypothetical protein OsJ_17340                        85.5    6e-16   
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    6e-16   
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610        86.3    7e-16   
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    7e-16   
ref|XP_011030645.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    7e-16   
gb|AIE39576.1|  leucine-rich repeat extensin-like protein             83.2    7e-16   
gb|KJB47441.1|  hypothetical protein B456_008G026700                  86.7    7e-16   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                 85.5    8e-16   
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    8e-16   
ref|NP_001050725.1|  Os03g0637600                                     85.1    8e-16   
gb|EAY91133.1|  hypothetical protein OsI_12740                        85.1    9e-16   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    9e-16   
ref|XP_004505561.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    9e-16   
dbj|BAO45886.1|  leucine-rich repeat extensin-like protein            85.5    9e-16   
ref|XP_010488313.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    9e-16   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    9e-16   
ref|XP_010559035.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  84.7    9e-16   
ref|XP_002514492.1|  LRX2, putative                                   86.7    9e-16   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    9e-16   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    9e-16   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...  86.7    9e-16   
emb|CDY34233.1|  BnaA01g24500D                                        84.7    9e-16   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    1e-15   
emb|CDY46593.1|  BnaCnng14150D                                        84.7    1e-15   
gb|EAY96763.1|  hypothetical protein OsI_18683                        85.1    1e-15   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                 85.9    1e-15   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    1e-15   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg           85.9    1e-15   
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    1e-15   
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    1e-15   
ref|XP_002455064.1|  hypothetical protein SORBIDRAFT_03g003730        85.9    1e-15   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg              85.1    1e-15   
ref|XP_009110797.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    1e-15   
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg           85.9    1e-15   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg           86.3    1e-15   
ref|XP_008798454.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    1e-15   
ref|NP_001054807.1|  Os05g0180300                                     84.7    1e-15   
gb|KFK29358.1|  hypothetical protein AALP_AA7G123800                  84.7    1e-15   
gb|KDO40432.1|  hypothetical protein CISIN_1g045837mg                 85.5    1e-15   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1         86.3    1e-15   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...  85.9    1e-15   
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    1e-15   
emb|CDM81891.1|  unnamed protein product                              85.5    1e-15   
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    1e-15   
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    2e-15   
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    2e-15   
ref|XP_004292960.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    2e-15   
ref|XP_002464196.1|  hypothetical protein SORBIDRAFT_01g013940        84.3    2e-15   
ref|NP_188919.1|  leucine-rich repeat extensin-like protein 6         85.1    2e-15   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...  84.7    2e-15   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...  85.9    2e-15   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg           84.3    2e-15   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    2e-15   
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                  85.5    2e-15   
emb|CDP07600.1|  unnamed protein product                              85.1    2e-15   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    2e-15   
gb|KJB06895.1|  hypothetical protein B456_001G004000                  84.7    2e-15   
ref|XP_002885524.1|  hypothetical protein ARALYDRAFT_898761           84.3    2e-15   
ref|XP_010511710.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...  85.5    2e-15   
ref|XP_008665106.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    2e-15   
ref|XP_009626397.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    2e-15   
ref|XP_011100435.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    2e-15   
ref|XP_006420005.1|  hypothetical protein CICLE_v10004988mg           84.3    2e-15   
gb|ADA62506.1|  c-myc tagged LRX1                                     85.5    2e-15   
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    3e-15   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    3e-15   
gb|KJB72347.1|  hypothetical protein B456_011G172700                  83.6    3e-15   
gb|KJB06897.1|  hypothetical protein B456_001G004000                  84.7    3e-15   
ref|XP_007013716.1|  Leucine-rich repeat family protein               84.7    3e-15   
gb|KJB06894.1|  hypothetical protein B456_001G004000                  84.7    3e-15   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    3e-15   
ref|XP_009798822.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    3e-15   
gb|KJB12465.1|  hypothetical protein B456_002G019800                  83.6    3e-15   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg           84.3    3e-15   
ref|XP_010424321.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    3e-15   
ref|XP_006654107.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    4e-15   
ref|XP_002885986.1|  predicted protein                                84.7    4e-15   
ref|XP_010525315.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  83.6    4e-15   



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG+LK ++V DAS N+LTGPIPQSFGC E++E+++L+ NQLYG VPE+LCK+
Sbjct  223  LTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKI  282

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              LEEL+   NYFTQIGPECR L+E+ VLDI   CI DL NQR  + C+ FFL  + C D
Sbjct  283  SSLEELTLKYNYFTQIGPECRKLVEENVLDIGMNCIIDLKNQRKPEECETFFLQKRNCRD  342

Query  349  HKSLLYVPCDI-DESPRKAGphphphrpykkhkRGSSTTYAALK  221
             KSL YVPC I D S R +           +     STTYAALK
Sbjct  343  MKSLSYVPCKIHDFSSRNSSSGRAHTTGDART---RSTTYAALK  383



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 10/164 (6%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLLK +TV DAS+N+LTGPIP SFGC   +E+LN++ NQLYG VPESLCKL
Sbjct  351  LSGCLPYEIGLLKLATVFDASVNKLTGPIPHSFGCLRDMELLNVSYNQLYGPVPESLCKL  410

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              LE+L+   NYFTQ+GPECR L+++KVLDI   CI DL NQR  + C+ FFL  +KCPD
Sbjct  411  GHLEKLTLKFNYFTQVGPECRKLIKEKVLDISMNCILDLENQRKPEECESFFLQPRKCPD  470

Query  349  HKSLLYVPCDIDE--SPRKAGphphphrpykkhkRGSSTTYAAL  224
             +SL  VPC+IDE  S R+               R  STTYAA+
Sbjct  471  MESLSKVPCNIDEFSSGRRP--------HRHLRARARSTTYAAI  506


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 53/106 (50%), Gaps = 11/106 (10%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPI-PQSFGCXEKLEILNLTNNQLYGSVPESLCK  533
            L+G  P  +    N T  D   NQLTGP+ PQ F     L++L L NN   G +PE+  +
Sbjct  256  LAGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTL--DLDVLFLNNNGFSGEIPETFGR  313

Query  532  LKDLEELSXSGNYFT-----QIGPECRNLLEKKVLDIDNXCIXDLP  410
               L  ++ + N FT      IG  CRN+LE  VL ++N     LP
Sbjct  314  TAAL-FITLANNRFTGQIPKSIGNACRNILE--VLFLNNQLSGCLP  356



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 5/163 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLPYEIGLLK +TV DAS+N+LTGPIP SFGC   +++LN++ NQLYG VPESLCKL
Sbjct  352  LYGCLPYEIGLLKLATVFDASVNKLTGPIPHSFGCLRDMQLLNISYNQLYGPVPESLCKL  411

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L++L+   NYFTQ+GPECR L+++K+LDI   C+ DL NQR  + C+ FFL  +KCPD
Sbjct  412  SHLQKLTLKFNYFTQVGPECRKLIKEKILDISMNCVLDLENQRKPEECEAFFLQPRKCPD  471

Query  349  HKSLLYVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAAL  224
             +SL  VPC+IDE S R++              R  STTYAA+
Sbjct  472  MESLSKVPCNIDEFSSRQSS----GRAYRHHRARAHSTTYAAI  510


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 53/106 (50%), Gaps = 11/106 (10%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPI-PQSFGCXEKLEILNLTNNQLYGSVPESLCK  533
            L+G  P  +    N T  D   NQLTGP+ PQ F     L++L L NN   G +PE+  +
Sbjct  257  LAGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTL--DLDVLFLNNNGFSGEIPETFGR  314

Query  532  LKDLEELSXSGNYFT-----QIGPECRNLLEKKVLDIDNXCIXDLP  410
               L  ++ + N FT      IG  CRN+LE  VL ++N     LP
Sbjct  315  TAAL-FITLANNRFTGEIPKSIGNACRNILE--VLFLNNQLYGCLP  357



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 116/164 (71%), Gaps = 5/164 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG+LK ++V DAS N+LTGPIPQSFGC  ++E+++L+ NQLYG VPE+LCK+
Sbjct  301  LTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLVQMEVMDLSYNQLYGEVPETLCKI  360

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              LEEL+   NYFTQIGPECR L+E+ VL+I   CI DL NQR  + C+ FFL  + C D
Sbjct  361  SSLEELTLKYNYFTQIGPECRKLVEENVLNIGMNCIIDLENQRKPEECEAFFLQKRNCRD  420

Query  349  HKSLLYVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAALK  221
             KSL Y+PC + E S R +       R +    +  STTYAA+K
Sbjct  421  MKSLSYIPCKLHEFSSRNSS----ARRAHTGDAKARSTTYAAVK  460



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GCLPYEIG LK +TV D S N+LTGPIP SFGC  K+EILNL  N+ YG VPE +C+L
Sbjct  331  FTGCLPYEIGNLKKATVFDVSRNKLTGPIPHSFGCLPKIEILNLATNEFYGPVPELVCEL  390

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            K L+ LS SGNYFTQ+GPECR L++ K LD+   CI DLP+QRSA  C+DFF   +KCP+
Sbjct  391  KTLQNLSLSGNYFTQVGPECRKLIKAKRLDVRKNCILDLPDQRSAAQCRDFFSKNRKCPN  450

Query  349  HKSLLYVPC  323
             KSL  VPC
Sbjct  451  EKSLTIVPC  459



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 109/165 (66%), Gaps = 8/165 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIG L  + + D SINQLTGPIPQSFGC + ++ LNL+ NQ YG+VPESLC L
Sbjct  326  LSGCLPCEIGFLNKTHIVDVSINQLTGPIPQSFGCLKDIQQLNLSYNQFYGAVPESLCIL  385

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             DLE L    NYFTQ+GPECR L+EKKVL++   CI DLP QRS + CK FF  +  CPD
Sbjct  386  GDLEVLDLKFNYFTQVGPECRKLIEKKVLNVTMNCILDLPCQRSPEECKAFFSKHWTCPD  445

Query  349  HKSLLYVPCDIDES--PRKAGphphphrpykkhkRGSSTTYAALK  221
             KSL YVPC I+ S  P +A  H              S TYAALK
Sbjct  446  PKSLNYVPCGINVSKGPPQASDHVPKRARP------PSPTYAALK  484



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG LK ST+ DAS N+LTGPIP SFGC EKL  LN++ N L G VPESLC+L
Sbjct  335  LSGCLPYEIGKLKKSTLFDASANRLTGPIPHSFGCMEKLRYLNVSYNHLSGEVPESLCRL  394

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            +DL+EL+ + NYFTQ+GP CR L++   LDI   C+ DLP+QRSA  C+ FFL  Q CP+
Sbjct  395  RDLDELTLNHNYFTQVGPACRKLIKSGKLDIRVNCVLDLPSQRSAAECEAFFLKQQYCPN  454

Query  349  HKSLLYVPCDIDES  308
             +S+  VPC ID S
Sbjct  455  RESMNIVPCKIDYS  468



>ref|XP_006356575.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=444

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLL  +TV DAS NQLTG IP SFGC  K+EILNL  NQ YG+VPE +CKL
Sbjct  286  LTGCLPYEIGLLSKATVFDASKNQLTGKIPHSFGCLAKMEILNLAQNQFYGAVPELVCKL  345

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ L+ S NYFT++GPEC+ L++KKVLD+   CI  LP QRSA+ C  FF   + CPD
Sbjct  346  CNLKNLTLSYNYFTEVGPECKKLIQKKVLDVRMNCIPGLPMQRSAEECAAFFCKPRSCPD  405

Query  349  HKSLLYVPCDIDES  308
             KS+ +VPC I  S
Sbjct  406  EKSMGFVPCSIGSS  419



>gb|KJB77660.1| hypothetical protein B456_012G149500 [Gossypium raimondii]
Length=449

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  STV DAS N+LTGPIP SFGC +K++IL+LTNNQ YG VPE++CKL
Sbjct  286  LTGCLPYEIGNLTQSTVFDASSNKLTGPIPYSFGCLKKMQILSLTNNQFYGEVPETVCKL  345

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L +LS S NYFT +GP CR L+EKK LD+   CI  LPNQRS + C +FFL  + CP 
Sbjct  346  PMLNKLSLSNNYFTHVGPACRGLIEKKKLDVKKNCIYGLPNQRSEKECVEFFLKKKDCPR  405

Query  349  HKSLLYVPC  323
             ++  +VPC
Sbjct  406  METFYWVPC  414



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC EK+E LNL  N  YG++PE +C+L
Sbjct  301  LTGCLPYQIGKLNQATVFDVEFNQLTGPIPYSFGCLEKMEQLNLARNNFYGTIPEMVCEL  360

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CR L++KK+LD+   CI DLPNQR+   C  FF+  Q CP+
Sbjct  361  SALKNVSLSFNYFTQVGPKCRKLIKKKILDVRMNCILDLPNQRTPWECAKFFMRKQNCPN  420

Query  349  HKSLLYVPCDID  314
             KS  Y+PC  D
Sbjct  421  SKSFFYIPCGKD  432



>gb|KCW54907.1| hypothetical protein EUGRSUZ_I00886 [Eucalyptus grandis]
Length=240

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLLK +T  DASINQLTGPIP SFGC +++  LNL+ + LYG VPE++C L
Sbjct  78   LSGCLPYEIGLLKKTTTFDASINQLTGPIPHSFGCLQQMNQLNLSYSHLYGPVPETVCML  137

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  L+ + NYFTQ+GPECR L+ KK L++   CI  LP+QRS   C  FF    KCP+
Sbjct  138  PKLSALTLNNNYFTQVGPECRKLILKKKLNVRMNCILGLPSQRSPAECDAFFSKKVKCPN  197

Query  349  HKSLLYVPCDIDE  311
             +S+ Y+PC I +
Sbjct  198  ERSMRYLPCKISQ  210



>ref|XP_004248758.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=442

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLL  +TV D S NQLTG IP SFGC  K+EILNL  NQ YG+VPE +CKL
Sbjct  284  LTGCLPYEIGLLSKATVFDVSKNQLTGKIPHSFGCLAKIEILNLAQNQFYGAVPELVCKL  343

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ L+ S NYF ++GPEC+ L+EK+VLDI   CI  LP QRSA+ C  FF   + CPD
Sbjct  344  CNLKNLTLSYNYFNEVGPECKKLIEKRVLDIKMNCIPGLPMQRSAEECAAFFCKPRSCPD  403

Query  349  HKSLLYVPCDI  317
             KSL +VPC +
Sbjct  404  EKSLGFVPCSV  414



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLLK +T  DASINQLTGPIP SFGC +++  LNL+ N LYG VPE++C L
Sbjct  351  LSGCLPYEIGLLKKTTTFDASINQLTGPIPHSFGCLQQMNQLNLSCNHLYGPVPETVCVL  410

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  L+ + NYFTQ+GPECR L+ KK LD+   CI  LP+QRS   C  FF    KCP+
Sbjct  411  PKLSALTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFFSKKVKCPN  470

Query  349  HKSLLYVPCDIDES  308
             KS+ YVPC I +S
Sbjct  471  EKSMRYVPCKISQS  484



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GCLPYEIG LK +TV D S N LTGPIP SF C  K++ILNL NN  YG VPE +C+L
Sbjct  291  FTGCLPYEIGNLKKATVFDVSCNMLTGPIPHSFACLAKIQILNLANNGFYGPVPEMVCQL  350

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ LS SGN+FTQ+GPECR L+  K +D+   CI DLP QRSA  CK+FF   + CP+
Sbjct  351  PNLQNLSLSGNFFTQVGPECRKLIMLKRIDVGQNCILDLPYQRSADECKEFFSKRRTCPN  410

Query  349  HKSLLYVPC  323
             KSL YVPC
Sbjct  411  EKSLTYVPC  419



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC +K+E LNL  N+ YG++PE +C+L
Sbjct  296  LTGCLPYQIGKLNQATVFDVEFNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCEL  355

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CR L++KK+LD+   CI DLP QR+   C  FF+  QKCP 
Sbjct  356  SALKNVSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQKCPK  415

Query  349  HKSLLYVPCD  320
             KS  Y+PCD
Sbjct  416  SKSFFYMPCD  425



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC +K+E LNL  N+ YG++PE +C+L
Sbjct  296  LTGCLPYQIGKLNQATVFDVEFNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCEL  355

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CR L++KK+LD+   CI DLP QR+   C  FF+  QKCP 
Sbjct  356  SALKNVSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQKCPK  415

Query  349  HKSLLYVPCD  320
             KS  Y+PCD
Sbjct  416  SKSFFYMPCD  425



>dbj|BAH19934.1| AT1G49750 [Arabidopsis thaliana]
Length=275

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC E +E LNL  N+ YG++PE +C++
Sbjct  109  LTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEI  168

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CR L+++K++D+   CI DLPNQ++   C  FF+  Q CP+
Sbjct  169  ACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQTCPN  228

Query  349  HKSLLYVPCD  320
             KSL  VPCD
Sbjct  229  SKSLFTVPCD  238



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 101/140 (72%), Gaps = 3/140 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+ +TV DAS N LTGPIP SFGC + +   N++ NQLYG+VPE LC L
Sbjct  326  LSGCLPPEIGLLQKATVFDASANHLTGPIPHSFGCLKNMLFFNMSYNQLYGAVPEPLCNL  385

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L EL+   NYFTQ+GP+CR L+  K LDI   CI DLP+QRSA  C+ FFL+ Q CPD
Sbjct  386  GSLIELTLKFNYFTQVGPKCRKLIMSKKLDISMNCILDLPSQRSAAECETFFLNQQSCPD  445

Query  349  HKSLL-YVPCDID--ESPRK  299
             +SL+ Y+PC ID  ESP +
Sbjct  446  PQSLINYMPCKIDNHESPEE  465



>ref|XP_004170987.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Cucumis 
sativus]
Length=357

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + DAS N LTGPIP SF C  K+++LN  NN LYG+VPE +CKL
Sbjct  195  LSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKL  254

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             D+++L+   N+ TQ+GP CR+L+ KKVLD+   CI  LP Q+S + C  FF H + CPD
Sbjct  255  PDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPD  314

Query  349  HKSLLYVPC  323
             KS+ Y+PC
Sbjct  315  EKSMKYIPC  323



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GCLPYEIG L NSTV D   N+LTGPIP SFGC   ++ LNL  NQ YG VPE +C+L
Sbjct  331  FTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSSMQYLNLAMNQFYGPVPEIVCQL  390

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFTQ+GPECR L+++KVLD+   CI DLPNQRS + C  FF   +KCP+
Sbjct  391  PKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFFSESKKCPN  450

Query  349  HKSLLYVPCDIDES  308
             +SL  VPC  + S
Sbjct  451  ERSLTLVPCARNRS  464



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GCLPYEIG L NSTV D   N+LTGPIP SFGC   ++ LNL  NQ YG VPE +C+L
Sbjct  286  FTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSGMQFLNLAMNQFYGPVPEIVCQL  345

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFTQ+GPECR L+++KVLD+   CI DLPNQRS + C  FF   +KCP+
Sbjct  346  PKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSPEECGKFFSESKKCPN  405

Query  349  HKSLLYVPC  323
             +SL  VPC
Sbjct  406  ERSLTLVPC  414



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GCLPYEIG L NSTV D   N+LTGPIP SFGC   ++ LNL  NQ YG VPE +C+L
Sbjct  342  FTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSSMQYLNLAMNQFYGPVPEIVCQL  401

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFTQ+GPECR L+++KVLD+   CI DLPNQRS + C  FF   +KCP+
Sbjct  402  PKLVNLSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFFSESKKCPN  461

Query  349  HKSLLYVPC  323
             +SL  VPC
Sbjct  462  ERSLTLVPC  470



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N LTGPIP SFGC +K+E LNL  N+ YG++PE +C+L
Sbjct  295  LTGCLPYQIGKLNQATVFDVEFNLLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCEL  354

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CR L++KK+LD+   CI DLP QR+   C  FF+  QKCP 
Sbjct  355  SALKNISLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQKCPK  414

Query  349  HKSLLYVPCD  320
             KS  Y+PCD
Sbjct  415  SKSFFYMPCD  424



>ref|XP_004137107.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=459

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + DAS N LTGPIP SF C  K+++LN  NN LYG+VPE +CKL
Sbjct  297  LSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKL  356

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             D+++L+   N+ TQ+GP CR+L+ KKVLD+   CI  LP Q+S + C  FF H + CPD
Sbjct  357  PDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPD  416

Query  349  HKSLLYVPC  323
             KS+ Y+PC
Sbjct  417  EKSMKYIPC  425



>gb|KGN43906.1| hypothetical protein Csa_7G073420 [Cucumis sativus]
Length=488

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + DAS N LTGPIP SF C  K+++LN  NN LYG+VPE +CKL
Sbjct  326  LSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKL  385

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             D+++L+   N+ TQ+GP CR+L+ KKVLD+   CI  LP Q+S + C  FF H + CPD
Sbjct  386  PDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPD  445

Query  349  HKSLLYVPC  323
             KS+ Y+PC
Sbjct  446  EKSMKYIPC  454



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC +K+E LNL  N+ YG++PE +C++
Sbjct  330  LTGCLPYQIGKLNRATVFDVGFNQLTGPIPYSFGCLDKMEQLNLARNKFYGAIPEIVCEI  389

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L+++ +LD+   CI DLPNQ+++Q C DFF+  Q CP+
Sbjct  390  SCLKNLSLSYNYFTQVGPKCRQLIKRNILDVRMNCILDLPNQKTSQECADFFMRKQTCPN  449

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  450  SKSMFRIPC  458



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D  +NQLTGPIP SFGC +K+E LNL  N  YG++PE +C+L
Sbjct  330  LTGCLPYQIGNLNRATVFDVELNQLTGPIPYSFGCLKKMEQLNLARNNFYGTIPEIVCEL  389

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L+++K+LD+   CI DL NQR+   C  FFL  Q CP+
Sbjct  390  SALKNLSLSYNYFTQVGPKCRTLIKRKILDVGMNCILDLTNQRTPWECAKFFLRKQSCPN  449

Query  349  HKSLLYVPCDID  314
             KS  Y+PC  D
Sbjct  450  FKSFFYLPCGKD  461



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D   NQLTGPIP SFGC  K+E LNL  N+ YG+VPE +C L
Sbjct  316  LTGCLPYEIGKLNQATVFDVGFNQLTGPIPYSFGCLGKMEQLNLARNKFYGAVPEIVCDL  375

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              ++ LS S NYFTQ+GP+CR L++K+VLD+   CI DLPNQRS   C  FF+  + CP+
Sbjct  376  PRIQNLSLSYNYFTQVGPKCRELIKKRVLDVRMNCILDLPNQRSPDDCAKFFMRKESCPN  435

Query  349  HKSLLYVPC  323
             +S+ ++PC
Sbjct  436  PESVFWMPC  444



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 103/166 (62%), Gaps = 2/166 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+ +TV DAS N LTGPIPQSF C  +++ILNL NNQLYG VPE +CKL
Sbjct  296  LSGCLPCEIGLLEKATVFDASRNLLTGPIPQSFACLAQMQILNLANNQLYGPVPELVCKL  355

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT++GPECR L+ K VLD+   CI  LP QRS   C  FF   + CPD
Sbjct  356  ANLGNLSLSYNYFTKVGPECRKLINKNVLDLTMNCIPGLPGQRSPAQCHAFFSKARSCPD  415

Query  349  HKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  212
              S  ++PC+ +   R+               +  S +YAAL   R
Sbjct  416  EGSFSWMPCNANS--RRNSLELSDSVSTSTGSKEPSRSYAALHPHR  459



>ref|NP_175397.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AAG13059.1|AC011807_18 Unknown protein [Arabidopsis thaliana]
 gb|AAS47632.1| At1g49750 [Arabidopsis thaliana]
 gb|AAS76756.1| At1g49750 [Arabidopsis thaliana]
 dbj|BAH19559.1| AT1G49750 [Arabidopsis thaliana]
 gb|AEE32471.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=494

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC E +E LNL  N+ YG++PE +C++
Sbjct  328  LTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEI  387

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CR L+++K++D+   CI DLPNQ++   C  FF+  Q CP+
Sbjct  388  ACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQTCPN  447

Query  349  HKSLLYVPCD  320
             KSL  VPCD
Sbjct  448  SKSLFTVPCD  457



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG LK++TV D   NQLTGPIP SFGC + ++ILNL  NQ YG VPE+LC+L
Sbjct  352  LSGCLPYEIGYLKDATVFDVGFNQLTGPIPHSFGCLDSIQILNLAANQFYGPVPETLCEL  411

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFTQ+GP+CR L+ +K LD+   CI  LP Q+    C  FF   ++CPD
Sbjct  412  PNLYNLSLSHNYFTQVGPKCRKLITEKKLDVRMNCILGLPQQKPEHACSHFFSQVRQCPD  471

Query  349  HKSLLYVPC  323
             KS + VPC
Sbjct  472  PKSFIKVPC  480



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GCLPYEIG L  + V D S N+LTGPIP SFGC   +EILNL  NQ YG VPE +CKL
Sbjct  341  FTGCLPYEIGFLTKTRVFDVSCNKLTGPIPHSFGCLSMIEILNLAKNQFYGPVPEIVCKL  400

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ LS SGNYFTQ+GPECR L+  + LD+ N CI  LPNQR  + C +FF   ++C +
Sbjct  401  PNLQNLSLSGNYFTQVGPECRKLISLRRLDVRNNCILGLPNQRPPKACTEFFSKPKQCAN  460

Query  349  HKSLLYVPC  323
             +S+ Y+PC
Sbjct  461  ERSMNYIPC  469



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 98/137 (72%), Gaps = 4/137 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL+++TV DA  N LTGPIP SFGC EK+E+LNL  NQLYG +PE++C L
Sbjct  298  LSGCLPYEIGLLRSATVFDAGNNLLTGPIPCSFGCLEKMELLNLAGNQLYGQIPEAVCAL  357

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKC--  356
            ++L  LS S NYFT +GP CRNL++  VL+++N CI  LPNQRS   C  F  H   C  
Sbjct  358  RNLVNLSLSDNYFTSVGPTCRNLIKNGVLNVNNNCIHGLPNQRSVGECSAF--HPGSCPY  415

Query  355  PDHKSLLYVPCDIDESP  305
            P   S  ++PC++ +SP
Sbjct  416  PPSYSFSFIPCELPQSP  432



>ref|XP_008454973.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=520

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + DAS N LTGPIP SF C  K+++LN  +N LYG+VPE +CKL
Sbjct  358  LSGCLPMEIGLLENTILFDASNNSLTGPIPYSFACLAKIQLLNFADNTLYGAVPEGVCKL  417

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +++ L+   N+ TQ+GP CR+L+ KKVLD+   CI  LP QRS + C  FF H + CPD
Sbjct  418  PNIQNLTLRNNFITQVGPVCRSLISKKVLDVSGNCILGLPEQRSEEECTHFFTHVELCPD  477

Query  349  HKSLLYVPC  323
             KS+ Y+PC
Sbjct  478  EKSMKYIPC  486



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTG IP SFGC  K+E LNL  N  YG++PE +C+L
Sbjct  331  LTGCLPYQIGNLNRATVFDVESNQLTGLIPYSFGCLNKMEQLNLARNNFYGTIPEIVCEL  390

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L+++K+LD+   CI DL NQR+   C  FFL  Q CP+
Sbjct  391  SALKNLSLSSNYFTQVGPKCRTLIKRKILDVGMNCILDLANQRAPWECAKFFLRKQSCPN  450

Query  349  HKSLLYVPCDID  314
            +KS  YVPC  D
Sbjct  451  YKSFFYVPCGKD  462



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D   N LTGPIP SFGC +K+E LNL  N  YG++PE++C L
Sbjct  288  LTGCLPYEIGKLNLATVFDVGSNLLTGPIPYSFGCLDKMEQLNLARNTFYGTIPETVCNL  347

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              ++ LS S NYFT +GP+CR L++KKVLD+   CI  LPNQRSA  C  FF+  Q CP+
Sbjct  348  PRIQNLSLSYNYFTHVGPKCRELIKKKVLDVRMNCILGLPNQRSATECSKFFMRKQPCPN  407

Query  349  HKSLLYVPC  323
             KS  ++PC
Sbjct  408  PKSFFWIPC  416



>emb|CDY43618.1| BnaC09g17570D [Brassica napus]
Length=210

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N LTGPIP SFGC +K+E  NL  N+ +G++PE +C++
Sbjct  44   LTGCLPYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQFNLARNKFFGTIPEIVCEI  103

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S N+FTQ+GP+CRNL+++ +LD+   CI DLPNQ++   C +FF+    CP+
Sbjct  104  SSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKLTCPN  163

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  164  SKSMFRIPC  172



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLL  + + D S N+LTG IP SFGC   ++ILNL  NQ YG VPE +CKL
Sbjct  296  LTGCLPYEIGLLTKARIFDVSKNKLTGKIPHSFGCLANMQILNLAQNQFYGPVPELVCKL  355

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ LS S NYFT++GPEC+ L+++KVLD+   CI  LP QRSA  C  FF   + CPD
Sbjct  356  SNLKNLSLSYNYFTEVGPECKKLIQRKVLDVRMNCIPGLPMQRSAAECAAFFCKPRSCPD  415

Query  349  HKSLLYVPCDI  317
             KSL  VPC I
Sbjct  416  EKSLGIVPCTI  426



>gb|AIE39583.1| LRR receptor-like protein kinase, partial [Humulus lupulus]
Length=141

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             SGCLPY IG LKN T+ DAS N +TGPIP SFGC  K+E+LNL NNQLYG VPES+CKL
Sbjct  18   FSGCLPYGIGKLKNLTLFDASTNLITGPIPHSFGCLSKIELLNLANNQLYGEVPESVCKL  77

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   + SGNY TQ+GP CR L+  K L++D  CI DLP QRS + C  FF    +CP+
Sbjct  78   PNLSNFTLSGNYITQVGPMCRKLINSKRLNVDWNCIRDLPKQRSFEDCGHFFSKDHQCPE  137

Query  349  HKS  341
              S
Sbjct  138  CSS  140



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLL  + + D S N+LTG IP SFGC  K++ILNL  NQ YG VPE +CKL
Sbjct  299  LTGCLPYEIGLLTKARIFDVSKNKLTGKIPHSFGCLAKMQILNLAQNQFYGPVPELVCKL  358

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ LS S NYFT++G EC+ L+E+KVLD+   CI  LP QRSA  C  FF   + CPD
Sbjct  359  SNLKNLSLSYNYFTEVGSECKKLIERKVLDVRMNCIPGLPMQRSAAECAAFFCKPRSCPD  418

Query  349  HKSLLYVPCDI  317
             KSL  VPC I
Sbjct  419  EKSLEIVPCRI  429



>ref|XP_007157235.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
 gb|ESW29229.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
Length=433

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLPY+IGLL  +TV D S N LTGPIP+SFGC E +  LNL  NQ+YG VPE++C+L
Sbjct  271  FQGCLPYQIGLLNKATVFDVSKNWLTGPIPRSFGCLESIRYLNLEQNQMYGEVPETVCEL  330

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              L     LS S NYFTQ+GP CR L+E  VLD+ N CI  LPNQR+ + C  FF + + 
Sbjct  331  PGLRNRGNLSLSDNYFTQVGPACRRLIEANVLDVRNNCILGLPNQRTHEQCSQFFSNLKP  390

Query  358  CPDHKSLLYVPC  323
            CP+ KSL YVPC
Sbjct  391  CPNPKSLNYVPC  402



>ref|XP_006307323.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
 gb|EOA40221.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
Length=496

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG LK +TV D   NQLTGPIP SFGC + +E LNL  N+ YG++PE +C++
Sbjct  330  LTGCLPYQIGNLKQATVFDVGGNQLTGPIPYSFGCLDSMEQLNLARNKFYGTIPEIVCEI  389

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+E KVLD+   CI DLPNQ + Q C DFF   Q C D
Sbjct  390  ACLKNLSLSYNYFTQAGPKCRKLIESKVLDVRMNCILDLPNQNTPQQCADFFKRRQTCAD  449

Query  349  HKSLLYVPC  323
             KSL  VPC
Sbjct  450  PKSLFIVPC  458



>ref|XP_002894215.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70474.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTGPIP SFGC E +E LNL  N+ YG++PE +C++
Sbjct  312  LTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEI  371

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ +S S NYFTQ+GP+CRNL+++K++D+   CI DLPNQ++   C +FF+  Q C +
Sbjct  372  ACLKNVSLSYNYFTQVGPKCRNLIKRKIMDVSMNCILDLPNQKTPSECANFFMRKQTCLN  431

Query  349  HKSLLYVPC  323
             KSL  VPC
Sbjct  432  SKSLFTVPC  440



>ref|XP_011467740.1| PREDICTED: uncharacterized protein At4g06744 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIG L  +T+ D S NQLTGPIPQSF C  K+EIL L NNQ YG+VPE +CKL
Sbjct  344  LSGCLPMEIGKLNQATLFDVSYNQLTGPIPQSFACLTKMEILVLDNNQFYGAVPELVCKL  403

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS + NYFTQ+GP CR L++K  L +DN CI DL  QR    C  FF   + CP+
Sbjct  404  PSLMNLSLANNYFTQVGPACRKLIKKGFLHVDNNCILDLKYQRPKSECASFFSKPRYCPN  463

Query  349  HKSLLYVPC  323
             +SLLY+PC
Sbjct  464  ERSLLYIPC  472



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC E +E LNL  N+ YG++PE +C+L
Sbjct  317  LTGCLPYQIGKLNRATVFDVESNELTGPIPYSFGCLENMEQLNLARNKFYGTIPEIVCEL  376

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L++ K+LD+   CI DL NQRS   C  FFL  Q C +
Sbjct  377  SALKNLSLSFNYFTQVGPKCRKLIKTKILDVRMNCILDLANQRSPWECAKFFLRKQNCHN  436

Query  349  HKSLLYVPC  323
             KS  Y+PC
Sbjct  437  FKSFFYIPC  445



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 91/139 (65%), Gaps = 6/139 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLP+EIG L  + V D   N+LTGPIP SF C +K+E LNL  N+ YG+VPE +C L
Sbjct  242  LEGCLPFEIGKLDKTVVFDVGSNKLTGPIPHSFACLKKMENLNLAKNKFYGTVPEMVCDL  301

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFTQ+GPECR L+ K++LD+   CI DLP QRSA  C  FF   + CP+
Sbjct  302  PRLANLSLSYNYFTQVGPECRKLISKRILDVRMNCILDLPGQRSAADCAKFFSKQRTCPN  361

Query  349  HKSLLYVPCDIDESPRKAG  293
             +SL Y+PC      RK G
Sbjct  362  ERSLSYIPC------RKGG  374



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLPYEIG L  + V D   N+LTGPIP SF C EK+EILNL  N+ YG VPE +C L
Sbjct  230  LEGCLPYEIGKLDKTVVFDVGSNKLTGPIPLSFACLEKMEILNLAMNKFYGPVPEMVCDL  289

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFTQ+G ECR L+ K++LD+   CI DLP QRSA  C  FF   + CP+
Sbjct  290  PRLANLSLSYNYFTQVGHECRKLISKRILDVRMNCILDLPGQRSAADCAKFFSKQRTCPN  349

Query  349  HKSLLYVPCDIDESPRKAG  293
             +SL Y+PC      RK G
Sbjct  350  ERSLNYIPC------RKGG  362



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+GLLK + V DAS N+LTGP+P +  C EK+E+LN T NQL+G VPE +C+L
Sbjct  285  LTGCLPYEVGLLKEAIVFDASNNKLTGPLPVALSCLEKVELLNFTGNQLFGMVPEVVCEL  344

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            + L   S S NYFT +GP CR+L  K VLDI N CI  LP QRS   C DF  H + CP 
Sbjct  345  EKLRNFSLSANYFTTLGPMCRDLFYKGVLDITNNCIPGLPFQRSVVECLDFIAHPKSCPR  404

Query  349  HKSLLYVPCDIDESPRKAG  293
              S  ++PC+   SP  +G
Sbjct  405  MWSYTFIPCN---SPFSSG  420



>gb|KJB12258.1| hypothetical protein B456_002G008600 [Gossypium raimondii]
Length=497

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L+N+TV D  +N+LTGPIP SFGC +K+E LNL  N+ YG VPE +C+L
Sbjct  328  LTGCLPYEIGYLQNATVFDVGMNKLTGPIPHSFGCLKKMEQLNLAGNEFYGEVPEIVCRL  387

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+ LS S NYFTQ+GP CR+L+ KK L++ N CI DLP QRS   C  FF     C  
Sbjct  388  SNLQNLSLSSNYFTQVGPACRDLVMKKKLNVKNNCILDLPEQRSKADCAMFFSRKLICDR  447

Query  349  HKSLLYVPC  323
             +S  ++PC
Sbjct  448  TESFKWIPC  456



>ref|XP_010691719.1| PREDICTED: uncharacterized protein At4g06744-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG LK + V D S N LTGPIP+SFGC EK++ L + NN+ +G+VPE +C L
Sbjct  303  LSGCLPYEIGYLKKARVFDVSTNYLTGPIPRSFGCLEKMQNLVMANNEFFGAVPEEVCML  362

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L++LS   NYFTQ+GPEC  L+ K VLD+ N CI  LPNQ+S ++C  FF   + C +
Sbjct  363  PHLKQLSLCNNYFTQVGPECMKLVHKGVLDVTNNCILGLPNQKSKEMCASFFKRPKTCGE  422

Query  349  HKSLLYVPC  323
             KSL  VPC
Sbjct  423  EKSLTIVPC  431



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D  +NQLTGPIP SFGC +K+E LNL  N+ YG++PE +C+L
Sbjct  326  LTGCLPYQIGNLNQATVFDVEVNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCEL  385

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFTQ+GP+CR L++  +LD+   CI DLPNQ++   C  FF+  Q CP+
Sbjct  386  SCLMNLSLSYNYFTQVGPKCRTLIKSNILDVRMNCILDLPNQKTPMECAKFFMKKQTCPN  445

Query  349  HKSLLYVPC  323
              S+  VPC
Sbjct  446  SHSMFLVPC  454



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N LTGPIP SFGC +K+E LNL  N+ +G++PE +C++
Sbjct  351  LTGCLPYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQLNLARNKFFGTIPEIVCEI  410

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S N+FTQ+GP+CRNL++K +LD+   CI DLPNQ++   C +FF+    CP+
Sbjct  411  SSLKNLSLSYNFFTQVGPKCRNLIKKNILDVRMNCILDLPNQKTPLECANFFMQKHICPN  470

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  471  SKSMFRIPC  479



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N LTGPIP SFGC +K+E LNL  N+ +G++PE +C++
Sbjct  389  LTGCLPYQIGKLNRATVFDVEYNNLTGPIPYSFGCLDKMEQLNLARNKFFGTIPEIVCEI  448

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S N+FTQ+GP+CRNL+++ +LD+   CI DLPNQ++   C +FF+    CP+
Sbjct  449  SSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKHTCPN  508

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  509  SKSMFRIPC  517



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLLK +TV DA  NQLTGP+P S  C E +E LN   N L+G VPE +C+L
Sbjct  279  LTGCLPYEIGLLKEATVFDAGNNQLTGPLPLSLACLENVEQLNFAGNMLFGMVPELVCEL  338

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            + L  LS S NYF  +GP CR L+EK V+DI N CI DLP QRS + C DFF H + CP 
Sbjct  339  QSLVNLSLSDNYFITVGPLCRILIEKGVVDIRNNCIPDLPFQRSVEECADFFAHPKFCPR  398

Query  349  HKSLLYVPC  323
              S  Y PC
Sbjct  399  MWSYTYSPC  407



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG LK +TV D S N LTGPIP SF C  KLE L+L +NQ YG VP+++CK 
Sbjct  244  LSGCLPYEIGYLKKATVFDVSSNILTGPIPNSFACLGKLEYLSLASNQFYGRVPDAVCKF  303

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++LE  S + NYFT+IGP C  L+ K++LD+   CI  LPNQ++A  C  FF   + CP 
Sbjct  304  RNLERFSAANNYFTRIGPACLALIRKRILDVRGNCIPGLPNQKTAAQCAAFFSIPRTCPR  363

Query  349  HKSLLYVPC  323
             ++L  +PC
Sbjct  364  PRTLSIIPC  372



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N LTGPIP SFGC +K+E  NL  N+ +G++PE +C++
Sbjct  309  LTGCLPYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQFNLARNKFFGTIPEIVCEI  368

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S N+FTQ+GP+CRNL+++ +LD+   CI DLPNQ++   C +FF+    CP+
Sbjct  369  SSLKNLSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKLTCPN  428

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  429  SKSMFRIPC  437



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D S N LTGPIP SF C  K++ LNL NN  YG VPE +C L
Sbjct  322  LTGCLPYEIGYLNQATVFDVSSNFLTGPIPHSFSCLAKIDYLNLANNSFYGPVPEQVCTL  381

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L     + NYFT++GPECR L++KKVLD+   CI   PNQ++   C  FF   +KCP+
Sbjct  382  SNLRNFYLANNYFTEVGPECRKLIKKKVLDVRQNCILGQPNQKTKAQCTAFFSKPRKCPN  441

Query  349  HKSLLYVPC  323
             K + YVPC
Sbjct  442  EKEMTYVPC  450



>ref|XP_010270780.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=495

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG LK +TV DA  N LTGPIP SFGC E++++LN T N+LYG VPE +C L
Sbjct  334  LSGCLPYEIGFLKKATVFDAGNNHLTGPIPYSFGCLERMQLLNFTGNKLYGPVPEVVCGL  393

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-CP  353
              L   S S NYFTQ+GP+CR L++K  LDI N CI DLP+QR A  C+ FF    K C 
Sbjct  394  PSLANFSLSDNYFTQVGPKCRELIKKGKLDIRNNCILDLPSQRPADHCEKFFSSNPKYCS  453

Query  352  DHKSLLYVPCDI  317
            D K+   +PC +
Sbjct  454  DLKTNTMIPCRL  465



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D S N LTGPIP SF C  K+E LNL +N+ YG VPE +C L
Sbjct  370  LTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTL  429

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   S + NYFT++GPECR L++KK+LD+   CI   PNQ++   C  FF   +KCP+
Sbjct  430  SNLGNFSLANNYFTEVGPECRKLMKKKLLDVRQNCILGEPNQKTKAQCNAFFSKPRKCPN  489

Query  349  HKSLLYVPC  323
             K + YVPC
Sbjct  490  EKEMTYVPC  498



>gb|KJB32334.1| hypothetical protein B456_005G236100 [Gossypium raimondii]
Length=433

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D   N+LTGPIP SFGC +K+E+LNL  N+ YG VPE +C+L
Sbjct  270  LTGCLPYEIGNLSQATVFDVGSNKLTGPIPYSFGCLKKIELLNLACNEFYGEVPEIVCQL  329

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            K+L+ LS S NYFTQ+GP CR+L+ KK LD+ N CI DLP QRS   C  FF     C  
Sbjct  330  KNLQNLSLSYNYFTQVGPACRDLIMKKKLDVKNNCILDLPFQRSEAECTAFFSRNLYCDR  389

Query  349  HKSLLYVPC  323
              S  +VPC
Sbjct  390  KDSFKWVPC  398



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC  K+E LNL  N+ YG++PE LC+L
Sbjct  295  LTGCLPYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLNLARNKFYGTIPEILCEL  354

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L++KK+LD+   CI DL NQR+   C  FFL  QKCP+
Sbjct  355  SSLKNLSLSSNYFTQVGPKCRTLIKKKILDVGMNCILDLANQRTPWECTKFFLRKQKCPN  414

Query  349  HKSLLYVPCDID  314
             K+  Y+PC  D
Sbjct  415  FKTFFYIPCGKD  426



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D   N+LTGPIP SFGC  K+E+LNL NN+ YG+VPE +C+L
Sbjct  332  LTGCLPYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQL  391

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ-KCP  353
              +E LS + NYFTQ+GP CR L+ KK LD+ N CI DLPNQ+S   C  FF      C 
Sbjct  392  PKIENLSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQKSKDECAKFFSRPPLGCE  451

Query  352  DHKSLLYVPC  323
              +S  +VPC
Sbjct  452  RKESFKWVPC  461



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG LK +TV D S N LTGPIP SF C  KLE L+L +NQ YG VPE++C L
Sbjct  255  LSGCLPYEIGYLKQATVFDVSSNILTGPIPNSFACLGKLEYLSLASNQFYGRVPEAVCGL  314

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            + LE  + + NYFT+IGP C  L+ KK+LD+   C+  LPNQ++A  C  FF   + CP 
Sbjct  315  RHLERFNAANNYFTRIGPACMTLIRKKILDVRGNCLPGLPNQKTAAQCAAFFSIPRTCPR  374

Query  349  HKSLLYVPC  323
               L  +PC
Sbjct  375  RTRLSIIPC  383



>ref|XP_003607916.1| Receptor protein kinase [Medicago truncatula]
Length=366

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLPYEIG LK +TV D S N LTGPIP SFGC EK++ LNL +N+ YG+VPES+C L
Sbjct  201  FEGCLPYEIGYLKKATVFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPESVCVL  260

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              ++    LS +GNYFT++ P C +LL+ K+LD+ N CI  LPNQRS Q C +F    + 
Sbjct  261  SGIKNNGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQCKIKP  320

Query  358  CPDHKSLLYVPC  323
            C + +SL YVPC
Sbjct  321  CSNPQSLSYVPC  332



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G LK + V DA  NQLTGPIP S GC +K+E+LN   N LYG VPE +C L
Sbjct  270  LTGCLPYELGFLKEAVVFDAGNNQLTGPIPFSLGCLKKVEVLNFAGNYLYGMVPEVVCAL  329

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP C NL++K VLD+   CI  LP QRS   C  FF   + CP 
Sbjct  330  GNLANLSLSDNYFTTVGPICWNLIKKGVLDVRKNCIAGLPFQRSVWECAHFFARPRYCPY  389

Query  349  HKSLLYVPC  323
              +  Y+PC
Sbjct  390  WAAFTYIPC  398



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 86/138 (62%), Gaps = 0/138 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG LK + V D   NQLTG +P S  C EK+E LN  NN L+G VPE++C L
Sbjct  289  LTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGL  348

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   S S NYFT  GP CR L+EK VLD+ N CI DLP QRS   C DFF H + CP 
Sbjct  349  PNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPH  408

Query  349  HKSLLYVPCDIDESPRKA  296
              S  Y+PC     P  A
Sbjct  409  MWSYTYIPCKPYYIPEMA  426



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 86/138 (62%), Gaps = 0/138 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG LK + V D   NQLTG +P S  C EK+E LN  NN L+G VPE++C L
Sbjct  289  LTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGL  348

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   S S NYFT  GP CR L+EK VLD+ N CI DLP QRS   C DFF H + CP 
Sbjct  349  PNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVSECADFFAHPRFCPH  408

Query  349  HKSLLYVPCDIDESPRKA  296
              S  Y+PC     P  A
Sbjct  409  MWSYTYIPCKPYFIPEMA  426



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC +K+E L+L  N  YG++PE +C++
Sbjct  336  LTGCLPYQIGNLNRATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEIVCEI  395

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+E+K+LD+   CI DLPNQ+  + C  FF   Q C D
Sbjct  396  ACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQTCSD  455

Query  349  HKSLLYVPCDIDESPRKAG  293
             KSL  VPC  + +  K G
Sbjct  456  PKSLFIVPCGKNPNRLKPG  474



>gb|KHN05611.1| Hypothetical protein glysoja_047056 [Glycine soja]
Length=418

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP++IG L  +TV D S N LTGPIP SF C   ++ LNL  NQ YG VPE LC+L
Sbjct  259  FQGCLPFQIGYLVKATVFDVSKNSLTGPIPHSFACLASIQFLNLERNQFYGEVPEMLCQL  318

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              L     LS S NYFTQ+GP CRNL++ KVLD+ N CI  LPNQR    C +FF   + 
Sbjct  319  PGLRNNGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCTEFFSKIKP  378

Query  358  CPDHKSLLYVPC  323
            CP+ K+L YVPC
Sbjct  379  CPNPKNLHYVPC  390



>ref|XP_003538630.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=437

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP++IG L  +TV D S N LTGPIP SF C   ++ LNL +NQ YG VPE LC+L
Sbjct  278  FQGCLPFQIGYLVKATVFDVSKNSLTGPIPHSFACLASIQFLNLEHNQFYGEVPEMLCQL  337

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              L     LS S NYFTQ+GP CRNL++ KVLD+ N CI  LPNQR    C +FF   + 
Sbjct  338  PGLRNNGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCTEFFSKIKP  397

Query  358  CPDHKSLLYVPC  323
            CP+ K+L YVPC
Sbjct  398  CPNPKNLHYVPC  409



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=411

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+G L+++TV DA  NQLTGP+P S GC +K+E LN  +N LYG VPE LC+L
Sbjct  262  LTGCIPYELGFLRDATVFDAGNNQLTGPLPCSLGCLDKIEQLNFADNFLYGRVPEVLCEL  321

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +G  CR L+EK VLDI N CI DL +QRSA+ C  FFLH + C  
Sbjct  322  GNLANLSLSNNYFTGVGTACRKLIEKGVLDIRNNCIQDLADQRSAEECALFFLHPKSCLH  381

Query  349  HKSLLYVPC  323
             ++   +PC
Sbjct  382  PETYSLIPC  390



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLLK + V DA  NQLTGP+P S  C E  E LN   N LYG VPE +C L
Sbjct  282  LTGCLPYEIGLLKEAIVFDAGNNQLTGPLPFSLACLENAEQLNFAGNLLYGMVPEVVCGL  341

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L +LS S NYFT +GP CR L+ + VLD+ N CI DLP Q+S + C DFF H + CP 
Sbjct  342  QNLVDLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFFAHPRFCPY  401

Query  349  HKSLLYVPC  323
              S  Y+PC
Sbjct  402  MGSYTYIPC  410



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC +K+E L+L  N  YG++PE +C++
Sbjct  324  LTGCLPYQIGNLNQATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEIVCEI  383

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+E+K+LD+   CI DLPNQ+  + C  FF   Q C D
Sbjct  384  ACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQTCSD  443

Query  349  HKSLLYVPC  323
             KSL  VPC
Sbjct  444  PKSLFIVPC  452



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYEIGLLK + V DA  NQLTGP+P S  C E LE LNL  N L+G+VPE LC+L
Sbjct  297  LTGCIPYEIGLLKEAVVFDAGNNQLTGPLPFSLACLENLEQLNLAGNLLFGTVPEVLCEL  356

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYF  +GP CR L+E++VLD+ N CI  LP QRS   C +FF H   CP 
Sbjct  357  GKLVNLSLSDNYFIHVGPLCRILIERRVLDVRNNCIPGLPFQRSIVECANFFAHPMFCPR  416

Query  349  HKSLLYVPC  323
              S  ++PC
Sbjct  417  MWSYTFIPC  425



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLP EIGLL  +TV D S N LTGPIP SF C  K+EILNL  NQ +G VP+ +C+L
Sbjct  289  LTGCLPCEIGLLNKATVFDVSRNLLTGPIPWSFACLAKMEILNLAKNQFFGVVPDPICQL  348

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +LE    S NYFT +GPEC  L+++KVLD+   CI  LPNQRS   C  FF   + C +
Sbjct  349  PNLESFDLSSNYFTGVGPECWKLIQRKVLDVTMNCIPGLPNQRSKAECDAFFCKPRSCSN  408

Query  349  HKSLLYVPC  323
              SL +VPC
Sbjct  409  QGSLTWVPC  417



>gb|AES90113.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=460

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLPYEIG LK +TV D S N LTGPIP SFGC EK++ LNL +N+ YG+VPES+C L
Sbjct  295  FEGCLPYEIGYLKKATVFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPESVCVL  354

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              ++    LS +GNYFT++ P C +LL+ K+LD+ N CI  LPNQRS Q C +F    + 
Sbjct  355  SGIKNNGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQCKIKP  414

Query  358  CPDHKSLLYVPC  323
            C + +SL YVPC
Sbjct  415  CSNPQSLSYVPC  426



>ref|XP_010500525.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=504

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC +K+E L+L  N  YG++PE +C++
Sbjct  338  LTGCLPYQIGNLNRATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEIVCEI  397

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+E+K+LD+   CI DLPNQ+  + C  FF   Q C D
Sbjct  398  ACLKNLSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQTCSD  457

Query  349  HKSLLYVPC  323
             KSL  VPC
Sbjct  458  PKSLFIVPC  466



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+GLLK + V DAS N+LTGP+P +  C EK+E+L+ T NQL+G VPE +C+L
Sbjct  285  LTGCLPYEVGLLKEAIVFDASNNELTGPLPVALSCLEKVELLSFTCNQLFGMVPEVICEL  344

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            K L   S S NYFT +GP CR L  + VLD+ N CI  LP QRS   C DF  H + CP 
Sbjct  345  KKLRNFSLSDNYFTALGPVCRELFYEGVLDVTNNCIPGLPFQRSVVECLDFIAHPKSCPW  404

Query  349  HKSLLYVPCDIDES  308
              S  ++PC +  S
Sbjct  405  MWSYTFIPCKLPFS  418



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLLK + V DA  N+LTG +P S  C +K+E LN   N L+G VPE +CK+
Sbjct  294  LTGCLPYEIGLLKEAVVFDAGNNRLTGSLPLSLACLQKVEQLNFAGNLLFGMVPELVCKM  353

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S NYFT +GP CR L+ K VLD+ N CI DLP QRS   C +FF H + CP 
Sbjct  354  ENLVNLSLSDNYFTTVGPWCRILIAKGVLDVRNNCIPDLPFQRSIMECANFFAHPRFCPH  413

Query  349  HKSLLYVPC  323
              S  Y+PC
Sbjct  414  MWSYTYIPC  422



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL ++TV D   N LTGPIP SF C EK+E+L L  NQ YG +PE +C L
Sbjct  306  LSGCLPYEIGLLTSATVFDVGNNFLTGPIPCSFACLEKMEVLKLAGNQFYGKIPEEVCGL  365

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDF-FLHYQKCP  353
             +L  LS S NYF  +GP CR+L+++ VLD+ N CI  LPNQR A  C DF + H + CP
Sbjct  366  GNLANLSLSDNYFRYLGPTCRSLIKRGVLDVSNNCIHGLPNQRPAAECWDFYYFHLKHCP  425

Query  352  D---HKSLLYVPCDIDES  308
                  +   VPC+I+ S
Sbjct  426  SSLPRYNANVVPCNINHS  443



>ref|XP_010263446.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=474

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLLK +TV DA  N LTGPIP SFGC +++++L+   N+LYG VPE +C L
Sbjct  312  LSGCLPYEIGLLKKATVFDAGNNHLTGPIPYSFGCLKRMQLLSFAGNKLYGQVPEVVCAL  371

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFF-LHYQKCP  353
              L  LS S NYFTQ+GP+CR+L++K  L ++N CI DL +QRS   C+ FF    + C 
Sbjct  372  PKLANLSLSDNYFTQVGPKCRHLIKKGRLHLENNCILDLKSQRSPAECEKFFSSSMEYCS  431

Query  352  DHKSLLYVPCDIDESPRKA  296
              K+   +PC +    +KA
Sbjct  432  YEKTFNVIPCKLRHHSKKA  450



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+G LK   + DAS N LTGP+P S GC  K+E LNLT N LYG VPE +C L
Sbjct  257  LTGCIPYELGFLKELVLFDASNNLLTGPLPCSLGCLTKIEQLNLTGNLLYGQVPEVVCAL  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S NYFT++GP C  L++  VLDI   CI  LPNQRS   C  FFLH + CP 
Sbjct  317  ENLANLSLSNNYFTKLGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFFLHPRYCPY  376

Query  349  HKSLL-YVPCDIDE  311
            H +LL ++PC + +
Sbjct  377  HPTLLNFIPCKVHQ  390



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTG IP SFGC  K+E LNL  N+ YG++PE +C+L
Sbjct  315  LTGCLPYQIGKLNRATVFDVGFNQLTGLIPYSFGCLAKIEQLNLARNKFYGTIPEIVCEL  374

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+++ +LD    CI  LPNQ++AQ C  FF+H Q CPD
Sbjct  375  SSLKNLSLSYNYFTQAGPKCRELIKRSILDARMNCIIGLPNQKTAQECATFFMHRQTCPD  434

Query  349  HKSLLYVPC  323
             KS+  VPC
Sbjct  435  PKSMYLVPC  443



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+GLLK + V DA  N LTGP+P S GC  K+E+LN   N LYG +PE +C +
Sbjct  257  LTGCLPYELGLLKEAVVFDAGNNLLTGPLPCSLGCLRKIEVLNFAGNLLYGKIPEQICAV  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L   S   NYFT +GPECR +++ +VLD+   CI  LP QRSA+ C  FFL  + C  
Sbjct  317  GSLVNFSLFDNYFTSVGPECRKMIKSRVLDVRKNCIRGLPEQRSAEECASFFLKPRSCSH  376

Query  349  HKSLLYVPCDIDESPRKAG  293
              S  ++PC++  S    G
Sbjct  377  PSSFTFMPCEVQPSSESDG  395



>ref|XP_004142874.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004156371.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN62484.1| hypothetical protein Csa_2G356090 [Cucumis sativus]
Length=438

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 96/166 (58%), Gaps = 0/166 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLP+EIG L  +TV DA+ N LTGPIPQSFGC   L+ILNL NNQ YG++PES+C+L
Sbjct  270  LTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLANNQFYGTIPESICRL  329

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             D+  ++ S NYFT+IGP CR L+  + L I   CI     Q++   C  FF   + CP 
Sbjct  330  PDIYNITLSNNYFTRIGPVCRKLVIAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPRTCPR  389

Query  349  HKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  212
              +  YVPC +  +                    S  +YAAL++ R
Sbjct  390  ANTFSYVPCVLPTAAEAVQLDKAKVTSVDDMVPPSPRSYAALEMPR  435



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIGLLK + V DA  NQLTGP+P S  C E +E LN   N  YG VPE +C L
Sbjct  317  LTGCLPYEIGLLKEAIVFDAGNNQLTGPLPFSLACLESVEQLNFAGNLFYGMVPEVVCGL  376

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S NYFT +GP CR L+ + VLD+ N CI DLP Q+S + C DFF   + CP 
Sbjct  377  QNLVNLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFFARPRLCPY  436

Query  349  HKSLLYVPC  323
              S +Y+PC
Sbjct  437  MGSYIYIPC  445



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG LK + V D   NQLTG +P S  C EK+E LN  NN L+G VPE++C L
Sbjct  268  LTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGL  327

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   S S NYFT  GP CR L+EK VLD+ N CI DLP QRS   C DFF H + CP 
Sbjct  328  PNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPH  387

Query  349  HKSLLYVP  326
              S  Y+P
Sbjct  388  MWSYTYIP  395



>gb|KJB14612.1| hypothetical protein B456_002G134000 [Gossypium raimondii]
Length=422

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYEIGLLK + V DA  NQLTG +P S  C E LE LN   N L+G+VPE +C+L
Sbjct  278  LTGCIPYEIGLLKEAVVFDAGNNQLTGHLPFSLACMENLEQLNFAGNLLFGAVPEVVCEL  337

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYF  +GP CR L+E+ VLD+ N CI DLP QRS + C +FF H + CP 
Sbjct  338  GKLMNLSLSENYFIHVGPMCRILIERGVLDVRNNCIPDLPFQRSVEECANFFAHPRFCPR  397

Query  349  HKSLLYVPC  323
              S  Y+PC
Sbjct  398  MWSYNYIPC  406



>ref|XP_004137106.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=398

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + +AS N LTGPIP SF C  K+EILN   N LYG++PE +CKL
Sbjct  242  LSGCLPMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKL  301

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L++ + S N+ TQ+GP CR+L+ K +LD+   CI  LP QR  + C +FF     CPD
Sbjct  302  PNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHSCPD  361

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  362  EKSMKIIPC  370



>ref|XP_008454972.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=428

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + +AS N LTGPIP SF C  K++ILN ++N LYG+VPE +CKL
Sbjct  273  LSGCLPMEIGLLENTVLFNASKNSLTGPIPYSFCCLTKMQILNFSDNNLYGAVPEDVCKL  332

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L+  +   N+FTQ+GP CR+L+ K VLD+   CI  LP QR  + C  FF     CPD
Sbjct  333  PNLQRFNLRNNFFTQVGPICRSLIWKDVLDVSGNCILGLPKQRPEKECTYFFSKPHSCPD  392

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  393  DKSMKIIPC  401



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+G LK   + DAS N LTGP+P S GC  K+E LNLT N LYG VPE +C L
Sbjct  257  LTGCIPYELGFLKELVLFDASNNLLTGPLPCSLGCLTKIEQLNLTGNLLYGQVPEVVCAL  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S NYFT++GP C  L++  VLDI   CI  LPNQRS   C  FFLH + CP 
Sbjct  317  ENLANLSLSNNYFTKVGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFFLHPRYCPY  376

Query  349  HKSLL-YVPCDIDE  311
            H +L  ++PC + +
Sbjct  377  HPTLFNFIPCKVHQ  390



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC  K+E L L  N+ YG++PE LC+L
Sbjct  295  LTGCLPYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLILARNKFYGTIPEILCEL  354

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L+++K+LD+   CI DL NQR+   C  FF+  Q CP+
Sbjct  355  SSLKNLSLSSNYFTQVGPKCRTLIKRKILDVGRNCIQDLANQRTWWECARFFMRRQNCPN  414

Query  349  HKSLLYVPCDID  314
             KS  Y+PC  D
Sbjct  415  SKSFFYIPCGKD  426



>gb|KGN43905.1| hypothetical protein Csa_7G073410 [Cucumis sativus]
Length=468

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + +AS N LTGPIP SF C  K+EILN   N LYG++PE +CKL
Sbjct  312  LSGCLPMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKL  371

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L++ + S N+ TQ+GP CR+L+ K +LD+   CI  LP QR  + C +FF     CPD
Sbjct  372  PNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHSCPD  431

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  432  EKSMKIIPC  440



>ref|XP_004171357.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=466

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+N+ + +AS N LTGPIP SF C  K+EILN   N LYG++PE +CKL
Sbjct  310  LSGCLPMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKL  369

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L++ + S N+ TQ+GP CR+L+ K +LD+   CI  LP QR  + C +FF     CPD
Sbjct  370  PNLQKFNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHSCPD  429

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  430  EKSMKIIPC  438



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTG IP SFGC  K+E LNL  N+ YG++PE +C+L
Sbjct  309  LTGCLPYQIGKLNQATVFDVGFNQLTGLIPYSFGCLAKMEQLNLARNKFYGTIPEIVCEL  368

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+++ +LD+   CI DLPNQ++A  C  FF+  Q CPD
Sbjct  369  SSLKNLSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKTASECSTFFMQRQTCPD  428

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  429  PKSMYLIPC  437



>gb|KJB14611.1| hypothetical protein B456_002G133900 [Gossypium raimondii]
Length=441

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+EIG L  +TV D   N+LTGPIP+SFGC  KL++LN+ +N+ YG+VPE LC+L
Sbjct  280  LSGCLPFEIGYLNRTTVFDVGSNRLTGPIPESFGCMAKLQLLNMAHNRFYGAVPEVLCRL  339

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +    + S NYFTQ+GP+CR L++ + L+++  CI  LP QRSA  C +FF   + C  
Sbjct  340  PNAFNFTLSNNYFTQVGPQCRRLIKLRRLNVNRNCIMGLPFQRSATDCANFFSKPRSCAR  399

Query  349  HKSLLYVPCDIDES  308
              +   +PC +  +
Sbjct  400  ESTFSIIPCRLPAA  413



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+G LK + V DA  N+LTGP+P S GC EK+E+LN   N+LYG VP+ +C L
Sbjct  237  LSGCLPYELGFLKQAVVFDAGNNRLTGPLPFSLGCLEKVEVLNFAGNKLYGIVPDVICAL  296

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP C +L+   VLD+ N CI  LP QRS   C +FF + + CP 
Sbjct  297  GNLANLSLSDNYFTGVGPICLSLIRNGVLDLKNNCIPGLPFQRSFAECVEFFAYPRYCPH  356

Query  349  HKSLLYVPC  323
              +  Y+PC
Sbjct  357  MATYSYIPC  365



>ref|XP_004505256.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=470

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP+EIG LK +TV D S N LTGPIP SFGC EK++ LNL +N+ YG+VPES+C L
Sbjct  304  FEGCLPFEIGYLKKATVFDVSQNLLTGPIPASFGCLEKIQFLNLASNKFYGTVPESVCVL  363

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              +     LS S NYFT IGP C +L++ ++LD+   CI  +PNQRS + C +F    + 
Sbjct  364  PGIRNNGNLSLSDNYFTSIGPACWSLIKYRILDVSKNCIPGIPNQRSPRECYEFQCKKKA  423

Query  358  CPDHKSLLYVPC  323
            C +H+SL YVPC
Sbjct  424  CSNHESLSYVPC  435



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGPIP SFGC  K+E LNL  N+ YG++PE LC+L
Sbjct  295  LTGCLPYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLNLARNKFYGTIPEILCEL  354

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L+++K+LD+   CI  L NQR+   C  FF+  + CP+
Sbjct  355  SSLKNLSLSSNYFTQVGPKCRTLIKRKILDVGMNCIRGLANQRTWWECARFFMRRKNCPN  414

Query  349  HKSLLYVPCDID  314
             KS  Y+PC  D
Sbjct  415  SKSFFYIPCGKD  426



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   NQLTG IP SFGC  K+E LNL  N+ YG++PE +C+L
Sbjct  309  LTGCLPYQIGKLNRATVFDVGFNQLTGLIPYSFGCLAKMEQLNLARNKFYGTIPEIVCEL  368

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ GP+CR L+++ +LD+   CI DLPNQ+ A  C  FF+  Q CPD
Sbjct  369  SSLKNLSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKMASECSTFFMQRQTCPD  428

Query  349  HKSLLYVPC  323
             KS+  +PC
Sbjct  429  PKSMYLIPC  437



>gb|KHN30415.1| Hypothetical protein glysoja_033153 [Glycine soja]
Length=384

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 83/132 (63%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLPY+IG L  +TV D S N LTGPIP SF C + ++ LNL  NQ YG VPE LC L
Sbjct  224  FQGCLPYQIGYLDKATVFDVSKNSLTGPIPHSFACLQSIQYLNLDRNQFYGEVPEMLCLL  283

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              L     LS S NYFTQ+GP CRNL++  VLD+   CI  LPNQR    C +FF   + 
Sbjct  284  PGLRNNGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCTEFFSKIKP  343

Query  358  CPDHKSLLYVPC  323
            CP+ K L YVPC
Sbjct  344  CPNPKYLHYVPC  355



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG LKN T+ D   N LTGPIP SFGC +K+E LNL  N LYG VPE +C L
Sbjct  257  LTGCLPYEIGFLKNLTLFDVGGNLLTGPIPWSFGCLKKVEQLNLARNFLYGQVPEVVCAL  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   S S NYFT++GP C+ L+++ VLD+   CI  LP+QRS + C  FFL  + C  
Sbjct  317  GNLANFSLSYNYFTKVGPLCKMLIQRGVLDVRKNCIFGLPDQRSVRECMAFFLIPKSCSH  376

Query  349  HKSLLYVPCDIDESPRK  299
                 +VPC I     K
Sbjct  377  PALFNFVPCQIQHHWTK  393



>ref|XP_003516778.2| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=463

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 83/132 (63%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLPY+IG L  +TV D S N LTGPIP SF C + ++ LNL  NQ YG VPE LC L
Sbjct  303  FQGCLPYQIGYLDKATVFDVSKNSLTGPIPHSFACLQSIQYLNLDRNQFYGEVPEMLCLL  362

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              L     LS S NYFTQ+GP CRNL++  VLD+   CI  LPNQR    C +FF   + 
Sbjct  363  PGLRNNGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCTEFFSKIKP  422

Query  358  CPDHKSLLYVPC  323
            CP+ K L YVPC
Sbjct  423  CPNPKYLHYVPC  434



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+GLLK + V D   N LTGP+P+S GC E +E LN   N LYG VPE +C L
Sbjct  239  LTGCIPYELGLLKKAIVIDVGFNTLTGPLPRSLGCLESVEQLNFAGNLLYGQVPEVICSL  298

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            K+L   + S NYFT++GP CR L++  VL+++  CI  LPNQRS   C  F +  + CP 
Sbjct  299  KNLVNFTLSYNYFTKVGPLCRELIDNGVLNVEKNCINGLPNQRSILECVLFRMQIKLCPL  358

Query  349  HKSLLYVPCDIDE-SPRK  299
             KSL  +PC+I   SP +
Sbjct  359  QKSLRIIPCNISNFSPHR  376



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLLK + V DA  N LTGP+P S  C EKLE+LN   N LYG +PE LC L
Sbjct  276  LSGCLPYELGLLKQAVVFDAGNNYLTGPLPFSLACLEKLEVLNFAGNLLYGHIPEVLCGL  335

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP C  L++  VLD+   CI  LP QRS   C  FF H + CP 
Sbjct  336  GNLANLSLSDNYFTGVGPVCWRLIKNGVLDVKKNCIPGLPFQRSVAECAAFFAHPRYCPY  395

Query  349  HKSLLYVPC  323
              +  ++PC
Sbjct  396  MPTYAHIPC  404



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIGLLK + V D   NQLTGP+P S  C E +E LN   N L+G VPE +C +
Sbjct  318  LTGCLPYEIGLLKQALVLDVGNNQLTGPLPFSLACLENVEQLNFAGNLLHGMVPEVVCHE  377

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L+ LE  S S NYFT +GP CR+L+ K VLD+ N C+ DLP QR  + C DFF H + CP
Sbjct  378  LQSLENFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLPFQRPVEECADFFAHPRFCP  437

Query  352  DHKSLLYVPC  323
               +  Y+PC
Sbjct  438  FMWTYTYIPC  447



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L+   + DA  N LTGP+P S GC  KLE  NLT N LYG VPE +C L
Sbjct  261  LTGCLPYELGFLRELVLFDAGNNLLTGPLPCSLGCLAKLEQFNLTGNLLYGQVPEVVCAL  320

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFT++GP CR L++  VLDI   CI DLP+QRS   C+ F L  + CP+
Sbjct  321  GKLVNLSLSSNYFTELGPTCRKLVDSGVLDIKKNCIHDLPDQRSVLECEAFSLQRRYCPN  380

Query  349  HKSLLYVPCDIDESP  305
             +S   +PC +  SP
Sbjct  381  PESFNLIPCKVPSSP  395



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 84/135 (62%), Gaps = 0/135 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L    + DA  N LTGP+P S GC  KLE  NLT N LYG VPE +C L
Sbjct  261  LAGCLPYELGFLSELVLFDAGNNLLTGPLPCSLGCLAKLEQFNLTGNLLYGQVPEVVCAL  320

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFT++GP CR L+   VLDI   CI DLP+QRS   C  F LH + CP+
Sbjct  321  GKLVNLSLSSNYFTELGPTCRKLVNSGVLDIKKNCIHDLPDQRSVLECDAFSLHPRYCPN  380

Query  349  HKSLLYVPCDIDESP  305
              S   +PC +  SP
Sbjct  381  PASFNLIPCKVPSSP  395



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYEIG LK   + DAS N LTGP+P S GC  K+E LNL  N LYG VPE +C L
Sbjct  259  LTGCIPYEIGFLKELALFDASNNLLTGPLPCSLGCLAKIEQLNLAGNFLYGQVPEVVCAL  318

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT+IGP C  L++  VLDI N CI  LP+QRS   C  FFLH + CP 
Sbjct  319  GNLANLSLSNNYFTKIGPLCWKLVKTGVLDIRNNCIHGLPDQRSWHECFFFFLHPKYCPY  378

Query  349  HKSLLYVPCDI  317
                 ++PC I
Sbjct  379  PSFFHFIPCKI  389



>gb|KHN12808.1| Hypothetical protein glysoja_008771 [Glycine soja]
Length=224

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIG L+ +TV DA  NQLTGP+P S  C EK+E+LN   N LYG VPE +C  
Sbjct  85   LTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNFGGNLLYGMVPEVVCVG  144

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L +L   S S NYFT +GP CR L+++ VLD+ N CI DLP QRS   C +FF   + CP
Sbjct  145  LVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCP  204

Query  352  DHKSLLYVPCDI  317
                   +PC +
Sbjct  205  FMWFHGLIPCKL  216



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G LK  TV D S NQLTGP+P S  C E++ +L+++ N LYG VP+ LC+L
Sbjct  328  LTGCLPYELGFLKQVTVFDISRNQLTGPLPFSLACLERVALLDVSENLLYGMVPDMLCQL  387

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L +L  S NYFTQ+GP CRNL+ + +LD+ N C+ DLP QRS   C  FF   + CP 
Sbjct  388  PNLGKLDLSDNYFTQVGPACRNLISRGILDVKNNCVPDLPYQRSVFECASFFAVPKNCPY  447

Query  349  HKSLLYVPC  323
              +   +PC
Sbjct  448  MDTFKIIPC  456



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLP+EIG L  +TV DA+ N LTGPIPQSFGC   L+ILNL +NQ YG++PES+C+L
Sbjct  270  LTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLADNQFYGTIPESICRL  329

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             D+  ++ S NYFT+IGP CR L+  + L I   CI     Q++   C  FF   + CP 
Sbjct  330  PDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPRTCPR  389

Query  349  HKSLLYVPC  323
              +  YVPC
Sbjct  390  ANTFSYVPC  398



>ref|XP_007157716.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
 gb|ESW29710.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
Length=413

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L N  + D   N LTGPIP SFGC +K+E LNL  N LYG VPE +C L
Sbjct  257  LTGCLPYDIGFLGNVRLLDVGGNLLTGPIPWSFGCLKKVEQLNLARNFLYGQVPEVVCAL  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT++GP C++L+++ VLD+ N CI  LP+QRSA+ C  FF   + C  
Sbjct  317  GNLANLSLSYNYFTKVGPSCKSLIQRGVLDVRNNCIVGLPDQRSAKECMAFFSIPRSCLH  376

Query  349  HKSLLYVPCDIDES-PRK  299
              S   +PC I  + PR+
Sbjct  377  PASFNIIPCQIHWTKPRE  394



>ref|XP_008444596.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=507

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 97/167 (58%), Gaps = 5/167 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLP+EIG L  +TV DA+ N LTGPIPQSFGC   L+ILNL +NQ YG++PES+C+L
Sbjct  342  LTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLADNQFYGTIPESICRL  401

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             D+  ++ S NYFT+IGP CR L+  + L I   CI     Q++   C  FF   + CP 
Sbjct  402  PDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPRTCPR  461

Query  349  HKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDRP  209
              +  YVPC +   P  A                S  +YAAL  +RP
Sbjct  462  ANTFSYVPCVL---PTAAQLDKATVTSVDDMVPPSPRSYAAL--ERP  503



>gb|KDP41694.1| hypothetical protein JCGZ_16101 [Jatropha curcas]
Length=438

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLP+EIG L+ +TV D   N LTGPIPQSFGC  KL+ILNL +N  YG +PE LC+L
Sbjct  278  LTGCLPFEIGYLQKATVLDFGTNLLTGPIPQSFGCLAKLQILNLAHNMFYGPIPEVLCRL  337

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +    + + NYFTQ+GP+CR L+  + L+++  CI  L  QR A  C  FF   + C  
Sbjct  338  PNAFNFTLTYNYFTQVGPQCRRLIRARRLNVNRNCIFGLTGQRPAAECARFFARPRTCAR  397

Query  349  HKSLLYVPCDIDESPRK  299
              S   +PC +  S  K
Sbjct  398  ESSFSLIPCSLPASSMK  414



>ref|XP_006354850.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=384

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG L  + V DA  N+LTGP+P S GC E +E+LN   NQ+YG VP+ +C L
Sbjct  239  LSGCLPYEIGFLNEAIVFDAGNNRLTGPLPFSLGCLENVEMLNFARNQMYGIVPDVICAL  298

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT  GP C  L+E  VLD+ N CI   P QRS   C  FF + + CP 
Sbjct  299  GNLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFFAYPRYCPH  358

Query  349  HKSLLYVPC  323
              +  Y+PC
Sbjct  359  MATYTYIPC  367



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCK-  533
            L+GCLPYEIG L+ +TV DA  NQLTGP+P S  C EK+E+LNL  N LYG VPE +C  
Sbjct  289  LTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNLLYGMVPEVVCAG  348

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L +L   S S NYFT +GP CR L+++ VLD+ N CI DLP QRS   C +FF   + CP
Sbjct  349  LVNLVNFSLSDNYFTHVGPLCRILIQRGVLDVRNNCIPDLPFQRSVIECAEFFATPRMCP  408

Query  352  DHKSLLYVPCDI  317
                  ++PC +
Sbjct  409  FMWFYSFIPCKL  420



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L+N  + DAS N LTG +P S GC  KLE  NL +N LYG VPE LC L
Sbjct  261  LTGCLPYELGFLRNLVLFDASNNFLTGHLPCSLGCLAKLEQFNLASNLLYGQVPEVLCAL  320

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFT++GP+C  L ++ VLDI   CI DLP QRSA+ C  F LH + C +
Sbjct  321  GKLVNLSLSSNYFTKLGPKCGELEKRGVLDIRKNCIPDLPGQRSARECAAFSLHPRYCSN  380

Query  349  HKSLLYVPCDIDES  308
              S  Y+PC +  S
Sbjct  381  PASFNYIPCKVPSS  394



>ref|XP_010664550.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Vitis 
vinifera]
Length=425

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 93/166 (56%), Gaps = 3/166 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG L+ +TV DA  N LTGPIPQSF C +KL++L+L +NQ YG +P+SLC+L
Sbjct  263  LSGCLPYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQLLSLAHNQFYGRIPDSLCRL  322

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +    + S NYF  IGP C+ L+    LD+   CI  LPNQRSA  C  F+   + CP 
Sbjct  323  PNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFYSVSRTCPR  382

Query  349  HKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  212
              S   + C    +P  +                S  TY AL+  R
Sbjct  383  PGSFNVITC---SNPAASLSSAQVASLQAMAPAPSPVTYKALEPPR  425



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY++GLLK   V DA+ NQLTGP+P S  C EK+EILNL  N+LYGSVP+ LC+L
Sbjct  212  LTGCLPYQLGLLKEVVVIDAAENQLTGPLPTSIACLEKVEILNLAGNRLYGSVPDLLCRL  271

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFT  G  C  L+   VLD+ N CI  LP QR    C  FF     CP+
Sbjct  272  SKLTNLSLSDNYFTVAGDSCMGLIRSGVLDLTNNCIPGLPFQRPPMECAAFFAGQPSCPN  331

Query  349  HKSLLYVPCDI  317
                  +PC I
Sbjct  332  QYIFSKIPCRI  342



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 84/134 (63%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  +TV D   N LTGPIPQSFGC   L+ LNL +NQLYG +PESLC+L
Sbjct  275  LTGCLPYEIGFLGQATVFDVGGNLLTGPIPQSFGCLRNLQYLNLAHNQLYGLIPESLCRL  334

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +    + S N+FTQ+G +CR L+    L++   CI  LP+Q+S   C  FF   + CP 
Sbjct  335  PNAYNFTLSYNFFTQVGVQCRRLIRAGTLNVRRNCILGLPDQKSTAECGRFFSRARTCPR  394

Query  349  HKSLLYVPCDIDES  308
              +   V C+I  +
Sbjct  395  ENTFSIVTCNISAT  408



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIG L+ +TV DA  NQLTGP+P S  C EK+E+LNL  N LYG VPE +C  
Sbjct  271  LTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNMLYGMVPEVVCVG  330

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L +L   S S NYFT +GP CR L+++ VLD+ N CI DLP QRS   C +FF   + CP
Sbjct  331  LVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCP  390

Query  352  DHKSLLYVPCDI  317
                   +PC +
Sbjct  391  FMWFHGLIPCKL  402



>ref|XP_002284965.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Vitis 
vinifera]
 emb|CAN61024.1| hypothetical protein VITISV_001144 [Vitis vinifera]
 emb|CBI19481.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 93/166 (56%), Gaps = 3/166 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG L+ +TV DA  N LTGPIPQSF C +KL++L+L +NQ YG +P+SLC+L
Sbjct  275  LSGCLPYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQLLSLAHNQFYGRIPDSLCRL  334

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +    + S NYF  IGP C+ L+    LD+   CI  LPNQRSA  C  F+   + CP 
Sbjct  335  PNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFYSVSRTCPR  394

Query  349  HKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  212
              S   + C    +P  +                S  TY AL+  R
Sbjct  395  PGSFNVITC---SNPAASLSSAQVASLQAMAPAPSPVTYKALEPPR  437



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L+ + V DAS N+LTGP+P S GC EK+E LNL+ N LYG VPE LC L
Sbjct  201  LTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEVLCAL  260

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP CR L++  VLD++  CI  LP+QRS   C  FFL  + C  
Sbjct  261  DNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPRFCFY  320

Query  349  HKSLLYVPCD  320
                 ++PC 
Sbjct  321  PSWYNFIPCS  330



>ref|XP_009396708.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 89/141 (63%), Gaps = 8/141 (6%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIG L  +TV DA  NQ+TGPIP SFGC  KLE LNL  N LYG VP+ +C+L
Sbjct  282  LSGCLPYEIGFLSIATVFDAGFNQMTGPIPWSFGCLLKLEQLNLAGNLLYGEVPDVVCRL  341

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                +L  LS SGNYFT +G  C +L++ KVLD+   CI  LP QRS   C  F+   ++
Sbjct  342  AKDGNLANLSLSGNYFTWLGHSCWDLVKTKVLDVRQNCIPGLPEQRSPAECSTFWWGPKQ  401

Query  358  C-PDHKSLLYVPCDIDESPRK  299
            C P H     +PC + + P K
Sbjct  402  CLPSHD----IPCSLPKGPTK  418



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIG L+ +TV DA  NQLTGP+P S  C EK+E+LNL  N LYG VPE +C  
Sbjct  296  LTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNMLYGMVPEVVCVG  355

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L +L   S S NYFT +GP CR L+++ VLD+ N CI DLP QRS   C +FF   + CP
Sbjct  356  LVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCP  415

Query  352  DHKSLLYVPCDI  317
                   +PC +
Sbjct  416  FMWFHGLIPCKL  427



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = -1

Query  706  SGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKLK  527
            +GC+PYE+GLLK + V D   N LTGP+P S GC E +E LN   N LYG VPE +C LK
Sbjct  240  TGCIPYELGLLKKAIVIDVGFNTLTGPLPCSLGCLENVEQLNFAGNLLYGQVPEVICSLK  299

Query  526  DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPDH  347
            +L   + S NYFT++GP CR L+E  VL+++  CI  LPNQR    C  F +  + CP  
Sbjct  300  NLVNFTLSYNYFTKVGPLCRELIENGVLNVEKNCINGLPNQRPILECVLFRMRIKLCPLQ  359

Query  346  KSLLYVPCDIDE-SPRK  299
            KSL  +PC+I + SP +
Sbjct  360  KSLRIIPCNISKFSPHR  376



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLLK + V DA  N LTGP+P S GC EKLE+LN   N LYGSVP+ LC L
Sbjct  266  LSGCLPYELGLLKEAVVFDAGNNNLTGPLPFSLGCLEKLEVLNFAGNLLYGSVPDVLCGL  325

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S NY TQ GP C  L++  VLD+   CI   P QRS   C  FF   + CP 
Sbjct  326  RNLMNLSLSDNYLTQAGPSCMRLIKNGVLDVRKNCIPGQPFQRSVAECAAFFARPRNCPY  385

Query  349  HKSLLYVPC  323
              +   VPC
Sbjct  386  MDTYSQVPC  394



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L+   + DAS N LTGP+P S GC  KLE  NL +N LYG VPE +C L
Sbjct  261  LTGCLPYELGFLRKLVLFDASYNFLTGPLPCSLGCLAKLEQFNLASNLLYGQVPEVVCAL  320

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFT++GP+C  L    VLDI   CI DLP QRSA+ C  F LH + C +
Sbjct  321  GKLVNLSLSSNYFTKLGPKCTKLERSGVLDIRKNCIPDLPGQRSARECAAFSLHRRYCSN  380

Query  349  HKSLLYVPCDI  317
              S  ++PC +
Sbjct  381  PASFNFIPCKV  391



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L+ + V DAS N+LTGP+P S GC EK+E LNL+ N LYG VPE LC L
Sbjct  223  LTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEVLCAL  282

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP CR L++  VLD++  CI  LP+QRS   C  FFL  + C  
Sbjct  283  DNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPRFCFY  342

Query  349  HKSLLYVPCD  320
                 ++PC 
Sbjct  343  PSWYNFIPCS  352



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL  + V DA  N+LTGP+P S GC E +E+LN   NQLYG VPE +C L
Sbjct  266  LSGCLPYELGLLNEAVVFDAGNNRLTGPLPFSLGCLENMEVLNFAGNQLYGMVPEVICSL  325

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S N+F  +GP C +L+++ V+D+   CI  LP+QRS   C  FF   + CP 
Sbjct  326  GNLANLSLSHNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAFFAQPRYCPY  385

Query  349  HKSLLYVPC  323
             ++  Y+PC
Sbjct  386  METYSYIPC  394



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 90/139 (65%), Gaps = 2/139 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            ++GC+PYE+G LK++T+ DA  NQLTGP+P S GC EK+E LN   N LYG VPE +C+L
Sbjct  273  ITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNLLYGKVPEVVCEL  332

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP CR L++  VLD+   CI DL +QRS + C  F  H + C  
Sbjct  333  GNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEECASFSSHPRSCLH  392

Query  349  HKSLLYVPCDIDESPRKAG  293
             +S   +PC +   P+  G
Sbjct  393  PESFSVMPCKV--PPKSKG  409



>gb|KCW68710.1| hypothetical protein EUGRSUZ_F02313 [Eucalyptus grandis]
Length=362

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             SGCLPYEIGLL  + V DA  NQLTGP+P S  C EK+E LNL  N  YG VPE +C L
Sbjct  215  FSGCLPYEIGLLDETVVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEPICWL  274

Query  529  ---KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
               ++L  LS S NYF  +GP CR L+EK +L++ N CI DLP QR    C  FF   + 
Sbjct  275  GLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFAQPRP  334

Query  358  CPDHKSLLYVPC  323
            CP   S  YVPC
Sbjct  335  CPRMWSYSYVPC  346



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 88/138 (64%), Gaps = 2/138 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIG LK + V D   N+LTGP+P S  C EK+E LN   N LYG VPE +C +
Sbjct  264  LTGCLPYEIGFLKEAVVFDVGNNRLTGPLPFSLACLEKVEQLNFAGNLLYGMVPEVVCDE  323

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-C  356
            LK+L   S S NYFT +GP CR L+E+ VLD+   CI DLP QRS + C  FF + ++ C
Sbjct  324  LKNLANFSLSDNYFTYVGPLCRRLIERGVLDVRRNCIPDLPYQRSMEECGAFFSYPRRFC  383

Query  355  PDHKSLLYVPCDIDESPR  302
            P   S  ++PC     PR
Sbjct  384  PYMWSYNHIPCQPPHYPR  401



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPY+IG L  +TV D   N+LTGP+P SFGC  K+E L L  N+ YG++PE LC+L
Sbjct  306  LTGCLPYQIGNLNQATVFDVESNELTGPVPYSFGCLNKMEQLILARNKFYGAIPEILCEL  365

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L+ LS S NYFTQ+GP+CR L+++++LD+   CI  L NQR+   C  FF+  Q CP+
Sbjct  366  SSLKNLSLSSNYFTQVGPKCRTLIKRRILDVGRNCIRGLANQRTWWECARFFMRRQNCPN  425

Query  349  HKSLLYVPCDID  314
             KS   +PC  D
Sbjct  426  SKSFFNIPCGKD  437



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 9/142 (6%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLLK +TV DA  N +TGPIP SFGC +K+E LNL  N LYG VP+ LC+L
Sbjct  292  LSGCLPYEVGLLKKATVFDAGTNYITGPIPLSFGCLKKVEQLNLAQNLLYGEVPDVLCRL  351

Query  529  KD---LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             D   L  LS S NYFT +G  C  L+++ +LD+   CI  LP QRS   C  F    + 
Sbjct  352  ADVGHLANLSLSSNYFTWVGTSCWQLIKRGILDVRKNCIRGLPEQRSPAECAQFLKQPKY  411

Query  358  CPDHKSLLYVPCDIDESPRKAG  293
            CP    L ++PC I   PRK G
Sbjct  412  CP---YLPHIPCRI---PRKDG  427



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 93/143 (65%), Gaps = 9/143 (6%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE GLLK +TV DA  NQ+TGPIP SFGC +K+E LNL  N LYG VP+ +C+L
Sbjct  283  LSGCLPYETGLLKRATVFDAGSNQITGPIPLSFGCLQKVEQLNLAGNLLYGEVPDVVCQL  342

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L  LS S NYFT + P C  L+++KVLD+   CI  LPNQR  + C  +FL+  K
Sbjct  343  AKYGHLANLSLSDNYFTSVAPSCAGLIQQKVLDVRKNCIPGLPNQRPPEACA-WFLNRPK  401

Query  358  --CPDHKSLLYVPCDIDESPRKA  296
              CP+ +   Y+PC +  + R A
Sbjct  402  ITCPNAQ---YIPCHLPWAGRDA  421



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIGLLK + V D   NQLTGP+P S  C E +E LN   N L+G VPE LC +
Sbjct  323  LTGCLPYEIGLLKQAVVLDFGNNQLTGPLPFSLACLENVEQLNFAGNLLHGMVPEVLCHE  382

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L+ L   S S NYFT +GP CR+L+ K VLD+ N C+ DL  QR  + C DFF H + CP
Sbjct  383  LQSLANFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLLFQRPVEECADFFAHPRFCP  442

Query  352  DHKSLLYVPCDI  317
               +  Y+PC +
Sbjct  443  FMWTYTYIPCKL  454



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L+ + V DAS N+LTGP+P S GC EK+E LNL+ N LYG VPE LC L
Sbjct  259  LTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEVLCAL  318

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP CR L++  VLD++  CI  LP+QRS   C  FFL  + C  
Sbjct  319  DNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPRFCFY  378

Query  349  HKSLLYVPCD  320
                 ++PC 
Sbjct  379  PSWYNFIPCS  388



>gb|KEH30896.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=413

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG LKN  + DA  N LTGP+P S GC +K+E LN   N LYG VPE +C L
Sbjct  258  LTGCLPYEIGFLKNLQLFDAGNNLLTGPLPFSLGCLKKVEQLNFARNMLYGQVPEVVCSL  317

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +LE L+ S NYF ++GP CR L++  VLD+   CI DLP+QR  + C  F+   + C  
Sbjct  318  GNLENLTLSYNYFNRVGPLCRKLIKSGVLDVKKNCIFDLPDQRPMEDCVKFYAVPRTCLG  377

Query  349  HKSLLYVPCDIDESPR  302
              S   +PC +   PR
Sbjct  378  SGSFTVIPCQLPMKPR  393



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC-K  533
            L+GCLPYEIG L+ +TV DA  NQLTGP+P S  C EK+E+LN   N LYG VPE +C  
Sbjct  304  LTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNFGGNLLYGMVPEVVCVG  363

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L +L   S S NYFT +GP CR L+++ VLD+ N CI DLP QRS   C +FF   + CP
Sbjct  364  LVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCP  423

Query  352  DHKSLLYVPCDI  317
                   +PC +
Sbjct  424  FMWFHGLIPCKL  435



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGC PYE+GLL  + V DA  N+LTGP+P S GC E +E+LN   NQLYG VPE +C L
Sbjct  268  LSGCFPYELGLLNEAVVFDAGNNRLTGPLPFSLGCLENMEVLNFAGNQLYGMVPEVVCSL  327

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S N+F  +GP C +L+++ V+D+   CI  LP+QRS   C  +F   + CP 
Sbjct  328  RNLANLSLSNNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAYFAQPRYCPY  387

Query  349  HKSLLYVPC  323
             ++  Y+PC
Sbjct  388  METYSYIPC  396



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             SGCLPYEIGLL  + V DA  NQLTGP+P S  C EK+E LNL  N  YG VPE +C L
Sbjct  308  FSGCLPYEIGLLDETVVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEPICWL  367

Query  529  ---KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
               ++L  LS S NYF  +GP CR L+EK +L++ N CI DLP QR    C  FF   + 
Sbjct  368  GLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFAQPRP  427

Query  358  CPDHKSLLYVPC  323
            CP   S  YVPC
Sbjct  428  CPRMWSYSYVPC  439



>ref|XP_003529407.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=449

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP+EIG LK + V D S N LTGPIP SFGC +K++ LNL +N+LYG VP++LC++
Sbjct  288  FEGCLPFEIGYLKKAVVFDISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDNLCQI  347

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              +     LS + NYF +IGP C +L++ KVLD+   CI  LPNQ+S + C  F+   + 
Sbjct  348  PSIRNNGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYKTKKT  407

Query  358  CPDHKSLLYVPC  323
            CP+  S  YVPC
Sbjct  408  CPNPNSFYYVPC  419



>gb|KHN43047.1| Hypothetical protein glysoja_007577 [Glycine soja]
Length=456

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP+EIG LK + V D S N LTGPIP SFGC +K++ LNL +N+LYG VP++LC++
Sbjct  295  FEGCLPFEIGYLKKAVVFDISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDNLCQI  354

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              +     LS + NYF +IGP C +L++ KVLD+   CI  LPNQ+S + C  F+   + 
Sbjct  355  PSIRNNGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYKTKKT  414

Query  358  CPDHKSLLYVPC  323
            CP+  S  YVPC
Sbjct  415  CPNPNSFYYVPC  426



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+EIG L  +TV D   N+LTGPIPQSFGC  +L++LN+ +N+ YG +PE LC+L
Sbjct  280  LSGCLPFEIGYLNRTTVFDVGSNRLTGPIPQSFGCMARLQLLNMAHNKFYGPIPEVLCRL  339

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
                  + S NYFTQ+GP+CR L+  + L+++  CI  LPNQRSA  C  FF   + C  
Sbjct  340  PRAFNFTLSNNYFTQVGPQCRRLIRLRRLNVNRNCIMGLPNQRSAADCGRFFARPRTCAR  399

Query  349  HKSLLYVPCDIDES  308
              +   +PC +  +
Sbjct  400  ESTFSIIPCRLPAA  413



>ref|XP_004238131.2| PREDICTED: probable inactive receptor kinase At5g67200 [Solanum 
lycopersicum]
Length=1206

 Score =   140 bits (353),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG L  + V DA  N+LTGP+P S GC E +E+LN   NQ+YG VP+ +C L
Sbjct  239  LTGCLPYEIGFLNEAVVFDAGNNRLTGPLPFSLGCLENIEMLNFAGNQMYGMVPDVICAL  298

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L  LS S NYFT  GP C  L+E  VLD+ N CI   P QRS   C  FF + + CP 
Sbjct  299  ENLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFFAYPRYCPH  358

Query  349  HKSLLYVPC  323
              S  Y+PC
Sbjct  359  MASYTYIPC  367



>gb|KJB32335.1| hypothetical protein B456_005G236200 [Gossypium raimondii]
Length=413

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G LK   + D   N LTGP+P S  C +K+E+LNL NN  Y  VPE LC L
Sbjct  254  LTGCLPYEVGFLKELKLFDVEDNLLTGPLPCSLSCLDKIELLNLANNLFYWEVPEELCAL  313

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-CP  353
             +LE L+ SGNYFT++GP CR L++  +LD+   C+ DLP+QRS   C +F+L Y + CP
Sbjct  314  VNLENLTLSGNYFTKVGPACRKLIKNGILDMTQNCVPDLPHQRSLLECTEFYLKYIRFCP  373

Query  352  DHKSLLYVPC  323
              ++   +PC
Sbjct  374  YPETYKIIPC  383



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+GLLK +TV D   N LTGP+P S GC E +E LN   N LYG VPE +C L
Sbjct  267  LTGCIPYELGLLKKATVIDVGYNMLTGPLPCSLGCLESVEQLNFAGNLLYGQVPEVVCSL  326

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   + S NYFT++GP CR L++K +L+++  CI  LPNQRS   C  F    + CP 
Sbjct  327  TNLVNFTLSNNYFTKVGPLCRELIKKGILNVEKNCIFGLPNQRSIVECLIFRGQIKLCPL  386

Query  349  HKSLLYVPCDI  317
             K+   +PC I
Sbjct  387  QKTYSVIPCKI  397



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCK-  533
            L+GCLPYE+GLLK + V DAS NQLTGP+P S  C +K+E L+   N L+G VP+ +C+ 
Sbjct  285  LTGCLPYELGLLKEAIVLDASNNQLTGPLPFSLACLDKVEQLSFAGNLLFGLVPDVICEL  344

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L +L   S S NYF  +GP C+ L+++ +LD+ N CI  LP QRS + C  FF H + CP
Sbjct  345  LVNLANFSLSDNYFIHVGPICQRLIQRGLLDVTNNCIPGLPFQRSVEECAGFFAHPRFCP  404

Query  352  DHKSLLYVPC  323
            +  S  Y+PC
Sbjct  405  NMWSYTYIPC  414



>ref|XP_008456159.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=315

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLPYEIG L+N+ + DA  N+LTGPIP SF C  K E+L L +NQLYG VPE +CKL
Sbjct  154  LEGCLPYEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEEICKL  213

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   +   N+FTQ+GPEC+ L++KK+LD+ N CI  LP QRS   C +F    + C +
Sbjct  214  PNLGNFTLRNNFFTQVGPECKKLIKKKILDVSNNCIPGLPKQRSKTECLEFAYRPKYCGN  273

Query  349  HKSLLYVPC  323
             KS  Y+PC
Sbjct  274  DKSFTYIPC  282



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 85/135 (63%), Gaps = 6/135 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL  +TV DA  NQ+TGPIP SFGC  K+E LNL  N LYG VP+ +C+L
Sbjct  289  LSGCLPYEIGLLSIATVFDAGFNQVTGPIPWSFGCLLKVEQLNLAGNLLYGEVPDVVCRL  348

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                +L  LS SGNYFT +G  C +L++ KVLD+ + CI  LP QR    C  F    + 
Sbjct  349  AKDGNLANLSLSGNYFTSLGLSCWDLVKSKVLDVRHNCIVGLPEQRPPSECSKFLWRPKH  408

Query  358  CPDHKSLLYVPCDID  314
            CP      Y+PC + 
Sbjct  409  CPVSH---YIPCSLS  420



>ref|XP_010554992.1| PREDICTED: uncharacterized protein At4g06744 [Tarenaya hassleriana]
Length=392

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 7/137 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYEIG LK + V D   N+LTGP+P S  C EK E LN   N L+G+VPE+ C L
Sbjct  244  LTGCLPYEIGFLKEARVFDVGQNRLTGPLPTSLTCLEKAEQLNFAGNSLFGTVPETACVL  303

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L   S S NYFT++GP CR L+ K VLD+ N CI  LPNQRS + C DF    + C  
Sbjct  304  RNLANFSLSDNYFTRVGPFCRILIRKGVLDVRNNCIPLLPNQRSVKECVDFLAKPKYC--  361

Query  349  HKSLLYVPCDIDESPRK  299
              S ++ P  +   PRK
Sbjct  362  --SHMWFPSSV---PRK  373



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 90/139 (65%), Gaps = 2/139 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            ++GC+PYE+G L+++T+ DA  N LTGP+P S GC +K+E LN   N LYG +PE LC+L
Sbjct  276  ITGCIPYELGFLRDATLFDAGNNLLTGPLPCSLGCLDKMEELNFAGNLLYGKLPEVLCEL  335

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP CR L+E  VLD+   CI  L +QRSA+ C  FF + + CP 
Sbjct  336  GNLVNLSLSNNYFTSVGPMCRKLIENGVLDLRKNCIQHLADQRSAEECALFFGNPRSCPH  395

Query  349  HKSLLYVPCDIDESPRKAG  293
              +   +PC +   P+  G
Sbjct  396  PATFSLLPCKV--PPKSKG  412



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+GLLK + V D   N LTGP+P SFGC E +E LN   N LYG VPE +C L
Sbjct  268  LTGCIPYELGLLKKAIVIDVGYNMLTGPLPCSFGCLESVEQLNFAGNLLYGQVPEVVCSL  327

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   + S NYFT++GP CR L++K +L+++  CI  LPNQRS   C  F    + CP 
Sbjct  328  TNLVNFTLSYNYFTKVGPLCRELIKKGILNVEKNCILGLPNQRSIVECLIFRGQIKLCPL  387

Query  349  HKSLLYVPCDI  317
             K+   +PC I
Sbjct  388  QKTYNVIPCKI  398



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCK-  533
            L+GCLPYEIG L+ + V D   NQLTGP+P S  C EK+E++NL  N  YG VP+ LC+ 
Sbjct  240  LTGCLPYEIGYLEEAIVFDVGNNQLTGPLPLSLSCLEKVEVVNLAGNMFYGMVPDVLCEG  299

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L++L   S   NYFT +GP CR L+E+ +LD+   CI DLP QRS   C DFF   + CP
Sbjct  300  LENLVNFSLYDNYFTHVGPFCRMLIERGILDVGKNCILDLPFQRSVIECADFFSRPKMCP  359

Query  352  DHKSLLYVPCDI  317
                  + PC++
Sbjct  360  FMWFHSFFPCNV  371



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 96/177 (54%), Gaps = 17/177 (10%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLLK +TV DA  N +TGPIP SFGC +K+E LNL  N LYG VP+ +C+L
Sbjct  297  LSGCLPYEVGLLKKATVFDAGTNHITGPIPLSFGCLKKVEQLNLAQNFLYGEVPDVVCRL  356

Query  529  KD---LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             D   L  LS S NYFT +G  C  LLE+ +LD+   CI  LP+QRS   C  F    + 
Sbjct  357  ADVGHLANLSLSSNYFTWLGTSCWRLLERGILDVRKNCIRGLPDQRSPAECFWFLKQPKY  416

Query  358  CPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSS--------TTYAALKVDR  212
            CP      ++PC +   P K G   H          G          TTY AL   R
Sbjct  417  CP---YFPHIPCRL---PWKDGGAVHSAAAMLPAVGGGRDKAPASRYTTYTALHNRR  467



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 88/134 (66%), Gaps = 6/134 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPY++GLLK +TV DA  NQ+TGPIP SFGC  K+E LNL  N LYG VP+ +C+L
Sbjct  230  LSGCLPYQVGLLKKATVFDAGTNQITGPIPLSFGCLLKVEQLNLARNLLYGKVPDVVCRL  289

Query  529  KD---LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             D   L  LS S NYFT +G  C  L+++ +LD+ + CI  LP+QRS + C  F    + 
Sbjct  290  ADYGHLANLSLSSNYFTLLGFSCWELIDRGILDVRHNCIPGLPDQRSPEECAWFLKQPKY  349

Query  358  CPDHKSLLYVPCDI  317
            CP    L Y+PC I
Sbjct  350  CP---VLPYIPCYI  360



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 86/140 (61%), Gaps = 8/140 (6%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL  +TV DA  NQ+TGPIP SFGC +K+E LNL  N LYG+VP+ +C+L
Sbjct  290  LSGCLPYEIGLLSEATVFDAGFNQITGPIPLSFGCLQKVEQLNLAGNLLYGNVPDVVCRL  349

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH--Y  365
                 L  LS SGNYFT IG  C  L++  VLD+   CI   P+QR    C  FF H  +
Sbjct  350  AKTGQLANLSLSGNYFTSIGYSCWELIKSGVLDVRQNCIPGFPDQRRPDECWWFFTHPRH  409

Query  364  QKCPDHKSLLYVPCDIDESP  305
              CP      Y+PC    +P
Sbjct  410  YFCPFFH---YIPCKCPVAP  426



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 89/139 (64%), Gaps = 2/139 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            ++GC+PYE+G L+++T+ DA  N LTGP+P S GC +K+E LN   N LYG  PE +C+L
Sbjct  276  ITGCIPYELGFLRDATLFDAGNNXLTGPLPCSLGCLDKMEELNFAGNLLYGKXPEVVCEL  335

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT +GP CR L++  VLD+   CI  L +QRS + C  FF+  + CPD
Sbjct  336  GNLVNLSLSNNYFTSVGPICRQLIKNGVLDLRKNCIQHLADQRSVEECALFFVKPRSCPD  395

Query  349  HKSLLYVPCDIDESPRKAG  293
              +   +PC +   P+  G
Sbjct  396  PSTFSLLPCKV--PPKSKG  412



>ref|XP_007157715.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
 gb|ESW29709.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
Length=449

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 84/142 (59%), Gaps = 3/142 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP EIG LK + V D S N LTGPIP SFGC + ++ LNL  N+ YG VP+++C++
Sbjct  290  FDGCLPVEIGNLKRAVVFDVSKNLLTGPIPHSFGCLKSIQYLNLAQNKFYGCVPDNVCQI  349

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              L     LS + NYF  +GP C +L++ KVLD+   CI  LPNQRS   C  F+     
Sbjct  350  SSLRNNGNLSLADNYFNDVGPSCWSLIKSKVLDVSKNCIRGLPNQRSPYECSQFYKRKTT  409

Query  358  CPDHKSLLYVPCDIDESPRKAG  293
            CP+  S  YVPC  + S    G
Sbjct  410  CPNPSSFYYVPCRGNPSSETTG  431



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+G LK   V D   N LTGP+P S  C EK+++LN  +N LY  VPE LC L
Sbjct  257  LSGCLPYELGFLKELEVFDVENNLLTGPLPWSLACLEKIKLLNFASNLLYWEVPELLCAL  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-CP  353
             +LE LS S NYFT++GP CR L++  VL++   CI DLP+Q+S   C +F+L Y + CP
Sbjct  317  GNLENLSLSDNYFTKVGPICRKLIKNGVLNVRQNCIHDLPDQKSLHECAEFYLKYIRLCP  376

Query  352  DHKSLLYVPC  323
               +   +PC
Sbjct  377  YPATYKIIPC  386



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 84/134 (63%), Gaps = 6/134 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+EIGLL  +TV DA  NQ+TGPIP SFGC  K+E LNL  N LYG VP+ +C L
Sbjct  293  LSGCLPHEIGLLSKATVFDAGTNQITGPIPLSFGCLMKVEQLNLAQNLLYGEVPDVVCLL  352

Query  529  KD---LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             D   L  LS S NYFT +G  C  L+E+ +LD+   CI  LPNQRS + C  F    + 
Sbjct  353  ADFGKLANLSLSSNYFTSLGKSCWKLIERGILDVRRNCIPWLPNQRSPEECGWFLKQRKY  412

Query  358  CPDHKSLLYVPCDI  317
            CP      Y+PC I
Sbjct  413  CPVSP---YIPCHI  423



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
              GCLP+EIG LK   V D S N LTGPIP SFGC + ++ LNL  N+LYG VP++LC++
Sbjct  292  FEGCLPFEIGYLKKVVVFDVSKNLLTGPIPLSFGCLKSIQFLNLAQNKLYGCVPDNLCQI  351

Query  529  KDLE---ELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
              +     LS + NYF +IGP C +L++ KVLD+   CI  LP+Q+S + C  F+   + 
Sbjct  352  PSIRNNGNLSLADNYFKEIGPSCWSLIKSKVLDVSRNCIPGLPDQKSPKECYQFYKTKKT  411

Query  358  CPDHKSLLYVPC  323
            CP+  S  YVPC
Sbjct  412  CPNQNSFYYVPC  423



>ref|XP_009394537.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 81/134 (60%), Gaps = 6/134 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             SGCLPYEIG L  +TV D   NQ TGPIP SFGC  K+E LNL  N LYG VP+ +C+L
Sbjct  281  FSGCLPYEIGSLTTATVFDVGFNQFTGPIPWSFGCLLKVEQLNLAGNLLYGEVPDVVCRL  340

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                +L  LS SGNYFT +G  C +L+++KVLD+   CI   P QR    C  F  H + 
Sbjct  341  AKDGNLANLSLSGNYFTSLGHSCWDLIKRKVLDVRQNCIPWFPEQRRPVECWRFLWHRKF  400

Query  358  CPDHKSLLYVPCDI  317
            CP      Y+PC +
Sbjct  401  CPFFH---YIPCGL  411



>ref|XP_004953109.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=433

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP E+G+L  +TV DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  272  LSGCLPNELGMLHKATVIDAGMNQLTGPIPASFSCLSSVEQLNLGGNRLYGQVPDALCKL  331

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT +GP C  L++  VLD+ N CI  L NQR    C  F  H +
Sbjct  332  AGPAGRLANLTLSGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRRPVECAVFHSHPK  391

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  392  TCPAASAQVACP  403



>ref|XP_002452450.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
 gb|EES05426.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
Length=433

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  272  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDALCKL  331

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT +GP C  L++  VLD+ N CI  L NQR A  C  F    +
Sbjct  332  AGPAGRLANLTLSGNYFTSVGPACATLIKDGVLDVKNNCIPGLANQRRAAECAAFQSQPK  391

Query  361  KCP  353
             CP
Sbjct  392  TCP  394



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP EIGLL+ +TV DAS N LTG IP SF C   +EIL+L +NQLYG VPE +C+L
Sbjct  276  LSGCLPCEIGLLEKATVFDASRNYLTGRIPLSFTCLGMIEILDLADNQLYGHVPELVCEL  335

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT IGP+C  L+EK VL +   CI  LP+QR+   C+ FF   + CP 
Sbjct  336  PNLVTLSLSYNYFTGIGPKCLELVEKNVLHLRMNCIPGLPDQRTRAQCRAFFSTAKGCPR  395

Query  349  HKSLLYVPCDIDESPRK  299
                 ++PC      R+
Sbjct  396  SN---WIPCSSGGVIRR  409



>ref|XP_003575360.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=423

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 84/137 (61%), Gaps = 1/137 (1%)
 Frame = -1

Query  706  SGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKLK  527
            SGCLP+E+G+L  +TV DA  NQLTGPIPQSF C   +E LNL  N+LYG VP++LCKL 
Sbjct  264  SGCLPHELGMLTKTTVIDAGKNQLTGPIPQSFSCLSSVEQLNLGENRLYGQVPDALCKLG  323

Query  526  DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ-KCPD  350
             L  L+ +GNYF+ +GP C  L++  VLD+   CI  L NQR+   C  F    +  CP 
Sbjct  324  RLANLTLAGNYFSSVGPACSALVKDGVLDVKRNCIPGLANQRAPAECASFMSQPKASCPA  383

Query  349  HKSLLYVPCDIDESPRK  299
              + +  P +     +K
Sbjct  384  ASAPVSCPAEAAADAKK  400



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCK-  533
            L+GCLP+EIG  + + V D   NQLTGP+P S  C EK+E++NL  N  YG VP+ +C  
Sbjct  236  LTGCLPHEIGYFQEAVVFDVGNNQLTGPLPMSLSCLEKVEVVNLAGNMFYGMVPDFVCAG  295

Query  532  LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCP  353
            L++L   S S NYFT +GP CR L+++ VLD+   CI DLP QRS   C DFF   + CP
Sbjct  296  LENLVNFSLSDNYFTHVGPFCRMLIQRGVLDVGKNCIHDLPFQRSLIECADFFTRPKICP  355

Query  352  DHKSLLYVPCDI  317
                  + PC+ 
Sbjct  356  FTWFHGFYPCNF  367



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLPYEIG L+N  + DA  N+LTGP+P SFGC + +E LN  +N LYG VPE +C L
Sbjct  253  LDGCLPYEIGFLENVKLFDAGSNRLTGPLPFSFGCLKNVEQLNFASNMLYGQVPEVVCAL  312

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYF ++GP C+ L+   V+D+ N CI D+P+QR  + C  F+   + C  
Sbjct  313  GNLANLSLSYNYFNRVGPICKKLIRSGVVDVRNNCILDVPDQRPLKECVAFYSVPRTCLR  372

Query  349  HKSLLYVPC  323
             ++   +PC
Sbjct  373  SRTFSIIPC  381



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 84/135 (62%), Gaps = 11/135 (8%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL  +TV DA  NQ+TGPIP SFGC +K+E LNL  N LYG+VP+ +C+L
Sbjct  281  LSGCLPYEIGLLSEATVFDAGFNQITGPIPLSFGCLQKVEQLNLAGNFLYGNVPDVVCRL  340

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFL---H  368
                 L  LS SGNYFT IG  C  L++  VLD+   CI   P QR    C  FF    H
Sbjct  341  AKTGQLANLSLSGNYFTWIGHSCWELVKSGVLDVRQNCIPGFPEQRHPDECWWFFAQPKH  400

Query  367  YQKCPDHKSLLYVPC  323
            Y  CP    L ++PC
Sbjct  401  Y--CP---FLHFIPC  410



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLP+EIG L+N+ + DA  N+LTGPIP SF C  K E+L L +NQLYG VPE +CKL
Sbjct  289  LEGCLPFEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEEICKL  348

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   +   N+FTQ+G EC+ L++KK+LD+ N CI  LP QRS + C  F    + C +
Sbjct  349  PNLGNFTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFAYRPKYCGN  408

Query  349  HKSLLYVPC  323
             KS  Y+PC
Sbjct  409  DKSFTYIPC  417



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLP+EIG L+N+ + DA  N+LTGPIP SF C  K E+L L +NQLYG VPE +CKL
Sbjct  289  LEGCLPFEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEEICKL  348

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L   +   N+FTQ+G EC+ L++KK+LD+ N CI  LP QRS + C  F    + C +
Sbjct  349  PNLGNFTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFAYRPKYCGN  408

Query  349  HKSLLYVPC  323
             KS  Y+PC
Sbjct  409  DKSFTYIPC  417



>ref|XP_003575361.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=436

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 1/138 (1%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  +TV DA  NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  276  LSGCLPHELGMLTKTTVIDAGKNQLTGPIPPSFSCLSSVEQLNLGENRLYGQVPDALCKL  335

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ-KCP  353
              L  L+ +GNYF+ +GP C  L+++ VLD+   CI  L NQR+   C  F    +  CP
Sbjct  336  GRLANLTLAGNYFSSVGPACSALIKEGVLDVKRNCIPGLANQRAPAECTSFMSQPKASCP  395

Query  352  DHKSLLYVPCDIDESPRK  299
               + +  P +     +K
Sbjct  396  AASAPVSCPAEAAADAKK  413



>ref|XP_004976154.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=458

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL+ +TV DA  NQLTG IP SF C  K+E LNL +N LYG VP++LC+L
Sbjct  293  LSGCLPYELGLLEKATVIDAGTNQLTGTIPASFACLRKVEQLNLADNLLYGEVPDALCRL  352

Query  529  K--DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKC  356
                L+ L+ SGNYFT +G  C +L+++  L++D  CI   PNQRS + C  F    + C
Sbjct  353  AFGRLKNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECAKFQRQTKSC  412

Query  355  PDHKSLLYVPC  323
            P +    Y+PC
Sbjct  413  PVNS---YLPC  420



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 89/141 (63%), Gaps = 9/141 (6%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+GLLK +TV DA  NQLTGPIP SFGC EK+E LNL  NQL G VP+ +C+L
Sbjct  291  LSGCLPFEVGLLKKATVFDAGSNQLTGPIPLSFGCLEKVEQLNLAGNQLCGEVPDVVCRL  350

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L  LS S NYFT + P C +L+   VLD+   CI  LP+QRS + C  +FL   K
Sbjct  351  AKYGKLVNLSLSDNYFTSLAPSCISLIHSNVLDVRKNCIPWLPHQRSPEECA-WFLKLPK  409

Query  358  --CPDHKSLLYVPCDIDESPR  302
              CP+     Y+PC +    R
Sbjct  410  VFCPNAH---YIPCHLPWEGR  427



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L  + V DA  NQLTGP+P S GC + +E LN   N LYG VPE +C L
Sbjct  285  LTGCLPYELGSLDEAIVFDAGHNQLTGPLPLSLGCLKSVEQLNFAGNLLYGMVPEMVCAL  344

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            + L  L+ S NYFT +GP CR L+ + VL+I N CI DLP QR    C  F    + CP 
Sbjct  345  RHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFLAFPRICPR  404

Query  349  HKSLLYVPC  323
              S   +PC
Sbjct  405  MWSYTLMPC  413



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G L  + V DA  NQLTGP+P S GC + +E LN   N LYG VPE +C L
Sbjct  285  LTGCLPYELGSLDEAIVFDAGNNQLTGPLPLSLGCLKSVEQLNFAGNLLYGMVPEVVCAL  344

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            + L  L+ S NYFT +GP CR L+ + VL+I N CI DLP QR    C  F    + CP 
Sbjct  345  RHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFLAFPRICPR  404

Query  349  HKSLLYVPC  323
              S   +PC
Sbjct  405  MWSYTLMPC  413



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLPYE+G LK + V D   N+LTG +P S  C EK E LN   N L+G+VPE++C L
Sbjct  268  LTGCLPYELGFLKEARVLDVGQNRLTGRLPMSLTCLEKAEQLNFAGNFLFGAVPETVCML  327

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
            ++L   S S NYFT +GP CR L+E+ VLD+ N CI  LPNQR  + C  F    + C  
Sbjct  328  QNLANFSLSDNYFTHVGPFCRILIERGVLDVRNNCIPFLPNQRPFKECLGFLARPKYCSH  387

Query  349  HKSLLYVPC  323
                 ++PC
Sbjct  388  MWFHSFIPC  396



>gb|AFW62989.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=391

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  230  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKL  289

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT  GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  290  AGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPK  349

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  350  TCPAASTQVTCP  361



>ref|NP_001148637.1| LOC100282253 [Zea mays]
 gb|ACG32331.1| protein binding protein [Zea mays]
Length=445

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  284  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDALCKL  343

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT  GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  344  AGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPK  403

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  404  TCPAASTQVTCP  415



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            ++GC+PYE+G LK++T+ DA  NQLTGP+P S GC EK+E LN   N LYG VPE +C+L
Sbjct  239  ITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCEL  298

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVC  386
             +L  LS S NYFT +GP CR L++  VLD+   CI DL +QRS + C
Sbjct  299  GNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEEC  346



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 83/135 (61%), Gaps = 9/135 (7%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL  +TV DA  N LTG IP S+ C   +E LNL +N LYG V +SLC+L
Sbjct  283  LSGCLPYEIGLLARATVIDAGTNHLTGTIPLSYACLRSVEQLNLADNLLYGVVHDSLCRL  342

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFF---LH  368
                 L  L+ SGNYFT +GP C +L+ +  L++D  CI   PNQRS Q C +FF     
Sbjct  343  AYDGRLANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECAEFFHENWA  402

Query  367  YQKCPDHKSLLYVPC  323
               CP  K   YVPC
Sbjct  403  RMTCPVSK---YVPC  414



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E LN   N L+G+VPE++C L
Sbjct  251  FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCML  310

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-  359
               +L  LS S NYFT +GP CR LLEK VLD+ N CI   P QRS Q C +FF+  +K 
Sbjct  311  LRDNLVNLSLSDNYFTHVGPWCRGLLEKGVLDVGNNCIPFFPGQRSMQECAEFFVKPKKY  370

Query  358  -CPDHKSLLYVPC  323
             CP      +  C
Sbjct  371  YCPHMWFHSFFSC  383



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL+ +TV DA  N+LTG IP SF C  K+E LNL +N LYG VP++LC+L
Sbjct  294  LSGCLPYELGLLEKATVIDAGTNRLTGTIPASFACLRKVEQLNLADNLLYGEVPDALCRL  353

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKC  356
                L+ L+ SGNYFT +G  C +L+++  L++D  CI   PNQRS   C  F    + C
Sbjct  354  AFSHLKNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHDECAKFLRKPKTC  413

Query  355  PDHKSLLYVPC  323
            P +    Y+PC
Sbjct  414  PVNN---YLPC  421



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 83/135 (61%), Gaps = 9/135 (7%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGLL  +TV DA  N LTG IP S+ C   +E LNL +N LYG V +SLC+L
Sbjct  286  LSGCLPYEIGLLARATVIDAGTNHLTGTIPLSYACLRSVEQLNLADNLLYGVVHDSLCRL  345

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFF---LH  368
                 L  L+ SGNYFT +GP C +L+ +  L++D  CI   PNQRS Q C +FF     
Sbjct  346  AYDGRLANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECAEFFHDNWA  405

Query  367  YQKCPDHKSLLYVPC  323
               CP  K   YVPC
Sbjct  406  RMTCPVSK---YVPC  417



>gb|ACF84038.1| unknown [Zea mays]
 gb|AFW62991.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=435

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  274  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKL  333

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT  GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  334  AGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPK  393

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  394  TCPAASTQVTCP  405



>ref|NP_001241706.1| uncharacterized protein LOC100856884 [Zea mays]
 gb|ACF85236.1| unknown [Zea mays]
Length=458

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  297  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKL  356

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT  GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  357  AGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPK  416

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  417  TCPAASTQVTCP  428



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL  +TV DA  N+LTG IP SF C  K+E LNL +N LYG VP++LC+L
Sbjct  388  LSGCLPYELGLLAKATVIDAGTNRLTGTIPASFACLRKVEQLNLADNLLYGEVPDALCRL  447

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKC  356
                L+ L+ S NYFT +G  C +L+++  L++D  CI   PNQRS + C  F    + C
Sbjct  448  AFSHLKNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECARFLRKPKTC  507

Query  355  PDHKSLLYVPC  323
            P +    YVPC
Sbjct  508  PVNN---YVPC  515



>ref|XP_006647518.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=427

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 83/137 (61%), Gaps = 6/137 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+EIG+L  + V DAS+NQL GPIP SF C   +E LNL +N LYG +P++LCKL
Sbjct  265  LSGCLPHEIGMLTKAAVIDASMNQLAGPIPSSFSCLTSVEQLNLGSNSLYGEIPDALCKL  324

Query  529  KD-----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L  L+ S NYFT +GP C  L++  VL++ N CI  L NQR    C  F    
Sbjct  325  AAGPAGRLANLTLSSNYFTSVGPSCLPLIKDGVLNVKNNCIPGLANQRQPAECASFLSQP  384

Query  364  QKCPDHKSLLYVPCDID  314
            + CP   S  +V C ++
Sbjct  385  KTCPP-ASAAHVACPVE  400



>gb|ACF79045.1| unknown [Zea mays]
 gb|ACF86020.1| unknown [Zea mays]
 gb|AFW62992.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=458

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  297  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKL  356

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT  GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  357  AGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPK  416

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  417  TCPAASTQVTCP  428



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 88/137 (64%), Gaps = 12/137 (9%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL  +TV DA  NQLTGPIP SF C  K+E LNL +N LYG VP++LCKL
Sbjct  294  LSGCLPYELGLLAKATVIDAGTNQLTGPIPASFACLHKVEQLNLADNLLYGEVPDALCKL  353

Query  529  K-----DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L+ L+ S NYFT +G  C +L+++  L+++  CI   PNQRS + C  FF H 
Sbjct  354  AFAWTGRLKNLTLSNNYFTSLGSCCWDLIKEGKLNVERNCIPWAPNQRSHEECAAFF-HR  412

Query  364  QK---CPDHKSLLYVPC  323
             K   CP +    YVPC
Sbjct  413  TKTSACPVNS---YVPC  426



>ref|XP_008677766.1| PREDICTED: uncharacterized protein LOC100856884 isoform X1 [Zea 
mays]
Length=467

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  306  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKL  365

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT  GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  366  AGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPK  425

Query  361  KCPDHKSLLYVP  326
             CP   + +  P
Sbjct  426  TCPAASTQVTCP  437



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+GLL ++ V D   N+LTG +P S GC  KLE++N   N LYGSVPE LC +
Sbjct  251  LSGCLPHELGLLTDAVVFDGGGNRLTGLLPVSLGCLRKLEVMNFAGNLLYGSVPEVLCGI  310

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              L  LS S NYFT++GP C  L++  VLD+   C+  LP QRS   C  FF   + C  
Sbjct  311  GSLANLSLSDNYFTRVGPVCLGLIKSGVLDLRKNCVPGLPLQRSWAECGAFFARPRYCVA  370

Query  349  HK  344
            H 
Sbjct  371  HA  372



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 82/134 (61%), Gaps = 6/134 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL  +TV DA  NQLTGPIP SF C  K+E LNL +N LYG VP +LC+L
Sbjct  290  LSGCLPYELGLLAKATVIDAGTNQLTGPIPASFACLRKVEQLNLADNLLYGEVPNALCEL  349

Query  529  K-----DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L  L+ S NYFT +G  C +L+++  L++D  CI   PNQRS   C  FF H 
Sbjct  350  AFSWSGRLRNLTLSNNYFTSLGSCCWDLIKEGKLNVDRNCIPYAPNQRSHDECAAFF-HR  408

Query  364  QKCPDHKSLLYVPC  323
             K        YVPC
Sbjct  409  TKTSACPCNTYVPC  422



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GCLP EIG LK + V D   N+LTGPIP S GC EK+E LN      YG VPE LC+L
Sbjct  305  LTGCLPLEIGFLKEARVFDVGNNRLTGPIPFSLGCLEKVEELNFAGKLFYGMVPEVLCQL  364

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS   NYF Q+G  CR+L+ K +LDI   CI DLP QRS   C D F + + CP 
Sbjct  365  PNLLNLSLYDNYFMQVGLACRSLIWKGLLDIRKNCIPDLPFQRSVAECADLFQYPRFCPY  424

Query  349  HKS  341
              S
Sbjct  425  MNS  427



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+GLL+ +TV DA  N+LTG IP SF C  K+E LNL  N LYG VP++LC+L
Sbjct  287  LSGCLPHELGLLEKATVIDAGANRLTGTIPASFACLRKVEQLNLAGNLLYGEVPDALCRL  346

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKC  356
               +L+ L+ S NYFT +G  C +L+++  L++D  CI   PNQRS + C  F    + C
Sbjct  347  AFSNLKNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEDCAKFLRQPKSC  406

Query  355  PDHKSLLYVPC  323
            P +    YVPC
Sbjct  407  PVNN---YVPC  414



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+PYEIG L  ++V D   N+LTGP+P S  C EK+E LN   N L+G++PE++C +
Sbjct  254  FTGCIPYEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMV  313

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-  359
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q C +FF+  +K 
Sbjct  314  LRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKY  373

Query  358  -CPDHKSLLYVPC  323
             CP      +  C
Sbjct  374  YCPHMWYHSFFSC  386



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+PYEIG L  ++V D   N+LTGP+P S  C EK+E LN   N L+G++PE++C +
Sbjct  254  FTGCIPYEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMV  313

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-  359
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q C +FF+  +K 
Sbjct  314  LRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKY  373

Query  358  -CPDHKSLLYVPC  323
             CP      +  C
Sbjct  374  YCPHMWYHSFFSC  386



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+PYEIG L  ++V D   N+LTGP+P S  C EK+E LN   N L+G++PE++C +
Sbjct  254  FTGCIPYEIGFLMGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMV  313

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-  359
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q C +FF+  +K 
Sbjct  314  LRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKY  373

Query  358  -CPDHKSLLYVPC  323
             CP      +  C
Sbjct  374  YCPHMWYHSFFSC  386



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+PYEIG L+ ++V D   N+LTG +P S  C EK+E LN   N L+G +PES+C L
Sbjct  252  FTGCVPYEIGFLRGASVIDIGGNKLTGHLPLSLTCLEKVEQLNFAGNLLFGVIPESVCML  311

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKC  356
               +L   S S NYFT +GP CR+L E  VLD+ N C+  LP QRS + C +FF   + C
Sbjct  312  LRVNLVNFSLSDNYFTHMGPWCRSLFEIGVLDVRNNCLPFLPGQRSMKECAEFFFKPKYC  371

Query  355  PDHKSLLYVPC  323
            P      ++PC
Sbjct  372  PYRWFHSFIPC  382



>ref|XP_004953107.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=404

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  ++V +  +NQLTGPIP SF C   +E LNL  N+LYG VP++LCKL
Sbjct  243  LSGCLPHELGMLHKASVINVGMNQLTGPIPSSFSCLSSVEQLNLGGNRLYGQVPDALCKL  302

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+  GNYFT +GP C  L++  VLD+ N CI  L NQR    C  F    +
Sbjct  303  AGPAGRLANLTLPGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRHPAECAAFHSQPK  362

Query  361  KCP  353
             CP
Sbjct  363  TCP  365



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+PYEIGLLK ++V D S N+LTGP+P S  C EK+E LN   N L+G++P+++C  
Sbjct  239  FTGCIPYEIGLLKGASVIDISGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPDAVCMF  298

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH-YQK  359
              ++L   S S NYFT +GP C+ L+E+ VLD+ N CI   P QRS + C +FF+     
Sbjct  299  LRENLVNFSLSDNYFTHVGPWCKILVERGVLDVRNNCIPFFPGQRSIEECAEFFVKPNYY  358

Query  358  CPDHKSLLYVPC  323
            CP      ++PC
Sbjct  359  CPHAWFHSFLPC  370



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE++C L
Sbjct  256  FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCML  315

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-  359
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q C +FF+  +K 
Sbjct  316  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKY  375

Query  358  -CPDHKSLLYVPC  323
             CP      +  C
Sbjct  376  YCPHMWFHSFFSC  388



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC--  536
            LSGCLPYEIGL++  TV DA  N +TGPIP SFGC  K+E LNL  NQLYG +P+ LC  
Sbjct  295  LSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGKVEELNLAGNQLYGHIPDVLCIL  354

Query  535  -KLKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             K   L+ LS S NYF  +G  C  L   +VLD+   CI + PNQR A  C  F   Y  
Sbjct  355  AKTGKLQNLSLSDNYFHSVGHHCLELARSRVLDVRLNCILNFPNQRPALECARF---YAD  411

Query  358  CPDHKSLL-YVPCDI  317
             P H   + ++PCD+
Sbjct  412  PPQHCPFVPHIPCDL  426



>gb|EAY86685.1| hypothetical protein OsI_08067 [Oryza sativa Indica Group]
Length=428

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG +P++LCKL
Sbjct  266  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKL  325

Query  529  KD-----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L  L+ S NYFT +GP C +L++  VL++ N CI    NQR    C  F    
Sbjct  326  ATGPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFANQRRPAECASFHSQP  385

Query  364  QKCP  353
            + CP
Sbjct  386  KTCP  389



>gb|EAY86686.1| hypothetical protein OsI_08068 [Oryza sativa Indica Group]
Length=426

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG +P++LCKL
Sbjct  264  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKL  323

Query  529  K-----DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L  L+ S NYFT +GP C +L++  VL++ N CI    NQR    C  F    
Sbjct  324  AVGPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFTNQRRPAECASFHSQP  383

Query  364  QKCP  353
            + CP
Sbjct  384  KTCP  387



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 83/135 (61%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGL++  TV DA  N +TGPIP SFGC   +E LNL  NQLYG++P+ LC L
Sbjct  299  LSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNLAGNQLYGNIPDVLCML  358

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L+ LS S NYF  +G  C  L+  KVLD+   CI + PNQR A  C  F   Y  
Sbjct  359  AKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YAD  415

Query  358  CPDHKSLL-YVPCDI  317
             P H   + ++PCD+
Sbjct  416  PPQHCPFVPHIPCDL  430



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 83/135 (61%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGL++  TV DA  N +TGPIP SFGC   +E LNL  NQLYG++P+ LC L
Sbjct  299  LSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNLAGNQLYGNIPDVLCML  358

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L+ LS S NYF  +G  C  L+  KVLD+   CI + PNQR A  C  F   Y  
Sbjct  359  AKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YAD  415

Query  358  CPDHKSLL-YVPCDI  317
             P H   + ++PCD+
Sbjct  416  PPQHCPFVPHIPCDL  430



>dbj|BAD21636.1| leucine-rich repeat-like protein [Oryza sativa Japonica Group]
 dbj|BAG96332.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96587.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96789.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96849.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97586.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG +P++LCKL
Sbjct  276  LSGCLPHELGMLTKAAVFDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKL  335

Query  529  K-----DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L  L+ S NYFT +GP C +L++  VL++ N CI    NQR    C  F    
Sbjct  336  AAVPAGRLANLTLSSNYFTSVGPACLSLIKDGVLNVRNNCIPGFANQRRPAECASFHSQP  395

Query  364  QKCP  353
            + CP
Sbjct  396  KACP  399



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 79/138 (57%), Gaps = 4/138 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GC+PYEIG L+ +TV DA  N LTG +P S GC + +E LN   N LY ++PE +C +
Sbjct  221  LMGCIPYEIGFLRKATVFDAGDNYLTGQLPCSLGCLDMIEQLNFAGNFLYDAIPEVVCSM  280

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH----YQ  362
              L  LS S NYF  IGP C  L+++ VLD+   CI  LPNQR    C  F+ H      
Sbjct  281  PKLSNLSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFYFHSFWFRW  340

Query  361  KCPDHKSLLYVPCDIDES  308
             CP    +  +PC I+ S
Sbjct  341  VCPWQYLMSAIPCKINSS  358



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 79/138 (57%), Gaps = 4/138 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GC+PYEIG L+ +TV DA  N LTG +P S GC + +E LN   N LY ++PE +C +
Sbjct  257  LMGCIPYEIGFLRKATVFDAGDNYLTGQLPCSLGCLDMIEQLNFAGNFLYDAIPEVVCSM  316

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH----YQ  362
              L  LS S NYF  IGP C  L+++ VLD+   CI  LPNQR    C  F+ H      
Sbjct  317  PKLSNLSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFYFHSFWFRW  376

Query  361  KCPDHKSLLYVPCDIDES  308
             CP    +  +PC I+ S
Sbjct  377  VCPWQYLMSAIPCKINSS  394



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 86/141 (61%), Gaps = 6/141 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+PYEIG LK ++V D S N+LTG +P S  C EK+E LN   N L+G++PE++C L
Sbjct  239  FTGCIPYEIGFLKGASVIDISGNKLTGLLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCML  298

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ-K  359
               ++  LS S NYFT +GP C+ L E+ VLD+ N CI   P QRS   C +FF+  +  
Sbjct  299  LWDNIVNLSLSDNYFTHVGPWCKGLFERGVLDVTNNCIPFFPGQRSIDECAEFFVKPKYY  358

Query  358  CPDHKSLLYVPC---DIDESP  305
            CP      ++PC    I  SP
Sbjct  359  CPHPWFHRFLPCRYSHISSSP  379



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 87/157 (55%), Gaps = 0/157 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+G LK + V DA  N LTGP+P S  C EK+E LN   N LYG VPE +C L
Sbjct  270  LTGCIPYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEKIEQLNFAGNFLYGQVPEVVCDL  329

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NYFT+IGP CR L+   VLD+   CI  LP+QRS   C   +L    CP 
Sbjct  330  GNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSYLFQYPCPF  389

Query  349  HKSLLYVPCDIDESPRKAGphphphrpykkhkRGSST  239
              +  +VPC   +S    G              G+ST
Sbjct  390  PATYGFVPCQKSKSIHSFGTGQQKRSYVPIANGGNST  426



>ref|NP_001150111.1| protein binding protein precursor [Zea mays]
 gb|ACG37876.1| protein binding protein [Zea mays]
Length=424

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLP+E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VPE+LC L
Sbjct  263  LSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLAGNRLYGQVPEALCML  322

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDF  377
                  L  L+ S NYFT + P C  L++  VLD+ N CI  L NQR    C  F
Sbjct  323  AGPAGRLTNLTLSSNYFTSVAPACAALIKDGVLDVKNNCIPGLANQRRPAECAAF  377



>gb|EEC73254.1| hypothetical protein OsI_07372 [Oryza sativa Indica Group]
Length=324

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = -1

Query  703  GCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKLKD  524
            GCLP+E+G+L  +TV DA  NQLTGPIP SF C   +E LNL  N+LYG +P+ LCKL  
Sbjct  169  GCLPHELGMLTKATVIDAGKNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDVLCKLAA  228

Query  523  -----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L  L+ S NYFT +GP C +L++  VL++ N CI  L NQR    C  F    + 
Sbjct  229  GPAGRLANLTLSSNYFTSVGPSCLSLIKDGVLNVKNNCIPGLANQRRPAECASFHSQPKI  288

Query  358  CP  353
            CP
Sbjct  289  CP  290



>gb|AFW72330.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=245

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 78/128 (61%), Gaps = 5/128 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCL  E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LC+L
Sbjct  83   LSGCLAPELGMLAKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDALCRL  142

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT +GP C  L++  VL++ + CI  L NQR  + C  F     
Sbjct  143  AGPTGRLANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFIQSRP  202

Query  361  K-CPDHKS  341
            K CP   +
Sbjct  203  KTCPAAAT  210



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 81/135 (60%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGL++  TV DA  N +TGPIP S GC   +E LNL  NQLYG +P+ LC L
Sbjct  297  LSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDVLCML  356

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L+ LS S NYF  +G  C  L+  KVLD+   CI + PNQR A  C  F   Y  
Sbjct  357  AKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YAD  413

Query  358  CPDHKSLL-YVPCDI  317
             P H   + ++PCD+
Sbjct  414  PPQHCPFVPHIPCDL  428



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 81/135 (60%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGL++  TV DA  N +TGPIP S GC   +E LNL  NQLYG +P+ LC L
Sbjct  312  LSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDVLCML  371

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L+ LS S NYF  +G  C  L+  KVLD+   CI + PNQR A  C  F   Y  
Sbjct  372  AKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YAD  428

Query  358  CPDHKSLL-YVPCDI  317
             P H   + ++PCD+
Sbjct  429  PPQHCPFVPHIPCDL  443



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 85/139 (61%), Gaps = 6/139 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFG-----CXEKLEILNLTNNQLYGSVPE  545
             +G +P  +G    S +  A+ N+ TGPIP+S G       E++  LNL+ N LYG VPE
Sbjct  303  FNGAIPENLGKTPVSYLTLAN-NKFTGPIPRSIGQTSKSLLEQMNQLNLSCNHLYGPVPE  361

Query  544  SLCKLKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
            ++C L  L  L+ + NYFTQ+GPECR L+ KK LD+   CI  LP+QRS   C  FF   
Sbjct  362  TVCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFFSKK  421

Query  364  QKCPDHKSLLYVPCDIDES  308
             KCP+ KS+ YVPC I +S
Sbjct  422  VKCPNEKSMRYVPCKISQS  440



>gb|EMT04546.1| hypothetical protein F775_44003 [Aegilops tauschii]
Length=384

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 83/137 (61%), Gaps = 12/137 (9%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL  +TV DA  NQLTG IP S+ C  K+E LNL +N LYG VP++LC+L
Sbjct  223  LSGCLPYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLADNLLYGEVPDALCRL  282

Query  529  K------DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH  368
                    L  L+ S NYFT +G  C  L+++  L++   CI   PNQRS + C  FF H
Sbjct  283  AYPSSGGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHEECAGFF-H  341

Query  367  YQK--CPDHKSLLYVPC  323
              K  CP      YVPC
Sbjct  342  RTKTYCPVST---YVPC  355



>gb|EMS61305.1| hypothetical protein TRIUR3_11917 [Triticum urartu]
Length=414

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 83/137 (61%), Gaps = 12/137 (9%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GLL  +TV DA  NQLTG IP S+ C  K+E LNL +N LYG VP++LC+L
Sbjct  253  LSGCLPYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLADNLLYGEVPDALCRL  312

Query  529  K------DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH  368
                    L  L+ S NYFT +G  C  L+++  L++   CI   PNQRS + C  FF H
Sbjct  313  AYKSSGGHLANLTLSDNYFTSLGACCWALIKQGKLNVARNCIPYAPNQRSHEECAGFF-H  371

Query  367  YQK--CPDHKSLLYVPC  323
              K  CP      YVPC
Sbjct  372  GTKTYCPVST---YVPC  385



>gb|ABS78922.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78923.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G+VPE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_006648837.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=437

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCK-  533
            LSGCLPYE+G+L  + V DA +NQLTGPIP SF C   +E LNL +N+LYG +P +LC  
Sbjct  275  LSGCLPYEVGMLTKANVIDAGMNQLTGPIPSSFSCLTSVEQLNLGSNRLYGEIPAALCNP  334

Query  532  ----LKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHY  365
                   L  L+ S NY T +GP C  L++  V+++ N CI    NQR +  C  F    
Sbjct  335  AAGPASRLANLTLSSNYLTSVGPSCLPLIKDGVVNVKNNCIPGFANQRRSAECASFLSQP  394

Query  364  QKCPDHKS  341
            + CP+  +
Sbjct  395  KTCPEASA  402



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 79/135 (59%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             SGCLPYEIGL++  TV DA  N++ GPIP SFGC   +E LNL  NQLYG VP+ LC L
Sbjct  283  FSGCLPYEIGLVEGLTVFDAGGNEIKGPIPLSFGCLSDVEQLNLAGNQLYGHVPDVLCAL  342

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L  LS S NYF  +G  C  L+  +VLD+   CI   P QR A  C  F+    K
Sbjct  343  AKTGKLGNLSLSDNYFHSVGRLCMELVRSRVLDVKKNCILGFPRQRPAMECAAFYADPSK  402

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PCD+
Sbjct  403  HCP---FIPHIPCDL  414



>gb|ABS78920.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78921.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78924.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G+VPE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 79/135 (59%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC--  536
            LSGCLPYEIGL++  TV DA  NQ+ GPIP SFGC   +E LNL  NQLYG VP+ LC  
Sbjct  273  LSGCLPYEIGLVEGLTVFDAGGNQIRGPIPLSFGCLADVEELNLARNQLYGHVPDVLCLL  332

Query  535  -KLKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             K   L  LS S NYF  +G  C  L+  +VLD+   CI   P QR    C  F+    K
Sbjct  333  AKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECVMFYADPTK  392

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PCD+
Sbjct  393  HCP---FIPHIPCDL  404



>gb|ABS78915.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78917.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78919.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78911.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78912.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78914.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78910.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78918.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78905.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78908.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78909.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G+VPE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78900.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78903.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78904.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPETVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78901.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78913.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78916.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78925.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78926.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78927.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78928.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78929.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78930.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78931.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L+GC+PYE+G LK + V DA  N LTGP+P S GC EK+E LN   N LYG VPE +C+L
Sbjct  265  LTGCIPYEVGFLKTAIVFDAGENLLTGPLPCSLGCLEKIEQLNFAGNFLYGQVPEVVCEL  324

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
             +L  LS S NY T+IGP CR L+   VLD+   CI  LP+QRS   C    L    CP 
Sbjct  325  GNLLNLSLSDNYLTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSSLFRYPCPF  384

Query  349  HKSLLYVPC  323
              +  +VPC
Sbjct  385  PATYGFVPC  393



>ref|NP_001141180.1| uncharacterized protein LOC100273267 precursor [Zea mays]
 gb|ACF85643.1| unknown [Zea mays]
Length=437

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCL  E+G+L  + V DA +NQLTGPIP SF C   +E LNL  N+LYG VP++LC+L
Sbjct  275  LSGCLAPELGMLAKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDALCRL  334

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT +GP C  L++  VL++ + CI  L NQR  + C  F     
Sbjct  335  AGPTGRLANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFIQSRP  394

Query  361  K-CP  353
            K CP
Sbjct  395  KTCP  398



>gb|ABS78902.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G++PE +C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEXVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_006289202.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
 gb|EOA22100.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
Length=407

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P EIG L  ++V D   N+LTGP+P S  C +K+E LN   N L+G +PE +C L
Sbjct  254  FTGCIPNEIGFLTGASVIDIGGNKLTGPLPLSLMCLDKVEQLNFAGNLLFGGIPEPVCML  313

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK-  359
               +L  LS S NYFT +GP CR LL++ VLD+ N CI  L  QRS Q C +FF+  +K 
Sbjct  314  LRDNLLNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFLQGQRSMQECAEFFVRPKKY  373

Query  358  -CPDHKSLLYVPC  323
             CP      +  C
Sbjct  374  YCPHMWFHSFFSC  386



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = -1

Query  709   LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             L+GC+PYE+G LK + V DA  N LTGP+P S  C EK+E LN   N LYG VPE +C L
Sbjct  913   LTGCIPYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEKIEQLNFAGNFLYGQVPEVVCDL  972

Query  529   KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQKCPD  350
              +L  LS S NYFT+IGP CR L+   VLD+   CI  LP+QRS   C   +L    CP 
Sbjct  973   GNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSYLFQYPCPF  1032

Query  349   HKSLLYVPCDIDESPRKAG  293
               +  +VPC   +S    G
Sbjct  1033  PATYGFVPCQKSKSIHSFG  1051



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 81/137 (59%), Gaps = 12/137 (9%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLPYE+GLL  +TV DA  NQLTG IP S+ C  K+E LNL  N LYG VP++LC+L
Sbjct  294  LCGCLPYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLAGNLLYGEVPDALCRL  353

Query  529  K------DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLH  368
                    L  L+ S NYFT +G  C  L+++  L++   CI   PNQRS + C  FF H
Sbjct  354  AYPSSGGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHEECAGFF-H  412

Query  367  YQK--CPDHKSLLYVPC  323
              K  CP      YVPC
Sbjct  413  RTKTTCPVST---YVPC  426



>gb|ABS78906.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78907.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC+P+EIG L  ++V D   N+LTGP+P S  C EK+E +N   N L+G+ PE++C L
Sbjct  67   FTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAXPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL++ VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 79/135 (59%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC--  536
            LSGCLPYEIGL++  TV DA  N++ GPIP SFGC   +E LNL  NQLYG VP+ LC  
Sbjct  352  LSGCLPYEIGLVEGLTVFDAGGNEIRGPIPLSFGCLADVEELNLAGNQLYGHVPDVLCLL  411

Query  535  -KLKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             K   L  LS S NYF  +G  C  L+  +VLD+   CI   P QR    C  F+    K
Sbjct  412  AKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECAMFYADPTK  471

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PCD+
Sbjct  472  HCP---FIPHIPCDL  483



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC--  536
            LSGCLPYEIGL++   V DA  N++ GPIP SFGC   +E +NL  NQLYG VP+ +C  
Sbjct  359  LSGCLPYEIGLVEGLAVFDAGGNEIAGPIPLSFGCLRDVEEINLAGNQLYGQVPDVVCLL  418

Query  535  -KLKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             K   L+ LS S N+F  +G  C  L+  +VLD+   CI   P+QR A  C  F+    K
Sbjct  419  AKTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPALECAAFYADPTK  478

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PCD+
Sbjct  479  HCP---FIPHIPCDL  490



>ref|XP_010227187.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1492

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 9/137 (7%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGC+PYE+GLL  +TV DA  N LTG IP S+ C   +E LNL +N LYG VP++LC+L
Sbjct  287  LSGCIPYELGLLGKATVIDAGTNMLTGTIPASYACLRSVEQLNLADNLLYGVVPDALCQL  346

Query  529  KD----LEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQ  362
                  L  L+ SGNYFT +G  C +L+ +  L++D  CI   PNQRS + C  FF  ++
Sbjct  347  ASSGGRLVNLTLSGNYFTWLGACCWDLINEGKLNVDRNCIPWAPNQRSHEECARFF--FR  404

Query  361  KCPDHKS---LLYVPCD  320
            K   H +    ++ PC+
Sbjct  405  KIESHATCPISVHAPCE  421



>ref|XP_002447298.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
 gb|EES11626.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
Length=449

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 81/135 (60%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYE+GL++   V DA  N++TGPIP SFGC   +E LNL +NQLYG VP+ LC L
Sbjct  288  LSGCLPYEVGLVEGLAVFDAGGNEITGPIPLSFGCLRDVEELNLASNQLYGQVPDVLCLL  347

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L  LS S N+F  +G  C  L+  +VLD+   CI   P+QR    C  F+    K
Sbjct  348  ARNGKLGNLSLSENFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYADPTK  407

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PCD+
Sbjct  408  HCP---FIPHIPCDL  419



>gb|ACG42798.1| leucine-rich repeat, plant specific [Zea mays]
Length=431

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 82/135 (61%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGL++   V DA  N++TGP+P SFGC   +E LNL  NQLYG VP+ +C L
Sbjct  283  LSGCLPYEIGLVEGLAVFDAGGNEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDVVCLL  342

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L+ LS S N+F  +G  C  L+  +VLD+   CI   P+QR    C  F++   K
Sbjct  343  ARTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYVDPSK  402

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PC++
Sbjct  403  HCP---FIPHIPCEL  414



>ref|NP_001141186.1| leucine-rich repeat (LRR) family protein precursor [Zea mays]
 gb|ACF85658.1| unknown [Zea mays]
 gb|AFW59826.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=431

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 82/135 (61%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            LSGCLPYEIGL++   V DA  N++TGP+P SFGC   +E LNL  NQLYG VP+ +C L
Sbjct  283  LSGCLPYEIGLVEGLAVFDAGGNEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDVVCLL  342

Query  529  K---DLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
                 L+ LS S N+F  +G  C  L+  +VLD+   CI   P+QR    C  F++   K
Sbjct  343  ARTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYVDPSK  402

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PC++
Sbjct  403  HCP---FIPHIPCEL  414



>gb|ABS78899.1| At4g06744-like protein, partial [Arabidopsis halleri subsp. halleri]
Length=174

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
             +GC P+E G L  ++V D   N+LTGP+P S  C EK+E LN   N L+G+VPE++C L
Sbjct  67   FTGCXPHEXGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCML  126

Query  529  --KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQ  392
               +L  LS S NYFT +GP CR LL+  VLD+ N CI   P QRS Q
Sbjct  127  LRDNLVNLSLSNNYFTHVGPWCRGLLDXGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_002282474.2| PREDICTED: uncharacterized protein At4g06744 [Vitis vinifera]
 emb|CBI32376.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLCKL  530
            L GCLP EIG LK  TV D   N LTG +P S GC    E LN   N  YG VPE LC L
Sbjct  287  LFGCLPIEIGSLKELTVFDVGHNLLTGLLPCSLGCLHNAEQLNFAGNFFYGRVPEELCAL  346

Query  529  KDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFL  371
            K+L+ L+ S NYFT+IGP CR+L+    +D+ N CI +LP+QR    C  FFL
Sbjct  347  KNLQNLTLSDNYFTKIGPNCRDLIPTGKIDLRNNCIRNLPDQRPRSDCLAFFL  399



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = -1

Query  709  LSGCLPYEIGLLKNSTVXDASINQLTGPIPQSFGCXEKLEILNLTNNQLYGSVPESLC--  536
            LSGCLPYEIGL++  TV DA  NQ+ GPIP S GC   ++ LNL  NQLYG VP+ LC  
Sbjct  369  LSGCLPYEIGLVEGLTVFDAGGNQIRGPIPLSLGCLADVQELNLARNQLYGHVPDVLCLL  428

Query  535  -KLKDLEELSXSGNYFTQIGPECRNLLEKKVLDIDNXCIXDLPNQRSAQVCKDFFLHYQK  359
             K   L  LS S NYF  +G  C  L+  +VLD+   CI   P QR    C  F+    K
Sbjct  429  AKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECAMFYADPTK  488

Query  358  -CPDHKSLLYVPCDI  317
             CP    + ++PCD+
Sbjct  489  HCP---FIPHIPCDL  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365