BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036N18

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57286.1|  V-type proton ATPase subunit                           267   2e-84   Ipomoea nil [qian niu]
ref|XP_009786911.1|  PREDICTED: V-type proton ATPase subunit C          244   1e-75   Nicotiana sylvestris
ref|XP_009618992.1|  PREDICTED: V-type proton ATPase subunit C          243   4e-75   Nicotiana tomentosiformis
ref|XP_006363973.1|  PREDICTED: V-type proton ATPase subunit C-like     243   6e-75   Solanum tuberosum [potatoes]
ref|XP_004235295.1|  PREDICTED: V-type proton ATPase subunit C          239   1e-73   Solanum lycopersicum
emb|CDP15722.1|  unnamed protein product                                235   5e-72   Coffea canephora [robusta coffee]
ref|XP_011073132.1|  PREDICTED: V-type proton ATPase subunit C-like     235   8e-72   Sesamum indicum [beniseed]
ref|XP_011083360.1|  PREDICTED: V-type proton ATPase subunit C-like     230   5e-70   Sesamum indicum [beniseed]
gb|EYU24479.1|  hypothetical protein MIMGU_mgv1a006812mg                229   5e-69   Erythranthe guttata [common monkey flower]
gb|KJB40644.1|  hypothetical protein B456_007G072500                    222   4e-68   Gossypium raimondii
ref|XP_002284444.1|  PREDICTED: V-type proton ATPase subunit C is...    222   8e-67   Vitis vinifera
gb|KJB40648.1|  hypothetical protein B456_007G072500                    222   8e-67   Gossypium raimondii
ref|XP_010249179.1|  PREDICTED: V-type proton ATPase subunit C-like     222   9e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007031994.1|  Vacuolar ATP synthase subunit C (VATC) / V-A...    221   1e-66   Theobroma cacao [chocolate]
gb|KJB76316.1|  hypothetical protein B456_012G082900                    219   5e-66   Gossypium raimondii
gb|KJB76315.1|  hypothetical protein B456_012G082900                    219   8e-66   Gossypium raimondii
ref|XP_007151733.1|  hypothetical protein PHAVU_004G070900g             218   3e-65   Phaseolus vulgaris [French bean]
ref|XP_008231040.1|  PREDICTED: V-type proton ATPase subunit C          217   5e-65   Prunus mume [ume]
ref|XP_002275510.1|  PREDICTED: V-type proton ATPase subunit C          216   2e-64   Vitis vinifera
gb|KDP41839.1|  hypothetical protein JCGZ_26857                         216   2e-64   Jatropha curcas
ref|XP_006599411.1|  PREDICTED: V-type proton ATPase subunit C-like     215   3e-64   Glycine max [soybeans]
ref|XP_007215551.1|  hypothetical protein PRUPE_ppa007256mg             214   9e-64   Prunus persica
ref|XP_008362171.1|  PREDICTED: V-type proton ATPase subunit C-like     210   1e-63   
gb|ABH07428.1|  vacuolar H+-ATPase subunit C                            213   1e-63   Gossypium hirsutum [American cotton]
gb|KHM99227.1|  V-type proton ATPase subunit C                          213   2e-63   Glycine soja [wild soybean]
ref|XP_003548919.2|  PREDICTED: V-type proton ATPase subunit C-like     213   2e-63   Glycine max [soybeans]
gb|AIY85415.1|  V-ATPase subunit C1                                     213   3e-63   Eriobotrya japonica [loquat]
ref|XP_010925033.1|  PREDICTED: V-type proton ATPase subunit C-like     212   6e-63   Elaeis guineensis
ref|XP_011468207.1|  PREDICTED: V-type proton ATPase subunit C          212   7e-63   Fragaria vesca subsp. vesca
ref|XP_006446960.1|  hypothetical protein CICLE_v10015638mg             211   9e-63   Citrus clementina [clementine]
ref|XP_009378027.1|  PREDICTED: V-type proton ATPase subunit C          211   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_003553974.1|  PREDICTED: V-type proton ATPase subunit C-like     211   1e-62   Glycine max [soybeans]
ref|XP_011045799.1|  PREDICTED: V-type proton ATPase subunit C-li...    211   1e-62   Populus euphratica
ref|XP_011045798.1|  PREDICTED: V-type proton ATPase subunit C-li...    211   2e-62   Populus euphratica
dbj|BAE98945.1|  vacuolar ATP sythase subunit C                         207   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379060.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    210   2e-62   
ref|XP_004977299.1|  PREDICTED: V-type proton ATPase subunit C-like     210   3e-62   Setaria italica
ref|XP_010066422.1|  PREDICTED: V-type proton ATPase subunit C          210   3e-62   Eucalyptus grandis [rose gum]
ref|XP_003624472.1|  V-type proton ATPase subunit C                     209   5e-62   Medicago truncatula
ref|NP_001141160.1|  hypothetical protein                               204   7e-62   
ref|XP_009386009.1|  PREDICTED: V-type proton ATPase subunit C-like     209   9e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW81322.1|  hypothetical protein ZEAMMB73_736936                    205   1e-61   
ref|XP_006417188.1|  hypothetical protein EUTSA_v10007948mg             208   1e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010476263.1|  PREDICTED: V-type proton ATPase subunit C-like     208   2e-61   Camelina sativa [gold-of-pleasure]
emb|CDY19421.1|  BnaC05g09300D                                          208   2e-61   Brassica napus [oilseed rape]
ref|XP_010494723.1|  PREDICTED: V-type proton ATPase subunit C          208   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010250562.1|  PREDICTED: V-type proton ATPase subunit C          207   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010939209.1|  PREDICTED: V-type proton ATPase subunit C-li...    207   4e-61   Elaeis guineensis
ref|XP_009395792.1|  PREDICTED: V-type proton ATPase subunit C-like     207   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010458722.1|  PREDICTED: V-type proton ATPase subunit C-like     207   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009148561.1|  PREDICTED: V-type proton ATPase subunit C          207   5e-61   Brassica rapa
ref|XP_002441755.1|  hypothetical protein SORBIDRAFT_08g001880          207   5e-61   Sorghum bicolor [broomcorn]
ref|NP_563916.1|  V-type proton ATPase subunit C                        207   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003518129.1|  PREDICTED: V-type proton ATPase subunit C-like     206   7e-61   Glycine max [soybeans]
ref|XP_010693540.1|  PREDICTED: V-type proton ATPase subunit C          206   8e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004493016.1|  PREDICTED: V-type proton ATPase subunit C-like     206   1e-60   Cicer arietinum [garbanzo]
emb|CDY16036.1|  BnaC08g40870D                                          208   2e-60   Brassica napus [oilseed rape]
ref|XP_006305100.1|  hypothetical protein CARUB_v10009467mg             205   2e-60   
ref|XP_008808181.1|  PREDICTED: V-type proton ATPase subunit C-like     205   3e-60   Phoenix dactylifera
ref|XP_008654564.1|  PREDICTED: hypothetical protein isoform X1         205   3e-60   
ref|XP_008775427.1|  PREDICTED: V-type proton ATPase subunit C-li...    204   4e-60   Phoenix dactylifera
ref|XP_002441624.1|  hypothetical protein SORBIDRAFT_09g030620          204   8e-60   Sorghum bicolor [broomcorn]
ref|XP_006844509.1|  hypothetical protein AMTR_s00016p00139220          203   1e-59   Amborella trichopoda
ref|XP_003567787.1|  PREDICTED: V-type proton ATPase subunit C          203   2e-59   Brachypodium distachyon [annual false brome]
gb|KEH23490.1|  vacuolar H+-ATPase subunit C                            202   3e-59   Medicago truncatula
gb|KHN28568.1|  V-type proton ATPase subunit C                          202   3e-59   Glycine soja [wild soybean]
ref|XP_006655657.1|  PREDICTED: V-type proton ATPase subunit C-like     202   5e-59   Oryza brachyantha
gb|ABD32569.1|  V-ATPase subunit C                                      202   6e-59   Medicago truncatula
ref|XP_010096044.1|  V-type proton ATPase subunit C                     202   6e-59   
gb|EMT31457.1|  V-type proton ATPase subunit C                          198   6e-59   
gb|KGN50885.1|  hypothetical protein Csa_5G312840                       201   7e-59   Cucumis sativus [cucumbers]
ref|NP_001142247.1|  uncharacterized protein LOC100274416               201   9e-59   Zea mays [maize]
ref|XP_007161646.1|  hypothetical protein PHAVU_001G086700g             201   1e-58   Phaseolus vulgaris [French bean]
ref|XP_004150739.1|  PREDICTED: V-type proton ATPase subunit C-like     201   1e-58   Cucumis sativus [cucumbers]
gb|KHG11234.1|  V-type proton ATPase subunit C -like protein            199   2e-58   Gossypium arboreum [tree cotton]
ref|XP_008463120.1|  PREDICTED: V-type proton ATPase subunit C          200   2e-58   Cucumis melo [Oriental melon]
gb|ABG23314.1|  vacuolar proton-ATPase C subunit                        200   2e-58   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001056500.1|  Os05g0593100                                       200   3e-58   
ref|XP_002512862.1|  vacuolar ATP synthase subunit C, putative          200   3e-58   Ricinus communis
ref|XP_010556324.1|  PREDICTED: V-type proton ATPase subunit C          199   5e-58   Tarenaya hassleriana [spider flower]
gb|EMS67397.1|  V-type proton ATPase subunit C                          198   9e-58   Triticum urartu
ref|XP_006369829.1|  Vacuolar ATP synthase subunit C family protein     198   9e-58   
gb|KJB40646.1|  hypothetical protein B456_007G072500                    197   1e-57   Gossypium raimondii
gb|ACT34062.1|  vacuolar ATP synthetase subunit C                       198   1e-57   Aegilops tauschii
ref|XP_010554131.1|  PREDICTED: V-type proton ATPase subunit C-li...    196   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_010528136.1|  PREDICTED: V-type proton ATPase subunit C-like     196   1e-56   Tarenaya hassleriana [spider flower]
ref|NP_001147632.1|  LOC100281241                                       196   1e-56   Zea mays [maize]
ref|XP_011001967.1|  PREDICTED: V-type proton ATPase subunit C          195   2e-56   Populus euphratica
emb|CDX71966.1|  BnaC08g29080D                                          195   2e-56   
ref|XP_009118052.1|  PREDICTED: V-type proton ATPase subunit C-like     195   2e-56   Brassica rapa
gb|KFK43549.1|  hypothetical protein AALP_AA1G141200                    195   2e-56   Arabis alpina [alpine rockcress]
emb|CDY21070.1|  BnaA08g24550D                                          194   3e-56   Brassica napus [oilseed rape]
emb|CDY66539.1|  BnaCnng51300D                                          194   3e-56   Brassica napus [oilseed rape]
ref|XP_009110617.1|  PREDICTED: V-type proton ATPase subunit C-like     194   3e-56   Brassica rapa
ref|XP_010554130.1|  PREDICTED: V-type proton ATPase subunit C-li...    196   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_002889973.1|  de-etiolated 3                                     194   7e-56   
ref|XP_006373110.1|  hypothetical protein POPTR_0017s08810g             193   8e-56   Populus trichocarpa [western balsam poplar]
emb|CDY26596.1|  BnaA09g46810D                                          193   9e-54   Brassica napus [oilseed rape]
gb|ADE77882.1|  unknown                                                 185   1e-52   Picea sitchensis
ref|XP_008775428.1|  PREDICTED: V-type proton ATPase subunit C-li...    181   1e-51   
ref|XP_010528980.1|  PREDICTED: V-type proton ATPase subunit C-like     174   1e-50   Tarenaya hassleriana [spider flower]
gb|KJB76319.1|  hypothetical protein B456_012G082900                    172   1e-47   Gossypium raimondii
gb|KJB76320.1|  hypothetical protein B456_012G082900                    170   3e-47   Gossypium raimondii
gb|AGJ98217.1|  DET3                                                    168   3e-47   Petunia x hybrida [garden petunia]
ref|XP_006373109.1|  hypothetical protein POPTR_0017s08810g             169   1e-46   
gb|KCW64312.1|  hypothetical protein EUGRSUZ_G019431                    167   7e-46   Eucalyptus grandis [rose gum]
gb|AAO72561.1|  putative vacuolar ATP synthase subunit C                168   7e-46   
ref|XP_001773067.1|  predicted protein                                  166   3e-45   
ref|XP_010939292.1|  PREDICTED: V-type proton ATPase subunit C-li...    160   2e-43   Elaeis guineensis
gb|AFA36545.1|  vacuolar ATP synthetase subunit C                       144   4e-39   Lolium perenne [perennial ryegrass]
ref|XP_002980160.1|  hypothetical protein SELMODRAFT_111716             149   8e-39   Selaginella moellendorffii
gb|EMT09400.1|  V-type proton ATPase subunit C                          146   7e-38   
ref|XP_010068642.1|  PREDICTED: V-type proton ATPase subunit C-like     142   1e-36   
ref|XP_005651974.1|  vacuolar H+ ATPase V1 sector, subunit C            120   2e-28   Coccomyxa subellipsoidea C-169
gb|ADI46924.1|  ATPvC1m                                                 115   1e-26   Volvox carteri f. nagariensis
gb|KCW64318.1|  hypothetical protein EUGRSUZ_G01948                     108   2e-26   Eucalyptus grandis [rose gum]
ref|XP_002954527.1|  vacuolar ATP synthase, subunit C                   111   3e-25   Volvox carteri f. nagariensis
gb|KDO47363.1|  hypothetical protein CISIN_1g017251mg                   107   6e-24   Citrus sinensis [apfelsine]
gb|KJB40647.1|  hypothetical protein B456_007G072500                    107   8e-24   Gossypium raimondii
ref|XP_010663792.1|  PREDICTED: V-type proton ATPase subunit C is...    107   1e-23   
ref|XP_001696429.1|  vacuolar H+ ATPase V1 sector, subunit C            106   2e-23   Chlamydomonas reinhardtii
ref|XP_005847214.1|  hypothetical protein CHLNCDRAFT_35880              104   1e-22   Chlorella variabilis
gb|KJB76317.1|  hypothetical protein B456_012G082900                    103   1e-22   Gossypium raimondii
ref|XP_002503957.1|  H+-or Na+-translocating f-type, v-type and A...    103   3e-22   Micromonas commoda
gb|EPS62747.1|  hypothetical protein M569_12043                         102   3e-22   Genlisea aurea
ref|XP_008341246.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    101   6e-22   
sp|Q9SCB9.1|VATC_HORVU  RecName: Full=V-type proton ATPase subuni...    101   8e-22   Hordeum vulgare [barley]
ref|XP_001756840.1|  predicted protein                                98.2    1e-20   
emb|CCD60515.1|  subfamily S1B unassigned peptidase (S01 family)      94.7    2e-19   Schistosoma mansoni
ref|XP_011399399.1|  V-type proton ATPase subunit C                   94.7    2e-19   Auxenochlorella protothecoides
ref|XP_009051892.1|  hypothetical protein LOTGIDRAFT_206255           92.8    1e-18   Lottia gigantea
ref|XP_001814187.1|  PREDICTED: V-type proton ATPase subunit C is...  92.8    1e-18   Tribolium castaneum [rust-red flour beetle]
gb|KJB40645.1|  hypothetical protein B456_007G072500                  83.2    1e-18   Gossypium raimondii
ref|XP_008195426.1|  PREDICTED: V-type proton ATPase subunit C is...  92.8    1e-18   Tribolium castaneum [rust-red flour beetle]
ref|XP_009012372.1|  hypothetical protein HELRODRAFT_156435           92.4    2e-18   Helobdella robusta
gb|EFA06700.1|  hypothetical protein TcasGA2_TC009631                 92.8    2e-18   
gb|KFB48532.1|  AGAP005845-PA-like protein                            92.0    2e-18   Anopheles sinensis
ref|XP_006012217.1|  PREDICTED: V-type proton ATPase subunit C 1-...  91.7    3e-18   Latimeria chalumnae
gb|KDR10550.1|  V-type proton ATPase subunit C                        91.3    4e-18   Zootermopsis nevadensis
emb|CAX70572.1|  Vacuolar H+ ATPase 44kD C subunit                    90.5    5e-18   Schistosoma japonicum
ref|XP_007513767.1|  V-type proton ATPase subunit C 1                 91.7    5e-18   Bathycoccus prasinos
gb|ABF18462.1|  V-ATPase C subunit                                    90.5    6e-18   Aedes aegypti
emb|CAX70571.1|  Vacuolar H+ ATPase 44kD C subunit                    90.5    8e-18   Schistosoma japonicum
gb|AIJ50380.1|  V-ATPase subunit C                                    90.1    1e-17   Pectinophora gossypiella
gb|ACO11255.1|  Vacuolar proton pump subunit C                        90.1    1e-17   Caligus rogercresseyi
ref|XP_315870.4|  AGAP005845-PA                                       90.1    1e-17   Anopheles gambiae str. PEST
ref|XP_011305233.1|  PREDICTED: V-type proton ATPase subunit C        89.4    2e-17   Fopius arisanus
ref|NP_958479.1|  V-type proton ATPase subunit C 1-A                  88.6    3e-17   Danio rerio [leopard danio]
ref|XP_001843335.1|  vacuolar ATP synthase subunit C                  90.1    4e-17   Culex quinquefasciatus
ref|XP_001418773.1|  F-ATPase family transporter: protons (vacuolar)  88.2    4e-17   Ostreococcus lucimarinus CCE9901
ref|XP_008480724.1|  PREDICTED: V-type proton ATPase subunit C        88.6    4e-17   
ref|XP_003389520.1|  PREDICTED: V-type proton ATPase subunit C 1-...  88.2    6e-17   Amphimedon queenslandica
emb|CDJ90591.1|  ATPase domain containing protein                     86.3    6e-17   Haemonchus contortus [red stomach worm]
gb|EFX90034.1|  hypothetical protein DAPPUDRAFT_205240                87.8    7e-17   Daphnia pulex
ref|XP_001650489.1|  AAEL005173-PA                                    89.7    7e-17   
ref|XP_008895951.1|  hypothetical protein, variant                    87.4    7e-17   Phytophthora parasitica INRA-310
gb|ACM77810.1|  putative vacuolar H+ATPase                            82.8    8e-17   Erigeron canadensis [horseweed]
ref|XP_008559568.1|  PREDICTED: V-type proton ATPase subunit C        87.8    8e-17   Microplitis demolitor
gb|ETN59245.1|  vacuolar ATP synthase subunit C                       89.4    8e-17   Anopheles darlingi [American malaria mosquito]
ref|XP_005098193.1|  PREDICTED: V-type proton ATPase subunit C-li...  87.8    8e-17   Aplysia californica
gb|EYC06044.1|  hypothetical protein Y032_0078g1163                   87.4    9e-17   Ancylostoma ceylanicum
ref|XP_009861882.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  87.4    1e-16   
gb|ABO61291.1|  vacuolar ATPase subunit C                             87.4    1e-16   Lutzomyia longipalpis
ref|XP_001201267.2|  PREDICTED: V-type proton ATPase subunit C-like   87.0    1e-16   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006626108.1|  PREDICTED: V-type proton ATPase subunit C 1-...  87.0    1e-16   Lepisosteus oculatus
ref|XP_006219905.1|  PREDICTED: V-type proton ATPase subunit C-like   87.0    1e-16   Vicugna pacos
ref|XP_007670905.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  86.3    1e-16   
ref|XP_008895950.1|  hypothetical protein PPTG_03917                  87.4    1e-16   Phytophthora parasitica INRA-310
ref|NP_001023451.1|  Protein VHA-11, isoform a                        86.7    2e-16   Caenorhabditis elegans [roundworm]
ref|XP_002423137.1|  vacuolar ATP synthase subunit C, putative        87.8    2e-16   Pediculus humanus corporis [human body lice]
ref|XP_011504285.1|  PREDICTED: V-type proton ATPase subunit C is...  86.7    2e-16   Ceratosolen solmsi marchali
ref|XP_005797406.1|  PREDICTED: V-type proton ATPase subunit C 1-...  86.7    2e-16   Xiphophorus maculatus
gb|EYC06045.1|  hypothetical protein Y032_0078g1163                   87.0    2e-16   Ancylostoma ceylanicum
ref|XP_002645132.1|  C. briggsae CBR-VHA-11 protein                   86.3    2e-16   Caenorhabditis briggsae
gb|ENN78483.1|  hypothetical protein YQE_05047                        85.5    3e-16   Dendroctonus ponderosae
dbj|BAB24526.1|  unnamed protein product                              85.9    3e-16   Mus musculus [mouse]
ref|XP_001506621.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  85.9    3e-16   
ref|XP_009170324.1|  hypothetical protein T265_06723                  86.3    3e-16   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_011144745.1|  PREDICTED: V-type proton ATPase subunit C        85.9    3e-16   Harpegnathos saltator
ref|XP_010898239.1|  PREDICTED: V-type proton ATPase subunit C 1-...  85.9    3e-16   
ref|XP_001960901.1|  GF11269                                          85.9    3e-16   Drosophila ananassae
ref|XP_004077677.1|  PREDICTED: V-type proton ATPase subunit C 1      85.9    3e-16   Oryzias latipes [Japanese rice fish]
dbj|BAM20425.1|  vacuolar H[+] ATPase 44kD C subunit                  85.9    4e-16   Papilio polytes
ref|XP_004580713.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.7    4e-16   Ochotona princeps [southern American pika]
ref|XP_007249407.1|  PREDICTED: V-type proton ATPase subunit C 1-...  85.5    4e-16   Astyanax mexicanus [blind cave fish]
ref|XP_007547766.1|  PREDICTED: V-type proton ATPase subunit C 1-...  85.5    4e-16   Poecilia formosa
gb|EZA45856.1|  S-methyl-5'-thioadenosine phosphorylase-like prot...  87.0    4e-16   
ref|XP_008420198.1|  PREDICTED: V-type proton ATPase subunit C 1-A    85.5    4e-16   Poecilia reticulata
ref|XP_010954093.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  85.5    5e-16   Camelus bactrianus [camel]
ref|XP_004993351.1|  hypothetical protein PTSG_05481                  85.1    5e-16   Salpingoeca rosetta
ref|XP_002940167.1|  PREDICTED: V-type proton ATPase subunit C 2      85.5    5e-16   Xenopus tropicalis [western clawed frog]
ref|XP_004047450.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.3    5e-16   
ref|XP_004679737.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.3    5e-16   
ref|XP_010768583.1|  PREDICTED: V-type proton ATPase subunit C 1-...  82.8    5e-16   Notothenia coriiceps [yellowbelly rockcod]
gb|ERL87116.1|  hypothetical protein D910_04516                       85.1    6e-16   Dendroctonus ponderosae
dbj|GAA48137.1|  V-type proton ATPase subunit C 1-A                   86.7    6e-16   Clonorchis sinensis [oriental liver fluke]
ref|XP_011268884.1|  PREDICTED: V-type proton ATPase subunit C        85.1    6e-16   Camponotus floridanus
emb|CAF93730.1|  unnamed protein product                              84.7    6e-16   Tetraodon nigroviridis
ref|XP_001946227.1|  PREDICTED: V-type proton ATPase subunit C        85.1    6e-16   Acyrthosiphon pisum
ref|XP_004663083.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.3    6e-16   Jaculus jaculus
ref|XP_010751636.1|  PREDICTED: V-type proton ATPase subunit C 1-A    85.1    7e-16   Larimichthys crocea [croceine croaker]
ref|XP_008211658.1|  PREDICTED: V-type proton ATPase subunit C is...  85.1    7e-16   
gb|EDM16360.1|  rCG60064, isoform CRA_a                               84.0    7e-16   Rattus norvegicus [brown rat]
gb|AAA36803.1|  H+ -ATPase C subunit                                  84.3    7e-16   Homo sapiens [man]
ref|XP_003094835.1|  CRE-VHA-11 protein                               85.1    7e-16   Caenorhabditis remanei
ref|NP_001088261.1|  V-type proton ATPase subunit C 1                 84.7    7e-16   Xenopus laevis [clawed frog]
gb|EFN75043.1|  Vacuolar proton pump subunit C                        85.1    8e-16   Camponotus floridanus
gb|AAB62571.1|  V-ATPase C subunit                                    85.1    8e-16   Drosophila melanogaster
ref|XP_007550565.1|  PREDICTED: V-type proton ATPase subunit C 1-A    84.7    8e-16   Poecilia formosa
ref|XP_010744926.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.7    8e-16   
ref|XP_007550566.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.7    8e-16   Poecilia formosa
ref|XP_005803508.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.7    8e-16   Xiphophorus maculatus
ref|XP_005316339.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    8e-16   
ref|XP_010610418.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    8e-16   Fukomys damarensis [Damara mole rat]
gb|KFO20049.1|  V-type proton ATPase subunit C 1                      84.7    8e-16   Fukomys damarensis [Damara mole rat]
gb|KFP57056.1|  V-type proton ATPase subunit C 1                      82.8    8e-16   Cathartes aura
ref|XP_005306086.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    8e-16   Chrysemys picta bellii
ref|XP_008146707.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    8e-16   
ref|XP_004457641.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    8e-16   
ref|XP_003782478.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    9e-16   
ref|XP_003459431.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.7    9e-16   Oreochromis niloticus
ref|XP_006212224.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    9e-16   Vicugna pacos
ref|XP_004316545.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.0    9e-16   
ref|XP_005367598.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    9e-16   Microtus ochrogaster [prairie voles]
ref|XP_006122461.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    9e-16   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007056164.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    9e-16   Chelonia mydas [green seaturtle]
ref|XP_004457640.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    9e-16   
ref|XP_006982882.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    9e-16   Peromyscus maniculatus bairdii
ref|XP_004011849.1|  PREDICTED: V-type proton ATPase subunit C 1      84.7    1e-15   Ovis aries [domestic sheep]
ref|XP_005072734.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   
ref|XP_003701871.1|  PREDICTED: V-type proton ATPase subunit C-like   85.9    1e-15   
ref|XP_008849773.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Nannospalax galili
ref|NP_477266.1|  vacuolar H[+] ATPase 44kD subunit, isoform A        84.7    1e-15   Drosophila melanogaster
ref|XP_002710769.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Oryctolagus cuniculus [domestic rabbit]
ref|XP_011504284.1|  PREDICTED: V-type proton ATPase subunit C is...  85.9    1e-15   Ceratosolen solmsi marchali
ref|XP_007634426.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   
ref|XP_003940719.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Saimiri boliviensis boliviensis
ref|XP_006145636.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Tupaia chinensis
ref|XP_008290531.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Stegastes partitus
ref|XP_004768925.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Mustela putorius furo [black ferret]
ref|XP_006241664.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    1e-15   Rattus norvegicus [brown rat]
ref|XP_002015982.1|  GL11349                                          84.3    1e-15   Drosophila persimilis
ref|XP_003509877.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Cricetulus griseus [Chinese hamsters]
gb|EGI57447.1|  V-type proton ATPase subunit C                        84.3    1e-15   Acromyrmex echinatior
ref|NP_001686.1|  V-type proton ATPase subunit C 1                    84.3    1e-15   Homo sapiens [man]
ref|XP_008051075.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Carlito syrichta
dbj|BAE40727.1|  unnamed protein product                              84.3    1e-15   Mus musculus [mouse]
ref|NP_079770.2|  V-type proton ATPase subunit C 1                    84.3    1e-15   Mus musculus [mouse]
gb|AIC48333.1|  ATP6V1C1                                              84.3    1e-15   synthetic construct
gb|KDO34219.1|  hypothetical protein SPRG_01434                       84.7    1e-15   Saprolegnia parasitica CBS 223.65
ref|XP_002759363.1|  PREDICTED: V-type proton ATPase subunit C 1      84.3    1e-15   Callithrix jacchus [common marmoset]
ref|XP_011067212.1|  PREDICTED: V-type proton ATPase subunit C        84.3    1e-15   Acromyrmex echinatior
ref|XP_004679736.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    1e-15   
ref|XP_011227437.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    1e-15   
ref|XP_008687451.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    1e-15   Ursus maritimus [white bear]
ref|XP_005728447.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.0    1e-15   Pundamilia nyererei
ref|XP_005917491.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.0    1e-15   Haplochromis burtoni
emb|CAH93365.1|  hypothetical protein                                 84.0    1e-15   Pongo abelii [orang utan]
emb|CAH93171.1|  hypothetical protein                                 84.0    1e-15   Pongo abelii [orang utan]
ref|XP_003444114.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.0    1e-15   Oreochromis niloticus
sp|Q9U5N1.1|VATC_MANSE  RecName: Full=V-type proton ATPase subuni...  84.0    1e-15   Manduca sexta [Carolina sphinx]
ref|NP_001011992.1|  V-type proton ATPase subunit C 1                 84.0    2e-15   Rattus norvegicus [brown rat]
ref|NP_001005772.2|  V-type proton ATPase subunit C 1-B               84.0    2e-15   Danio rerio [leopard danio]
ref|XP_004663082.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    2e-15   Jaculus jaculus
ref|NP_989172.1|  V-type proton ATPase subunit C 1                    84.0    2e-15   Xenopus tropicalis [western clawed frog]
ref|XP_007488240.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  84.0    2e-15   Monodelphis domestica
ref|XP_003965909.1|  PREDICTED: V-type proton ATPase subunit C 1-...  84.0    2e-15   Takifugu rubripes [tiger puffer]
ref|XP_007932996.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    2e-15   Orycteropus afer afer
ref|XP_008321927.1|  PREDICTED: V-type proton ATPase subunit C 1      84.0    2e-15   Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_001177134.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...  84.0    2e-15   Sus scrofa [pigs]
emb|CDS17048.1|  V type proton ATPase subunit C 1 A                   84.0    2e-15   Echinococcus granulosus
ref|XP_008304955.1|  PREDICTED: V-type proton ATPase subunit C 1-A    83.6    2e-15   Stegastes partitus
ref|XP_001360460.2|  GA20788                                          84.3    2e-15   
ref|XP_005316338.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   Ictidomys tridecemlineatus
ref|XP_005627900.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
gb|ADI40552.1|  lysosomal H+-transporting ATPase 42kDa, V1 subuni...  82.0    2e-15   Cynopterus sphinx [greater short-nosed fruit bat]
ref|NP_788849.1|  V-type proton ATPase subunit C 1                    83.6    2e-15   Bos taurus [bovine]
ref|NP_725564.1|  vacuolar H[+] ATPase 44kD subunit, isoform C        84.3    2e-15   Drosophila melanogaster
ref|XP_004431292.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006192890.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_001494151.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
gb|KFV93235.1|  V-type proton ATPase subunit C 1                      82.4    2e-15   
ref|XP_006916693.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_008146706.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_004402384.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_004275371.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
ref|XP_008574309.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
ref|XP_007463323.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_007075876.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
ref|XP_006212223.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
gb|AAC83084.1|  vacuolar adenosine triphosphatase subunit C           83.6    2e-15   
ref|XP_002922648.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_003782477.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    2e-15   
ref|XP_010071758.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    2e-15   
ref|XP_010883498.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.4    2e-15   
ref|XP_005879352.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
ref|XP_009578275.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    2e-15   
ref|XP_007518917.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
ref|XP_010771260.1|  PREDICTED: V-type proton ATPase subunit C 1      83.6    2e-15   
ref|XP_004370770.1|  PREDICTED: V-type proton ATPase subunit C 1      83.2    2e-15   
ref|XP_011332476.1|  PREDICTED: V-type proton ATPase subunit C is...  82.8    3e-15   
ref|XP_009812066.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    3e-15   
ref|XP_006897234.1|  PREDICTED: V-type proton ATPase subunit C 1-...  83.2    3e-15   
gb|EGT48628.1|  CBN-VHA-11 protein                                    83.2    3e-15   
emb|CDJ04792.1|  V type proton ATPase subunit C 1 A                   83.2    3e-15   
ref|XP_003219499.1|  PREDICTED: V-type proton ATPase subunit C 1      83.2    3e-15   
gb|KFV06900.1|  V-type proton ATPase subunit C 1                      82.4    3e-15   
ref|XP_006636047.1|  PREDICTED: V-type proton ATPase subunit C 1-...  83.2    3e-15   
ref|XP_011414828.1|  PREDICTED: V-type proton ATPase subunit C 1-...  83.2    3e-15   
ref|XP_004940041.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.0    3e-15   
ref|XP_001369362.2|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    3e-15   
ref|XP_006830685.1|  PREDICTED: V-type proton ATPase subunit C 1      83.2    3e-15   
ref|XP_004607741.1|  PREDICTED: V-type proton ATPase subunit C 1      83.2    3e-15   
gb|EKC32287.1|  V-type proton ATPase subunit C 1                      83.6    3e-15   
ref|XP_010017127.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    4e-15   
ref|XP_007427660.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    4e-15   
ref|XP_001975366.1|  GG22273                                          83.6    4e-15   
ref|XP_005150964.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    4e-15   
ref|XP_010017126.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    4e-15   
ref|XP_003408473.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    4e-15   
ref|XP_003080507.1|  putative vacuolar ATP synthase subunit C (ISS)   82.8    4e-15   
ref|XP_007886138.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    4e-15   
ref|XP_005010664.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    4e-15   
gb|KFQ53504.1|  V-type proton ATPase subunit C 1                      82.8    4e-15   
ref|XP_009890115.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    4e-15   
ref|XP_007932994.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    4e-15   
ref|XP_011332474.1|  PREDICTED: V-type proton ATPase subunit C is...  82.8    4e-15   
ref|XP_007488239.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  83.6    4e-15   
gb|EUB62465.1|  V-type proton ATPase subunit C 1-A                    82.8    4e-15   
gb|KGL98694.1|  V-type proton ATPase subunit C 1                      82.8    4e-15   
ref|XP_001647617.1|  AAEL015594-PA                                    81.6    4e-15   
ref|XP_003760346.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    4e-15   
ref|XP_009076362.1|  PREDICTED: V-type proton ATPase subunit C 1      82.8    5e-15   
gb|KFQ17703.1|  V-type proton ATPase subunit C 1                      82.8    5e-15   
dbj|BAH12829.1|  unnamed protein product                              81.6    5e-15   
ref|XP_009896480.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
ref|XP_003760347.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.8    5e-15   
ref|XP_009275405.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
gb|KFW03506.1|  V-type proton ATPase subunit C 1                      82.8    5e-15   
ref|XP_005042435.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
gb|KFQ75735.1|  V-type proton ATPase subunit C 1                      82.4    5e-15   
ref|XP_009680642.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
ref|XP_008934370.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
ref|XP_009864623.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
ref|XP_010148071.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
gb|KFV65544.1|  V-type proton ATPase subunit C 1                      82.4    5e-15   
ref|XP_002092223.1|  GE14069                                          83.6    5e-15   
ref|XP_010223600.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
ref|XP_005231036.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
ref|XP_005499457.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
gb|KFM06053.1|  V-type proton ATPase subunit C 1                      82.4    5e-15   
ref|XP_008211656.1|  PREDICTED: V-type proton ATPase subunit C is...  84.0    5e-15   
gb|KFV53281.1|  V-type proton ATPase subunit C 1                      82.4    5e-15   
gb|KFP35023.1|  V-type proton ATPase subunit C 1                      82.4    5e-15   
ref|XP_009700298.1|  PREDICTED: V-type proton ATPase subunit C 1      82.4    5e-15   
gb|KFP85886.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|EMP39278.1|  V-type proton ATPase subunit C 1                      83.6    6e-15   
gb|KFP83640.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|KFQ55181.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|KFP65965.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
ref|XP_004903962.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.4    6e-15   
gb|KFP15570.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|KFV20198.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|KGL84583.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|KFO56816.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|KFZ64730.1|  V-type proton ATPase subunit C 1                      82.4    6e-15   
gb|EOB07902.1|  Vacuolar proton pump subunit C 1                      82.4    6e-15   
gb|ELW68408.1|  V-type proton ATPase subunit C 1                      81.3    6e-15   
ref|XP_008329974.1|  PREDICTED: V-type proton ATPase subunit C 1-...  82.4    6e-15   
ref|XP_010883497.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.4    6e-15   
ref|XP_002004414.1|  GI19629                                          83.6    7e-15   
ref|XP_009918407.1|  PREDICTED: V-type proton ATPase subunit C 1      82.0    7e-15   
ref|XP_008611986.1|  hypothetical protein SDRG_07905                  82.4    7e-15   
gb|EHJ73191.1|  hypothetical protein KGM_01090                        82.8    7e-15   
ref|NP_001040138.1|  vacuolar ATPase subunit C                        82.0    7e-15   
ref|XP_003395428.1|  PREDICTED: v-type proton ATPase subunit C-like   82.4    8e-15   
gb|KFQ04988.1|  V-type proton ATPase subunit C 1                      82.0    8e-15   
ref|XP_010004766.1|  PREDICTED: V-type proton ATPase subunit C 1      82.0    8e-15   
ref|XP_003480143.1|  PREDICTED: V-type proton ATPase subunit C 1      82.0    8e-15   
ref|XP_008922269.1|  PREDICTED: V-type proton ATPase subunit C 1      82.0    9e-15   
ref|XP_009510884.1|  PREDICTED: V-type proton ATPase subunit C 1      82.0    9e-15   
ref|XP_006028579.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.0    9e-15   
ref|XP_418370.1|  PREDICTED: V-type proton ATPase subunit C 1 iso...  81.6    9e-15   
gb|ADI40553.1|  lysosomal H+-transporting ATPase 42kDa, V1 subuni...  79.3    9e-15   
ref|XP_002059879.1|  GJ14996                                          83.2    1e-14   
ref|XP_010302959.1|  PREDICTED: V-type proton ATPase subunit C 1      81.6    1e-14   
ref|XP_006028578.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  82.0    1e-14   
gb|KFO11936.1|  V-type proton ATPase subunit C 1                      81.6    1e-14   
ref|XP_002199030.2|  PREDICTED: V-type proton ATPase subunit C 1      82.4    1e-14   
ref|XP_010980173.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  81.6    1e-14   
ref|XP_008500896.1|  PREDICTED: V-type proton ATPase subunit C 1      81.6    1e-14   
ref|XP_002063006.1|  GK21692                                          83.2    1e-14   
ref|XP_010222647.1|  PREDICTED: V-type proton ATPase subunit C 2      81.6    1e-14   
ref|XP_003488765.1|  PREDICTED: V-type proton ATPase subunit C-like   82.8    1e-14   
gb|KFW95221.1|  V-type proton ATPase subunit C 1                      81.6    1e-14   
gb|EJW79943.1|  V-ATPase subunit C family protein                     80.9    1e-14   
ref|XP_002733333.1|  PREDICTED: V-type proton ATPase subunit C 1-...  81.3    1e-14   
gb|KFP07692.1|  V-type proton ATPase subunit C 1                      81.3    1e-14   
gb|ETE67498.1|  V-type proton ATPase subunit C 1-A                    81.3    1e-14   
ref|XP_001899274.1|  V-ATPase subunit C family protein                81.3    2e-14   
ref|XP_003139516.1|  V-ATPase subunit C family protein                81.3    2e-14   
emb|CEF60497.1|  V-type proton ATPase subunit C 2                     81.3    2e-14   
ref|XP_007423656.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  80.9    2e-14   
ref|XP_002585525.1|  hypothetical protein BRAFLDRAFT_60009            80.9    2e-14   
emb|CDQ00984.1|  Protein Bm13998, isoform h                           81.3    2e-14   
ref|XP_004340673.1|  Vtype proton ATPase subunit C, putative          80.9    2e-14   
ref|XP_004074259.1|  PREDICTED: V-type proton ATPase subunit C 1-...  80.5    2e-14   
ref|XP_006760332.1|  PREDICTED: V-type proton ATPase subunit C 1      80.1    3e-14   
ref|NP_725565.3|  vacuolar H[+] ATPase 44kD subunit, isoform E        82.0    3e-14   
gb|KFM68542.1|  V-type proton ATPase subunit C                        80.1    3e-14   
gb|KFO92741.1|  V-type proton ATPase subunit C 1                      80.1    3e-14   
gb|AAV36859.1|  RE74713p                                              81.6    3e-14   
ref|XP_010139291.1|  PREDICTED: V-type proton ATPase subunit C 1      80.1    3e-14   
ref|XP_009321363.1|  PREDICTED: V-type proton ATPase subunit C 1      80.1    4e-14   
ref|XP_003968986.1|  PREDICTED: V-type proton ATPase subunit C 1-...  80.1    4e-14   
gb|KFW66441.1|  V-type proton ATPase subunit C 1                      80.1    4e-14   
ref|XP_003741777.1|  PREDICTED: V-type proton ATPase subunit C 1-...  80.1    4e-14   
ref|XP_009556284.1|  PREDICTED: V-type proton ATPase subunit C 1      80.1    4e-14   
gb|KFO74013.1|  V-type proton ATPase subunit C 1                      79.7    4e-14   
gb|AAB51350.1|  C subunit of V-ATPase                                 79.7    4e-14   
ref|XP_006021843.1|  PREDICTED: V-type proton ATPase subunit C 2      79.7    5e-14   
ref|XP_008865718.1|  hypothetical protein H310_03575                  79.7    6e-14   
ref|NP_001279559.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...  79.3    6e-14   
ref|XP_002408654.1|  C subunit of V-ATPase, putative                  79.3    6e-14   
ref|XP_009824064.1|  hypothetical protein H257_02220                  79.3    8e-14   
ref|XP_004356034.1|  H(+)-transporting ATPase                         79.0    8e-14   
ref|XP_006010910.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  79.0    9e-14   
gb|ESA12183.1|  hypothetical protein GLOINDRAFT_185994                79.0    1e-13   
ref|XP_001987444.1|  GH21923                                          80.1    1e-13   
ref|XP_004533485.1|  PREDICTED: V-type proton ATPase subunit C-li...  79.0    1e-13   
ref|XP_006562159.1|  PREDICTED: V-type proton ATPase subunit C is...  78.6    1e-13   
ref|XP_006611433.1|  PREDICTED: V-type proton ATPase subunit C-li...  78.6    1e-13   
ref|XP_007476197.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  78.6    1e-13   
ref|XP_009029568.1|  hypothetical protein HELRODRAFT_103807           78.2    2e-13   
emb|CEG71831.1|  hypothetical protein RMATCC62417_07500               78.2    2e-13   
ref|XP_006562158.1|  PREDICTED: V-type proton ATPase subunit C is...  78.2    2e-13   
ref|XP_006611432.1|  PREDICTED: V-type proton ATPase subunit C-li...  78.2    2e-13   
ref|XP_011205545.1|  PREDICTED: V-type proton ATPase subunit C        77.8    3e-13   
ref|XP_003696475.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  78.6    3e-13   
ref|XP_006257984.1|  PREDICTED: V-type proton ATPase subunit C 2      77.4    4e-13   
gb|EFA81774.1|  H+-transporting ATPase                                76.6    5e-13   
ref|XP_008115724.1|  PREDICTED: V-type proton ATPase subunit C 2      76.6    5e-13   
ref|XP_003773690.1|  PREDICTED: V-type proton ATPase subunit C 1-...  76.6    6e-13   
ref|XP_004436528.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  76.6    6e-13   
ref|XP_005174884.1|  PREDICTED: V-type proton ATPase subunit C        76.6    6e-13   
ref|XP_004582658.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  76.3    8e-13   
gb|ELK13979.1|  V-type proton ATPase subunit C 2                      75.5    8e-13   
ref|XP_003375717.1|  vacuolar proton pump subunit C                   76.3    8e-13   
ref|XP_006140884.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  76.3    9e-13   
gb|KHN78456.1|  V-type proton ATPase subunit C                        75.1    1e-12   
gb|KHJ99251.1|  v-ATPase subunit C                                    75.9    1e-12   
ref|XP_011181512.1|  PREDICTED: V-type proton ATPase subunit C        75.9    1e-12   
ref|XP_003787440.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  75.5    1e-12   
ref|XP_009068581.1|  PREDICTED: V-type proton ATPase subunit C 2      75.5    1e-12   
ref|XP_002196413.1|  PREDICTED: V-type proton ATPase subunit C 2      75.5    1e-12   
gb|ERG84842.1|  v-type proton atpase subunit c                        75.5    2e-12   
ref|XP_006677585.1|  hypothetical protein BATDEDRAFT_87040            75.5    2e-12   
ref|XP_008493333.1|  PREDICTED: V-type proton ATPase subunit C 2      75.5    2e-12   
ref|XP_011363427.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  75.1    2e-12   
gb|EPY75601.1|  V-type proton ATPase subunit C 2 isoform 1            75.1    2e-12   
ref|XP_005487252.1|  PREDICTED: V-type proton ATPase subunit C 2      75.1    2e-12   
ref|XP_002296350.1|  V-type H-ATPase subunit C                        74.7    2e-12   
ref|XP_006910296.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  75.1    2e-12   
sp|Q9NDR5.1|VATC_ASCSS  RecName: Full=V-type proton ATPase subuni...  75.1    2e-12   
ref|XP_005293177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  75.1    2e-12   
ref|XP_006191924.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  75.1    2e-12   
ref|XP_009489937.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  72.8    2e-12   
ref|XP_009898136.1|  PREDICTED: V-type proton ATPase subunit C 2      74.7    3e-12   
ref|XP_004887051.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  74.7    3e-12   
ref|XP_002107808.1|  hypothetical protein TRIADDRAFT_19844            74.7    3e-12   
ref|XP_010627354.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  74.7    3e-12   
emb|CCI43247.1|  unnamed protein product                              74.7    3e-12   
gb|EYC06042.1|  hypothetical protein Y032_0078g1163                   74.7    3e-12   
ref|XP_008528126.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  74.3    3e-12   
emb|CCA27664.1|  H or Na translocating Ftype putative                 74.7    3e-12   
ref|XP_009702306.1|  PREDICTED: V-type proton ATPase subunit C 2      74.3    4e-12   
gb|EDL08793.1|  \ATPase, H+ transporting, lysosomal V1 subunit C1...  72.0    4e-12   
ref|XP_008528125.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  74.3    4e-12   
ref|XP_007933285.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  74.3    4e-12   
ref|XP_008930944.1|  PREDICTED: V-type proton ATPase subunit C 2      74.3    4e-12   
ref|XP_007053234.1|  PREDICTED: V-type proton ATPase subunit C 2      74.3    4e-12   
ref|XP_004665751.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  74.3    4e-12   
ref|XP_005404477.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  73.9    4e-12   
gb|ELT96241.1|  hypothetical protein CAPTEDRAFT_179819                74.3    5e-12   
ref|XP_005044330.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  73.9    5e-12   
ref|XP_008639998.1|  PREDICTED: V-type proton ATPase subunit C 2      73.9    5e-12   
gb|ADK26726.1|  ATPase, H+ transporting, lysosomal 42kDa, V1 subu...  73.9    5e-12   
ref|XP_005044329.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  73.9    5e-12   
ref|XP_009874966.1|  PREDICTED: V-type proton ATPase subunit C 2      72.8    5e-12   
ref|XP_003055517.1|  H+-or Na+-translocating f-type, v-type and A...  73.9    5e-12   
ref|XP_010280691.1|  PREDICTED: V-type proton ATPase subunit C 2      73.9    5e-12   
ref|XP_005327420.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  73.9    5e-12   
ref|XP_001505940.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  73.9    5e-12   
gb|EYC06043.1|  hypothetical protein Y032_0078g1163                   74.3    5e-12   
ref|XP_005521918.1|  PREDICTED: V-type proton ATPase subunit C 2      73.9    6e-12   
gb|KII64093.1|  V-type proton ATPase subunit C 1-A                    73.2    6e-12   
ref|XP_005506895.1|  PREDICTED: V-type proton ATPase subunit C 2      73.6    6e-12   
gb|KDD75533.1|  hypothetical protein H632_c634p0                      69.7    7e-12   
ref|XP_419951.1|  PREDICTED: V-type proton ATPase subunit C 2 iso...  73.6    7e-12   
ref|XP_001503588.2|  PREDICTED: V-type proton ATPase subunit C 2 ...  73.6    7e-12   



>dbj|BAO57286.1| V-type proton ATPase subunit [Ipomoea nil]
Length=376

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/143 (100%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS
Sbjct  234  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVRVFAESILRYGLPPSFLSVVLSPSVKSEKRVRSILESLCDSSNSTYWKTEDE
Sbjct  294  SWMHFCAVRVFAESILRYGLPPSFLSVVLSPSVKSEKRVRSILESLCDSSNSTYWKTEDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            GAVGAFGGDAEVHPYVSFTINLV
Sbjct  354  GAVGAFGGDAEVHPYVSFTINLV  376



>ref|XP_009786911.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana sylvestris]
Length=376

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNF+IKARERGFQIRDFE+NPET ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS
Sbjct  234  DADNFKIKARERGFQIRDFEHNPETQESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVR+FAESILRYGLPPSFLSVVL+PS KSEK+VRSILESLCDSSNS +WK+EDE
Sbjct  294  SWMHFCAVRIFAESILRYGLPPSFLSVVLAPSTKSEKKVRSILESLCDSSNSNFWKSEDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +  FGGD+E HPYVSFTINLV
Sbjct  354  GGMAGFGGDSEAHPYVSFTINLV  376



>ref|XP_009618992.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana tomentosiformis]
Length=376

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNF+IKARERGFQIRDFE+NP+T ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS
Sbjct  234  DADNFKIKARERGFQIRDFEHNPDTQESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVR+FAESILRYGLPPSFLSVVL+PS KSEK+VRSILESLCDSSNS +WK+EDE
Sbjct  294  SWMHFCAVRIFAESILRYGLPPSFLSVVLAPSTKSEKKVRSILESLCDSSNSNFWKSEDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            G +  FGGDAE HPYVSFTINL
Sbjct  354  GGMAGFGGDAEAHPYVSFTINL  375



>ref|XP_006363973.1| PREDICTED: V-type proton ATPase subunit C-like [Solanum tuberosum]
Length=376

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNF+IKARERGFQIRDFE+NPET ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS
Sbjct  234  DADNFKIKARERGFQIRDFEHNPETQESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVR+FAESILRYGLPPSFLSVVL+PS+KSEK+VRSILESLCDSSNS +WK +DE
Sbjct  294  SWMHFCAVRIFAESILRYGLPPSFLSVVLAPSIKSEKKVRSILESLCDSSNSNFWKADDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +  FGGD E HPYVSFTINLV
Sbjct  354  GGMAGFGGDTEAHPYVSFTINLV  376



>ref|XP_004235295.1| PREDICTED: V-type proton ATPase subunit C [Solanum lycopersicum]
Length=376

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNF+ KARERGFQIRDFE+NPET ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS
Sbjct  234  DADNFKNKARERGFQIRDFEHNPETQESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVR+FAESILRYGLPPSFLSVVL+PS+KSEK+VRSILESLCDSSNS +WK +DE
Sbjct  294  SWMHFCAVRIFAESILRYGLPPSFLSVVLAPSIKSEKKVRSILESLCDSSNSNFWKADDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +  FGGD E HPYVSFTINLV
Sbjct  354  GGMAGFGGDTEAHPYVSFTINLV  376



>emb|CDP15722.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNFR KARER FQIRDFEYN ET ESRKQELEKLMQDQE FRSSLLQWCYTSYGEVF 
Sbjct  234  DADNFRTKARERAFQIRDFEYNSETQESRKQELEKLMQDQERFRSSLLQWCYTSYGEVFI  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVR+FAESILRYGLPPSFLS VLSPSVKSEK+VRSILE LCDSSNSTYWKTEDE
Sbjct  294  SWMHFCAVRIFAESILRYGLPPSFLSAVLSPSVKSEKKVRSILEGLCDSSNSTYWKTEDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +  FG DA+ HPYVSFTINL+
Sbjct  354  GPLSGFGADADAHPYVSFTINLI  376



>ref|XP_011073132.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNFR KARER FQIRDFEYNPET ESRKQELEKL QDQET RSSLLQWCYTSYGEVFS
Sbjct  234  DADNFRTKARERNFQIRDFEYNPETQESRKQELEKLNQDQETLRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVRVF+ESILRYGLPPSFLSVVLSP  KSEK+VR+ILE LC SSNSTYWKTEDE
Sbjct  294  SWMHFCAVRVFSESILRYGLPPSFLSVVLSPPTKSEKKVRNILEGLCSSSNSTYWKTEDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +G F GD + HPYVSFTINL+
Sbjct  354  GGMGGFAGDTDAHPYVSFTINLI  376



>ref|XP_011083360.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNFR KARE+ FQ+RDFEYNPET ESRKQELEKL+QDQET RSSLLQWCYTSYGEVFS
Sbjct  234  DADNFRTKAREKNFQVRDFEYNPETQESRKQELEKLIQDQETLRSSLLQWCYTSYGEVFS  293

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVRVF+ESILRYGLPPSFLSVVLSPSVKSEK+VRSILE L DSS+STYWKT+DE
Sbjct  294  SWMHFCAVRVFSESILRYGLPPSFLSVVLSPSVKSEKKVRSILEGLSDSSHSTYWKTDDE  353

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +G F GDA+ HPYV FTINL+
Sbjct  354  GGMGGFAGDADAHPYVCFTINLI  376



>gb|EYU24479.1| hypothetical protein MIMGU_mgv1a006812mg [Erythranthe guttata]
Length=430

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNFR KARER FQIRDFEYN ET ESRKQELEKLMQDQE+ R+SLLQWCYTSYGEVFS
Sbjct  288  DADNFRTKARERSFQIRDFEYNSETQESRKQELEKLMQDQESLRNSLLQWCYTSYGEVFS  347

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            SWMHFCAVRVF+ESILRYGLPPSFLSVVL+PS+KSEK+VRSILE LC SSNSTYWK EDE
Sbjct  348  SWMHFCAVRVFSESILRYGLPPSFLSVVLAPSLKSEKKVRSILEGLCTSSNSTYWKGEDE  407

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
              +G FGGD++ HPYVSFT+NLV
Sbjct  408  VGMGGFGGDSDAHPYVSFTVNLV  430



>gb|KJB40644.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=261

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSS
Sbjct  119  ADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSS  178

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESILRYGLPPSFL+ VLSPS K EK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  179  WMHFCAVRIFAESILRYGLPPSFLACVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEG  238

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+   GGDA+ +PYVSFTIN+
Sbjct  239  GAMAGLGGDADTYPYVSFTINI  260



>ref|XP_002284444.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Vitis vinifera]
 emb|CBI15738.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIRDFEY+PET ESRKQELEKLM DQ+T R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNFKTSARERGFQIRDFEYSPETQESRKQELEKLMLDQDTIRTSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFLSVVL+PSVKSEK+ RSILE L DS+NSTYWK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLSVVLAPSVKSEKKARSILEGLSDSANSTYWKSEDEL  352

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +G+ GGDA+ HPYVSFTINLV
Sbjct  353  GGMGSLGGDADSHPYVSFTINLV  375



>gb|KJB40648.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=375

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESILRYGLPPSFL+ VLSPS K EK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  293  WMHFCAVRIFAESILRYGLPPSFLACVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEG  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+   GGDA+ +PYVSFTIN+
Sbjct  353  GAMAGLGGDADTYPYVSFTINI  374



>ref|XP_010249179.1| PREDICTED: V-type proton ATPase subunit C-like [Nelumbo nucifera]
Length=375

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIR+FEY+PET ESRK+ELEKLMQDQET R SLL WCYTSYGEVFSS
Sbjct  235  ADNFKTSARERGFQIREFEYSPETQESRKRELEKLMQDQETLRGSLLLWCYTSYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PS K+EK+VRSILE LCDS++STYWK+EDEG
Sbjct  295  WMHFCAVRVFAESILRYGLPPSFLATVLAPSTKNEKKVRSILEGLCDSTHSTYWKSEDEG  354

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             VG  GGDA+ HPYVSFTIN++
Sbjct  355  VVG-LGGDADSHPYVSFTINII  375



>ref|XP_007031994.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
 gb|EOY02920.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
Length=375

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLIQDQDSLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF+ESILRYGLPPSFL+ VL+PSVK EK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  293  WMHFCAVRVFSESILRYGLPPSFLACVLAPSVKGEKKVRSILEGLCDSTNSTYWKTEDES  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+   GGDA+ HPYVSFTIN+
Sbjct  353  GAMAGLGGDADAHPYVSFTINI  374



>gb|KJB76316.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=352

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSS
Sbjct  210  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSS  269

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  270  WMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSILEGLCDSANSTYWKTEDEG  329

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+   GGD + HPYVSFTIN+
Sbjct  330  GAMAGLGGDTDAHPYVSFTINI  351



>gb|KJB76315.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76318.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76321.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=375

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSILEGLCDSANSTYWKTEDEG  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+   GGD + HPYVSFTIN+
Sbjct  353  GAMAGLGGDTDAHPYVSFTINI  374



>ref|XP_007151733.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
 gb|ESW23727.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
Length=376

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE+HESRKQEL+KL++DQE+ R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSPESHESRKQELDKLIEDQESLRASLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFL+ VL+PSVK+EK+VRSILE L DS+NS YWKTEDEG
Sbjct  293  WMHFCAVRVFTESILRYGLPPSFLASVLAPSVKAEKKVRSILEGLSDSTNSGYWKTEDEG  352

Query  316  A--VGAFGGDAEVHPYVSFTINLV  251
                G   GDA+ HPYVSFTINLV
Sbjct  353  VGMAGLVAGDADAHPYVSFTINLV  376



>ref|XP_008231040.1| PREDICTED: V-type proton ATPase subunit C [Prunus mume]
Length=376

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESILRYGLPPSFL+ VL+P+ KSEK+VRSILE LCDS NST+WKT+DE 
Sbjct  293  WMHFCAVRIFAESILRYGLPPSFLACVLAPTTKSEKKVRSILEGLCDSGNSTFWKTDDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             GA+   GGDA+ HPYVSFTINLV
Sbjct  353  GGAMAGLGGDADAHPYVSFTINLV  376



>ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [Vitis vinifera]
 emb|CBI21291.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEY+ E  ESRK+ELEKLM+DQETFRS+LLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNARERGFQIRDFEYSSEAQESRKEELEKLMRDQETFRSTLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE LCDS+NS +WK+ED+ 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLAPSVKSEKKVRSILEGLCDSTNSAFWKSEDDA  352

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +   GGDA+ HPYV FTINLV
Sbjct  353  GGMAGLGGDADAHPYVCFTINLV  375



>gb|KDP41839.1| hypothetical protein JCGZ_26857 [Jatropha curcas]
Length=376

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  E RKQELEKLMQDQE+ RSSLLQW YTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSPEAQEGRKQELEKLMQDQESLRSSLLQWSYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF+ESILRYGLPPSFLS VL+PS KSEK+VRSILE LCDS+NSTYWK+EDE 
Sbjct  293  WMHFCAVRVFSESILRYGLPPSFLSCVLAPSAKSEKKVRSILEGLCDSANSTYWKSEDEI  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G + A GGDA  +PYVSFTINL
Sbjct  353  GGGMAALGGDAGAYPYVSFTINL  375



>ref|XP_006599411.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN13381.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE GFQIRDFEY+PE+H+SRKQELEKL++DQE+ R SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREEGFQIRDFEYSPESHDSRKQELEKLVEDQESLRGSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFL+ VL+PSVK+EK+VRSILE L DSSNS YWKTEDEG
Sbjct  293  WMHFCAVRVFTESILRYGLPPSFLACVLAPSVKAEKKVRSILEGLSDSSNSAYWKTEDEG  352

Query  316  -AVGAFGGDAEVHPYVSFTINLV  251
              +    GDA+ HPYVSFTINLV
Sbjct  353  VGMAGLAGDADAHPYVSFTINLV  375



>ref|XP_007215551.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
 gb|EMJ16750.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
Length=376

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+P+ KSEK+VRSILE LCDS NST+WKT+DE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLAPTTKSEKKVRSILEGLCDSGNSTFWKTDDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G +    GDA+ HPYVSFTINLV
Sbjct  353  GGGMAGLAGDADAHPYVSFTINLV  376



>ref|XP_008362171.1| PREDICTED: V-type proton ATPase subunit C-like [Malus domestica]
Length=262

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  R SLLQWCYTSYGEVFSS
Sbjct  119  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRGSLLQWCYTSYGEVFSS  178

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF ESILRYGLPP+FL+ VLSP  K+EK+VRSILE LCDS NST+WK +DE 
Sbjct  179  WMHFCAVRVFTESILRYGLPPNFLACVLSPPTKAEKKVRSILEGLCDSGNSTFWKXDDEV  238

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G V    GDA+ HPYVSFTINLV
Sbjct  239  GGGVPGLAGDADAHPYVSFTINLV  262



>gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum]
Length=377

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ   RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQYMLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvv--lspsvkSEKRVRSILESLCDSSNSTYWKTED  323
            WMHFCAVRVFAESILRYGLPPS   +   LSPSVK EK+VRSILE LCDS+NSTYWKTED
Sbjct  293  WMHFCAVRVFAESILRYGLPPSPSFLACVLSPSVKGEKKVRSILEGLCDSANSTYWKTED  352

Query  322  E-GAVGAFGGDAEVHPYVSFTINL  254
            E GA+   GGD + HPYVSFTIN+
Sbjct  353  EGGAMAGLGGDTDAHPYVSFTINI  376



>gb|KHM99227.1| V-type proton ATPase subunit C [Glycine soja]
Length=376

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQERLRASLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE L DS+NS YWKTEDE 
Sbjct  293  WMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSILEGLTDSTNSAYWKTEDEV  352

Query  316  AVGAFG--GDAEVHPYVSFTINL  254
              G  G  GDA+ HPYVSFTIN+
Sbjct  353  GAGMAGLAGDADAHPYVSFTINV  375



>ref|XP_003548919.2| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=384

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSS
Sbjct  241  ADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQERLRASLLQWCYTSYGEVFSS  300

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE L DS+NS YWKTEDE 
Sbjct  301  WMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSILEGLTDSTNSAYWKTEDEV  360

Query  316  AVGAFG--GDAEVHPYVSFTINL  254
              G  G  GDA+ HPYVSFTIN+
Sbjct  361  GAGMAGLAGDADAHPYVSFTINV  383



>gb|AIY85415.1| V-ATPase subunit C1 [Eriobotrya japonica]
Length=376

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  R SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRGSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF ESILRYGLPP+FL+ VL+P  K+EK+VRSILE LCDS NST+WKT+DE 
Sbjct  293  WMHFCAVRVFTESILRYGLPPNFLACVLAPPTKAEKKVRSILEGLCDSGNSTFWKTDDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G V    GDA+ HPYVSFTINLV
Sbjct  353  GGGVPGLAGDADAHPYVSFTINLV  376



>ref|XP_010925033.1| PREDICTED: V-type proton ATPase subunit C-like [Elaeis guineensis]
Length=374

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIR+FEY+PE  ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFKTSARERGFQIREFEYSPEAQESRKQELEKLLQDQENIRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PS K EK+VRSILE LC + NST+WK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLAAVLAPSAKGEKKVRSILEELCGNVNSTFWKSEDEV  352

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GG+AE +PYVSFTIN+V
Sbjct  353  GLAGLGGEAEAYPYVSFTINIV  374



>ref|XP_011468207.1| PREDICTED: V-type proton ATPase subunit C [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 124/144 (86%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSILE LCDSSNS +WKTEDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLAPVTKSEKKVRSILEGLCDSSNS-FWKTEDEV  351

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             GA+    GDA+ HPYVSF INLV
Sbjct  352  GGAMAGLAGDADAHPYVSFNINLV  375



>ref|XP_006446960.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446961.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446962.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006468875.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468876.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Citrus 
sinensis]
 ref|XP_006468877.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Citrus 
sinensis]
 gb|ESR60200.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60201.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60202.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|KDO47360.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47361.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47362.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=375

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARE+GFQIRDFEY+ E  ESR QELEKL+ DQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRIAAREKGFQIRDFEYSSEAQESRNQELEKLVHDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK EK+VRSILE LC ++NST+WK+ED+G
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFWKSEDDG  352

Query  316  AVGA-FGGDAEVHPYVSFTINLV  251
             + A  GGDA+ HPYVSFTINLV
Sbjct  353  GMMAGLGGDADSHPYVSFTINLV  375



>ref|XP_009378027.1| PREDICTED: V-type proton ATPase subunit C [Pyrus x bretschneideri]
Length=376

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  R SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRGSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF ESILRYGLPP+FL+ VL+P  K+EK+VRSILE LCDS NST+WKT+DE 
Sbjct  293  WMHFCAVRVFTESILRYGLPPNFLACVLAPPTKAEKKVRSILEGLCDSGNSTFWKTDDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G V    GD + HPYVSFTINLV
Sbjct  353  GGGVPGLAGDVDAHPYVSFTINLV  376



>ref|XP_003553974.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=377

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSS
Sbjct  234  ADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQERLRTSLLQWCYTSYGEVFSS  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE L DS+NS YWK EDE 
Sbjct  294  WMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSILEGLSDSTNSAYWKNEDEV  353

Query  316  AVGAFG--GDAEVHPYVSFTINL  254
              G  G  GDA+ HPYVSFTINL
Sbjct  354  GAGMAGLAGDADGHPYVSFTINL  376



>ref|XP_011045799.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Populus 
euphratica]
 ref|XP_011045800.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Populus 
euphratica]
Length=375

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  ESRKQELE+L++DQE  RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNAREKGFQIRDFEYSPEAQESRKQELERLVRDQENLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCA+RVFAESILRYGLPPSFL+ VLSP+ KSEK+VRSILE  CD+SNST+WK+EDE 
Sbjct  293  WMHFCAIRVFAESILRYGLPPSFLACVLSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEM  352

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +   GGDA+ +PY SFTINLV
Sbjct  353  GGIFGLGGDADTYPYPSFTINLV  375



>ref|XP_011045798.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  ESRKQELE+L++DQE  RSSLLQWCYTSYGEVFSS
Sbjct  247  ADNFRTNAREKGFQIRDFEYSPEAQESRKQELERLVRDQENLRSSLLQWCYTSYGEVFSS  306

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCA+RVFAESILRYGLPPSFL+ VLSP+ KSEK+VRSILE  CD+SNST+WK+EDE 
Sbjct  307  WMHFCAIRVFAESILRYGLPPSFLACVLSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEM  366

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G +   GGDA+ +PY SFTINLV
Sbjct  367  GGIFGLGGDADTYPYPSFTINLV  389



>dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
Length=263

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARE+GFQ+RDFE + E  E+RKQEL KL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  121  ADNFRIAAREKGFQVRDFEQSVEAQETRKQELAKLVQDQESLRSSLLQWCYTSYGEVFSS  180

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED 
Sbjct  181  WMHFCAVRTFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDA  240

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  241  GAMAGLAGDSETHPYVSFTINL  262



>ref|XP_008379060.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C [Malus domestica]
Length=376

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  R+SLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRASLLQWCYXSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR FAESILRYGLPP+FL+ VL+P+ K+EK+VRSILE LCDS NST+WKT+DE 
Sbjct  293  WMHFCAVRDFAESILRYGLPPNFLACVLAPTTKAEKKVRSILEGLCDSGNSTFWKTDDEA  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G V    GDA+ HPYVSFTINLV
Sbjct  353  GGGVPGLAGDADAHPYVSFTINLV  376



>ref|XP_004977299.1| PREDICTED: V-type proton ATPase subunit C-like [Setaria italica]
Length=377

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE  RSSLLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEAMRSSLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+F ESILRYGLPPSFLS VL+PS KSEK+VRSILE LC +++STYWK+ED+ 
Sbjct  296  WMHFCAVRIFVESILRYGLPPSFLSAVLAPSTKSEKKVRSILEELCGNAHSTYWKSEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
            +V   GG++E+HPYVSFTIN+V
Sbjct  356  SVAGLGGESELHPYVSFTINIV  377



>ref|XP_010066422.1| PREDICTED: V-type proton ATPase subunit C [Eucalyptus grandis]
Length=378

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEYN E  E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSS
Sbjct  236  ADNFRTTARERGFQIRDFEYNLEAQEGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK EK+VRSILE LCD+++S YWK  ED 
Sbjct  296  WMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEGLCDNTHSAYWKPEEDA  355

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            G +   GGDA+ HPYVSFTIN+
Sbjct  356  GGMAGLGGDADTHPYVSFTINI  377



>ref|XP_003624472.1| V-type proton ATPase subunit C [Medicago truncatula]
 gb|AES80690.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=378

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE RKQEL+KLMQDQE+ R SLLQWCY SYGEVFSS
Sbjct  235  ADNFRTSAREKGFQIRDFEYSPETHEGRKQELDKLMQDQESLRGSLLQWCYASYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+F+ESILRYGLPPSFL+ VL+PSVK+EK+VRSILE L DSSNS YWKT++E 
Sbjct  295  WMHFCAVRLFSESILRYGLPPSFLACVLAPSVKAEKKVRSILEGLSDSSNSAYWKTDEEV  354

Query  316  AVGAFG--GDAEVHPYVSFTINLV  251
              G  G  G+A+ HPYVSFTINL+
Sbjct  355  GAGMAGLAGEADTHPYVSFTINLL  378



>ref|NP_001141160.1| hypothetical protein [Zea mays]
 gb|ACF84813.1| unknown [Zea mays]
 gb|ACF85584.1| unknown [Zea mays]
 gb|ACN29201.1| unknown [Zea mays]
 gb|AFW81324.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81325.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=200

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSS
Sbjct  59   VDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSS  118

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSILE LC +++S YWK+ED+ 
Sbjct  119  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSILEELCGNAHSIYWKSEDDV  178

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             V   GG+ E HPYVSFTIN V
Sbjct  179  GVAGLGGETEAHPYVSFTINFV  200



>ref|XP_009386009.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCY SYGEVFSS
Sbjct  235  ADNFRNNAREKGFQIREFEYSPEAQESRKQELEKLIQDQESKRSSLLQWCYASYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+VVL+P VKSEK+VR ILE LC + NS+YWK+EDE 
Sbjct  295  WMHFCAVRVFAESILRYGLPPSFLAVVLAPLVKSEKKVRGILEELCGNVNSSYWKSEDEI  354

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GG+AE +PYVSFTINLV
Sbjct  355  GLAGIGGEAEAYPYVSFTINLV  376



>gb|AFW81322.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81323.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=260

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSS
Sbjct  119  VDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSS  178

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSILE LC +++S YWK+ED+ 
Sbjct  179  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSILEELCGNAHSIYWKSEDDV  238

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             V   GG+ E HPYVSFTIN V
Sbjct  239  GVAGLGGETEAHPYVSFTINFV  260



>ref|XP_006417188.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
 gb|ESQ35541.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
Length=375

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQVRDFEHSAEAQETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP VKSEK+VRSILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPVVKSEKKVRSILERLCDSTNSLYWKSEEDA  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010476263.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTTARERGFQVRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VR ILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRPILERLCDSTNSLYWKSEEDG  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>emb|CDY19421.1| BnaC05g09300D [Brassica napus]
Length=377

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  235  ADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED 
Sbjct  295  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSGYWKSEEDA  354

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  355  GAMAGLAGDSETHPYVSFTINL  376



>ref|XP_010494723.1| PREDICTED: V-type proton ATPase subunit C [Camelina sativa]
Length=375

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTTARERGFQVRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VR ILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRPILERLCDSTNSLYWKSEEDG  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010250562.1| PREDICTED: V-type proton ATPase subunit C [Nelumbo nucifera]
Length=376

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+   RE+GFQIR+FEY+PE  E R +E+E+LM+DQET R SLLQWCYTSYGEVFSS
Sbjct  235  ADNFKTSTREKGFQIREFEYSPEAQEGRNREMERLMEDQETLRGSLLQWCYTSYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPP FL+ VL+PS+KSEK+ RSILE LCDS++S+YWK+EDEG
Sbjct  295  WMHFCAVRVFAESILRYGLPPLFLAAVLAPSIKSEKKARSILEGLCDSTHSSYWKSEDEG  354

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   G DA+ HPYVSFTIN+V
Sbjct  355  GMAGLGCDADAHPYVSFTINIV  376



>ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Elaeis 
guineensis]
Length=374

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIR+FEY+PE  ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFS+
Sbjct  233  ADNFKTSARERGFQIREFEYSPEAQESRKQELEKLLQDQENMRSSLLQWCYASYGEVFSA  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSILE L  ++NS +WK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLAAVLAPPAKSEKKVRSILEELSGNANSAFWKSEDEV  352

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
            ++   GG+AE +PYVSFTIN+V
Sbjct  353  SLAGIGGEAEAYPYVSFTINIV  374



>ref|XP_009395792.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIR+FEY+PE  ESRKQE EKL+QDQE+ R SLLQWCY SYGEVFSS
Sbjct  233  ADNFRNNAREKGFQIREFEYSPEAQESRKQEFEKLIQDQESKRRSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPP FL+VVL+PSVK+EK+VR ILE LC + NS+YWK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPQFLAVVLAPSVKNEKKVRGILEELCGNVNSSYWKSEDEV  352

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GG+AE HPYVSFTINLV
Sbjct  353  GLAGIGGEAEAHPYVSFTINLV  374



>ref|XP_010458722.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFE++ E  E+RKQELEKL++DQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTTARERGFQVRDFEHSVEAQETRKQELEKLVEDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVRVFAESI+RYGLPP+FL+ VLSP+VKSEK+VR ILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRVFAESIMRYGLPPAFLACVLSPAVKSEKKVRPILERLCDSTNSLYWKSEEDG  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>ref|XP_009148561.1| PREDICTED: V-type proton ATPase subunit C [Brassica rapa]
 emb|CDX98037.1| BnaA06g07880D [Brassica napus]
Length=375

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADN+R  ARE+GFQIRDFE++ E  E+RKQEL+KL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNYRTSAREKGFQIRDFEHSVEAQETRKQELQKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSGYWKSEEDA  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>ref|XP_002441755.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
 gb|EES15593.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
Length=377

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQIRDFEY+PE  ESRKQE+EKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQIRDFEYSPEAQESRKQEMEKLLQDQEAMRTSLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+F ESILRYGLPPSFLS VL+PS K EK+VRSILE LC + +S YWK ED+ 
Sbjct  296  WMHFCAVRIFVESILRYGLPPSFLSAVLAPSTKGEKKVRSILEELCGNVHSIYWKAEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
            AV   GG++EVHPYVSFT+N V
Sbjct  356  AVAGLGGESEVHPYVSFTVNFV  377



>ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
 sp|Q9SDS7.1|VATC_ARATH RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar H(+)-ATPase subunit C; AltName: 
Full=Vacuolar proton pump subunit C [Arabidopsis thaliana]
 gb|AAF20146.1|AF208261_1 vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAF78489.1|AC012187_9 Identical to vacuolar ATP sythase subunit C (DET3) from Arabidopsis 
thaliana gb|AF208261. ESTs gb|AA067533, gb|Z37481, gb|AA721838, 
gb|Z37180, gb|T21206 come from this gene [Arabidopsis 
thaliana]
 gb|AAG50103.1|AF334725_1 putative vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAL24354.1| Identical to vacuolar ATP sythase subunit C (DET3) [Arabidopsis 
thaliana]
 gb|AAM13333.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
 dbj|BAH30291.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28936.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
Length=375

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARE+GFQ+RDFE + E  E+RKQEL KL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRIAAREKGFQVRDFEQSVEAQETRKQELAKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRTFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDA  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>ref|XP_003518129.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN00618.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E+++SRKQELEKL++DQE+ RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSHESYDSRKQELEKLVEDQESLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFL+ VL+PSVK+EK+VRSILE L  SSNS YWKTEDEG
Sbjct  293  WMHFCAVRVFTESILRYGLPPSFLACVLAPSVKAEKKVRSILEGLSGSSNSAYWKTEDEG  352

Query  316  -AVGAFGGDAEVHPYVSFTINLV  251
              +    GDA+ HPYVSFTINLV
Sbjct  353  VGMAGLAGDADAHPYVSFTINLV  375



>ref|XP_010693540.1| PREDICTED: V-type proton ATPase subunit C [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR+KARERGFQIRDFE++PET +SRKQELEKL  DQET RS+LLQWCY+SYGEVFSS
Sbjct  233  ADNFRVKARERGFQIRDFEHDPETQDSRKQELEKLAHDQETMRSALLQWCYSSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF+ESILRYGLPP+FL+ VL+PS KSEK+VRSILE  C + NS +WK EDE 
Sbjct  293  WMHFCAVRVFSESILRYGLPPNFLACVLAPSQKSEKKVRSILERNCTAGNSVHWKAEDEV  352

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            GA+     +A+ HPYVSFTINLV
Sbjct  353  GAMAGLAAEADPHPYVSFTINLV  375



>ref|XP_004493016.1| PREDICTED: V-type proton ATPase subunit C-like [Cicer arietinum]
Length=378

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHESRKQEL+KLMQDQE+ R SLLQWCYTSYGEVFSS
Sbjct  235  ADNFRTSAREKGFQIRDFEYSPETHESRKQELDKLMQDQESLRGSLLQWCYTSYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESILRYGLPPSFL+ VL+PSVK+EK+VRSILE L DSSNS YWKT+++ 
Sbjct  295  WMHFCAVRLFAESILRYGLPPSFLACVLAPSVKAEKKVRSILEGLSDSSNSAYWKTDEDL  354

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G +    GDA+ HPYVSFTINL+
Sbjct  355  GGGMAGLAGDADTHPYVSFTINLL  378



>emb|CDY16036.1| BnaC08g40870D [Brassica napus]
Length=474

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE  RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQENLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDE  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDA  352

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+    GD+E HPYVSFTINL
Sbjct  353  GAMAGLAGDSETHPYVSFTINL  374



>ref|XP_006305100.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
 gb|EOA37998.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
Length=375

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTTAREKGFQVRDFEHSVEAQETRKQELEKLGQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE +CDS+NS YWK+E++G
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERMCDSTNSLYWKSEEDG  352

Query  316  AVGA-FGGDAEVHPYVSFTINL  254
            A  A   GD+E HPYVSFTINL
Sbjct  353  AAMAGLAGDSETHPYVSFTINL  374



>ref|XP_008808181.1| PREDICTED: V-type proton ATPase subunit C-like [Phoenix dactylifera]
Length=374

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIR+FEY+PE  ES K ELEKL+QDQE  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFKTSARERGFQIREFEYSPEAQESWKLELEKLLQDQENIRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPP FL+ VL+PS K EK+VRSILE LC + NST+WK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPLFLAAVLAPSAKGEKKVRSILEELCGNVNSTFWKSEDEV  352

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GG+AE +PYVSFTIN+V
Sbjct  353  GLAGLGGEAEAYPYVSFTINIV  374



>ref|XP_008654564.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85084.1| unknown [Zea mays]
 gb|ACG35170.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW81320.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSILE LC +++S YWK+ED+ 
Sbjct  296  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSILEELCGNAHSIYWKSEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             V   GG+ E HPYVSFTIN V
Sbjct  356  GVAGLGGETEAHPYVSFTINFV  377



>ref|XP_008775427.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Phoenix 
dactylifera]
Length=374

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIR+FEY+PE+ E+RKQELEKL+QDQE  RSSLLQWCY SYGEVFS+
Sbjct  233  ADNFKTSARERGFQIREFEYSPESQENRKQELEKLLQDQENMRSSLLQWCYASYGEVFSA  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+FAESILRYGLPP+FL+ VL+P  KSEK+VRSILE L  ++NS +WK+EDE 
Sbjct  293  WMHFCAVRIFAESILRYGLPPAFLAAVLAPPAKSEKKVRSILEELGGNANSAFWKSEDEV  352

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GG+AE +PYVSFTIN+V
Sbjct  353  GLAGIGGEAEAYPYVSFTINIV  374



>ref|XP_002441624.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
 gb|EES20054.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
Length=377

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSILE LC +++S YWK+ED+ 
Sbjct  296  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSILEELCGNAHSLYWKSEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GG+ E HPYVSFTIN V
Sbjct  356  GIAGLGGETEAHPYVSFTINFV  377



>ref|XP_006844509.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
 gb|ERN06184.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
Length=374

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARERGFQIRDFEY+PE  + R+QELEKL+QDQET   SLLQWCY SYGEVFSS
Sbjct  233  ADNFRISARERGFQIRDFEYSPEAQDKRQQELEKLLQDQETMSHSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSILE  C S NS  WK+EDEG
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLAAVLAPPTKSEKKVRSILEGHCGSRNSALWKSEDEG  352

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +    G+A+ +PYVSFTINL+
Sbjct  353  GLLGLVGEADAYPYVSFTINLI  374



>ref|XP_003567787.1| PREDICTED: V-type proton ATPase subunit C [Brachypodium distachyon]
 gb|ACU01766.1| vacuolar ATP synthetase subunit C [Brachypodium distachyon]
Length=382

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  240  VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQELMRTSLLQWCYASYSEVFSS  299

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNS-TYWKTEDE  320
            WMHFCAVRVF ESILRYGLPP+FLSVVL+PS KSEK+VR+ILE LC SSNS  YWK +D+
Sbjct  300  WMHFCAVRVFVESILRYGLPPNFLSVVLAPSTKSEKKVRNILEGLCGSSNSNNYWKQDDD  359

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
              V   GGD E HPYVSFTIN V
Sbjct  360  VGVAGLGGDTESHPYVSFTINFV  382



>gb|KEH23490.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=386

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 126/152 (83%), Gaps = 10/152 (7%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE RKQEL+KLMQDQE+ R SLLQWCY SYGEVFSS
Sbjct  235  ADNFRTSAREKGFQIRDFEYSPETHEGRKQELDKLMQDQESLRGSLLQWCYASYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsv--------vlspsvkSEKRVRSILESLCDSSNST  341
            WMHFCAVR+F+ESILRYGLPPSFL +        VL+PSVK+EK+VRSILE L DSSNS 
Sbjct  295  WMHFCAVRLFSESILRYGLPPSFLVLYSSRQEACVLAPSVKAEKKVRSILEGLSDSSNSA  354

Query  340  YWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  251
            YWKT++E   G  G  G+A+ HPYVSFTINL+
Sbjct  355  YWKTDEEVGAGMAGLAGEADTHPYVSFTINLL  386



>gb|KHN28568.1| V-type proton ATPase subunit C [Glycine soja]
Length=383

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 125/149 (84%), Gaps = 8/149 (5%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSS
Sbjct  234  ADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQERLRTSLLQWCYTSYGEVFSS  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSN------STYW  335
            WMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE L DS+N        YW
Sbjct  294  WMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSILEGLSDSTNRQVYDVRAYW  353

Query  334  KTEDEGAVGAFG--GDAEVHPYVSFTINL  254
            K EDE   G  G  GDA+ HPYVSFTINL
Sbjct  354  KNEDEVGAGMAGLAGDADGHPYVSFTINL  382



>ref|XP_006655657.1| PREDICTED: V-type proton ATPase subunit C-like [Oryza brachyantha]
Length=377

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRK+EL+KL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQVRDFEYSPEAQESRKEELDKLLQDQEAMRASLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS K EK+VRSILE LC + +S YWK+ED+ 
Sbjct  296  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSQKGEKKVRSILEELCGNVHSIYWKSEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             V   GG+ E HPYVSFTIN V
Sbjct  356  GVAGLGGETEAHPYVSFTINFV  377



>gb|ABD32569.1| V-ATPase subunit C [Medicago truncatula]
Length=382

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 125/148 (84%), Gaps = 6/148 (4%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PETHE RKQEL+KLMQDQE+ R SLLQWCY SYGEVFSS
Sbjct  235  ADNFRTSAREKGFQIRDFEYSPETHEGRKQELDKLMQDQESLRGSLLQWCYASYGEVFSS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNS----TYWKT  329
            WMHFCAVR+F+ESILRYGLPPSFL+ VL+PSVK+EK+VRSILE L DSSN      YWKT
Sbjct  295  WMHFCAVRLFSESILRYGLPPSFLACVLAPSVKAEKKVRSILEGLSDSSNRQLGIAYWKT  354

Query  328  EDEGAVGAFG--GDAEVHPYVSFTINLV  251
            ++E   G  G  G+A+ HPYVSFTINL+
Sbjct  355  DEEVGAGMAGLAGEADTHPYVSFTINLL  382



>ref|XP_010096044.1| V-type proton ATPase subunit C [Morus notabilis]
 gb|EXB62850.1| V-type proton ATPase subunit C [Morus notabilis]
Length=384

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 10/152 (7%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+ E  E+RKQELEKLM DQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQETRKQELEKLMHDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNS--------T  341
            WMHFCAVRVFAES+LRYGLPPSFLS VL+PSVK EK+VRSILE LCD++N         T
Sbjct  293  WMHFCAVRVFAESVLRYGLPPSFLSCVLAPSVKREKKVRSILEGLCDNANRQVVELLSVT  352

Query  340  YWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  251
            +WKT+DE   G  G  G+A+ HPYVSFTINLV
Sbjct  353  FWKTDDEAGGGIVGLTGEADAHPYVSFTINLV  384



>gb|EMT31457.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=259

 Score =   198 bits (503),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  117  VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSS  176

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ 
Sbjct  177  WMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDV  236

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G     GG+ E HPYVSFTIN V
Sbjct  237  GMAAGLGGETESHPYVSFTINFV  259



>gb|KGN50885.1| hypothetical protein Csa_5G312840 [Cucumis sativus]
Length=370

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+FRSSLLQW Y SY EVF S
Sbjct  227  ADNFKTSAREKGFQIREFEYSPEAQESRKQELEKLVQDQESFRSSLLQWSYASYAEVFIS  286

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  287  WMHFCAVRVFAESILRYGLPPSFLASVLAPSVKSEKKVRSILEGLCDSANSTYWKTEDEV  346

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G +   GGD++ HPYVSFTINL
Sbjct  347  GGGMAGLGGDSDAHPYVSFTINL  369



>ref|NP_001142247.1| uncharacterized protein LOC100274416 [Zea mays]
 gb|ACF87983.1| unknown [Zea mays]
 tpg|DAA59220.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=377

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+ +QE  R+SLLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLLEQEVMRTSLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+F ESILRYGLPPSFLS VL+PS K EK+VRSILE LC + +S YWK ED+ 
Sbjct  296  WMHFCAVRIFVESILRYGLPPSFLSAVLAPSTKGEKKVRSILEDLCGNVHSIYWKGEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
            AV   GG++EVHPYVSFTIN V
Sbjct  356  AVAGLGGESEVHPYVSFTINFV  377



>ref|XP_007161646.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
 gb|ESW33640.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
Length=376

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             +N+R  ARE+GFQIRDFEY+ ETHE+RKQEL+KL+QDQE  R+SLLQWC+TSYGEVFSS
Sbjct  233  VENYRTSAREKGFQIRDFEYSQETHENRKQELDKLVQDQERLRASLLQWCFTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE+L DS+NS YWK EDE 
Sbjct  293  WMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSILEALSDSTNSAYWKIEDEV  352

Query  316  AVGAFG--GDAEVHPYVSFTINL  254
              G  G  GD++ HPYVSFTINL
Sbjct  353  GAGMAGLAGDSDAHPYVSFTINL  375



>ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus]
 ref|XP_004166274.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus]
Length=376

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+FRSSLLQW Y SY EVF S
Sbjct  233  ADNFKTSAREKGFQIREFEYSPEAQESRKQELEKLVQDQESFRSSLLQWSYASYAEVFIS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLASVLAPSVKSEKKVRSILEGLCDSANSTYWKTEDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G +   GGD++ HPYVSFTINL
Sbjct  353  GGGMAGLGGDSDAHPYVSFTINL  375



>gb|KHG11234.1| V-type proton ATPase subunit C -like protein [Gossypium arboreum]
Length=328

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 119/142 (84%), Gaps = 8/142 (6%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSS
Sbjct  193  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSS  252

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSILE        TYWKTEDE 
Sbjct  253  WMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSILE-------GTYWKTEDEG  305

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            GA+   GGD + HPYVSFTIN+
Sbjct  306  GAMAGLGGDTDAHPYVSFTINI  327



>ref|XP_008463120.1| PREDICTED: V-type proton ATPase subunit C [Cucumis melo]
Length=376

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+FRSSLLQW Y SY EVF S
Sbjct  233  ADNFKTSAREKGFQIREFEYSPEAQESRKQELEKLVQDQESFRSSLLQWSYASYAEVFIS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSILE LCDS+NSTYWKTEDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLAFVLAPSVKSEKKVRSILEGLCDSANSTYWKTEDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G +   GGD++ HPYVSFTINL
Sbjct  353  GGGMAGLGGDSDAHPYVSFTINL  375



>gb|ABG23314.1| vacuolar proton-ATPase C subunit [Triticum aestivum]
Length=380

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  238  VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSS  297

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ 
Sbjct  298  WMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDV  357

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G     GG+AE HPYVSFTIN V
Sbjct  358  GMAAGLGGEAESHPYVSFTINFV  380



>ref|NP_001056500.1| Os05g0593100 [Oryza sativa Japonica Group]
 gb|AAT44305.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
 dbj|BAF18414.1| Os05g0593100 [Oryza sativa Japonica Group]
 dbj|BAG88149.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94456.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79794.1| hypothetical protein OsI_21221 [Oryza sativa Indica Group]
 gb|EEE64903.1| hypothetical protein OsJ_19763 [Oryza sativa Japonica Group]
Length=377

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+ E  ESRK+ELEKLMQDQE  R+SLLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQVRDFEYSSEAQESRKEELEKLMQDQEAMRASLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS K EK+VRSILE LC + +S YWK+ED+ 
Sbjct  296  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSQKGEKKVRSILEELCGNVHSIYWKSEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             V   GG+ E HPYVSFTIN +
Sbjct  356  GVAGLGGETEAHPYVSFTINFI  377



>ref|XP_002512862.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
 gb|EEF49365.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
Length=376

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  E+RKQELE+LMQDQE+FRSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSPEAQENRKQELEQLMQDQESFRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVF ESILRYGLPP+FL+ VL+PSVK EK+VRSILE L DS+NSTYWK+EDE 
Sbjct  293  WMHFCAVRVFTESILRYGLPPAFLACVLAPSVKGEKKVRSILEGLSDSANSTYWKSEDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G + A GGDA+ HPYVSFTINL
Sbjct  353  GGGLAALGGDADAHPYVSFTINL  375



>ref|XP_010556324.1| PREDICTED: V-type proton ATPase subunit C [Tarenaya hassleriana]
Length=377

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSPEAQESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT---E  326
            WMHFCAVR+FAESI+RYGLPPSFLS VL+P+ K EK+VRSILE LCD++NSTYWK     
Sbjct  293  WMHFCAVRIFAESIMRYGLPPSFLSCVLAPTGKGEKKVRSILEGLCDAANSTYWKMEEEG  352

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
              G +   GGDAE HPYVSFTINL
Sbjct  353  GGGGMAGLGGDAEGHPYVSFTINL  376



>gb|EMS67397.1| V-type proton ATPase subunit C [Triticum urartu]
Length=374

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  232  VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSS  291

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ 
Sbjct  292  WMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDV  351

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G     GG+ E HPYVSFTIN V
Sbjct  352  GMAAGLGGETESHPYVSFTINFV  374



>ref|XP_006369829.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
 gb|ERP66398.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
Length=376

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  ESRKQELE+L++DQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNAREKGFQIRDFEYSPEAQESRKQELERLVRDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VLSP+ KSEK+VRSILE  CD+SNST+WK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEM  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G +   GG+A+ +PY SFTINLV
Sbjct  353  GGGIFGLGGEADTYPYPSFTINLV  376



>gb|KJB40646.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=336

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = -3

Query  640  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  461
            + IRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAE
Sbjct  206  YVIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAE  265

Query  460  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEV  284
            SILRYGLPPSFL+ VLSPS K EK+VRSILE LCDS+NSTYWKTEDE GA+   GGDA+ 
Sbjct  266  SILRYGLPPSFLACVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEGGAMAGLGGDADT  325

Query  283  HPYVSFTINL  254
            +PYVSFTIN+
Sbjct  326  YPYVSFTINI  335



>gb|ACT34062.1| vacuolar ATP synthetase subunit C [Aegilops tauschii]
Length=380

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  238  VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSS  297

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ 
Sbjct  298  WMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDV  357

Query  319  GAVGAFGGDAEVHPYVSFTINLV  251
            G     GG+ E HPYVSFTIN V
Sbjct  358  GMAAGLGGETESHPYVSFTINFV  380



>ref|XP_010554131.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Tarenaya 
hassleriana]
Length=377

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ RDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQTRDFEYSPEAQESRKQELEKLVQDQESMRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESILRYGLPP+FLS VL+PS K EK+VRSILE  CD++NSTYWK E+E 
Sbjct  293  WMHFCAVRIFAESILRYGLPPAFLSCVLAPSTKGEKKVRSILEGSCDAANSTYWKVEEEA  352

Query  319  --GAVGAFGGDAEVHPYVSFTINL  254
              G  G  GGD E +PYV FTINL
Sbjct  353  GGGMAGFGGGDTEAYPYVCFTINL  376



>ref|XP_010528136.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=376

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSAREKGFQIRDFEYSPEAQESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT--ED  323
            WMHFCAVR+FAESILRYGLPPSFLS VL+PS K EK+VRSI+E L DS+NS YWK   E 
Sbjct  293  WMHFCAVRIFAESILRYGLPPSFLSCVLAPSSKGEKKVRSIIEGLSDSANSKYWKPEEEG  352

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
             G  G  GGDA+ HPYVSFTINL
Sbjct  353  GGMGGLGGGDADAHPYVSFTINL  375



>ref|NP_001147632.1| LOC100281241 [Zea mays]
 gb|ACF83479.1| unknown [Zea mays]
 gb|ACG28176.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW79360.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQIRDFEY+PE  ESR QE+EKL++DQE  R++LLQWCY SY EVFSS
Sbjct  236  VDNFKVRAREKGFQIRDFEYSPEAQESRMQEMEKLLRDQEAMRTTLLQWCYASYSEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSIL+ L   ++S YWK+ED+ 
Sbjct  296  WMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSILDELSGDAHSLYWKSEDDV  355

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             V   GG+ E HPYVSFTIN V
Sbjct  356  GVAGLGGETEAHPYVSFTINFV  377



>ref|XP_011001967.1| PREDICTED: V-type proton ATPase subunit C [Populus euphratica]
Length=376

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  +RE+GFQIRD EY+ E  E+RKQELE+++QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSSREKGFQIRDVEYSSEAQENRKQELERIVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSF++ VLSPS+KSEK+VRSIL+ L DSSNSTYWK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFMACVLSPSLKSEKKVRSILDGLGDSSNSTYWKSEDEL  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G +   GGDA+ HPYVS TINLV
Sbjct  353  VGGMMGLGGDADTHPYVSLTINLV  376



>emb|CDX71966.1| BnaC08g29080D [Brassica napus]
Length=378

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDA  352

Query  319  ---GAVGAFGGDAEVHPYVSFTINL  254
               GA+    GD+E HPYVSFTINL
Sbjct  353  GAGGAMAGLAGDSETHPYVSFTINL  377



>ref|XP_009118052.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=378

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDA  352

Query  319  ---GAVGAFGGDAEVHPYVSFTINL  254
               GA+    GD+E HPYVSFTINL
Sbjct  353  GAGGAMAGLAGDSETHPYVSFTINL  377



>gb|KFK43549.1| hypothetical protein AALP_AA1G141200 [Arabis alpina]
Length=376

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARE+G+Q+RDFE++ E  E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNFRITAREKGYQVRDFEHSVEAQETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE +CDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERMCDSTNSLYWKSEEDA  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
              A+    GD+E HPYVSFTINL
Sbjct  353  GAAMAGLAGDSETHPYVSFTINL  375



>emb|CDY21070.1| BnaA08g24550D [Brassica napus]
Length=376

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDG  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
              A+    GD+E HPYVSFTINL
Sbjct  353  GAAIAGLAGDSETHPYVSFTINL  375



>emb|CDY66539.1| BnaCnng51300D [Brassica napus]
Length=376

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDG  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
              A+    GD+E HPYVSFTINL
Sbjct  353  GAAMAGLAGDSETHPYVSFTINL  375



>ref|XP_009110617.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=376

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSS
Sbjct  233  ADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDG  352

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
              A+    GD+E HPYVSFTINL
Sbjct  353  GAAMAGLAGDSETHPYVSFTINL  375



>ref|XP_010554130.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Tarenaya 
hassleriana]
Length=426

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ RDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  282  ADNFRTSAREKGFQTRDFEYSPEAQESRKQELEKLVQDQESMRSSLLQWCYTSYGEVFSS  341

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESILRYGLPP+FLS VL+PS K EK+VRSILE  CD++NSTYWK E+E 
Sbjct  342  WMHFCAVRIFAESILRYGLPPAFLSCVLAPSTKGEKKVRSILEGSCDAANSTYWKVEEEA  401

Query  319  --GAVGAFGGDAEVHPYVSFTINL  254
              G  G  GGD E +PYV FTINL
Sbjct  402  GGGMAGFGGGDTEAYPYVCFTINL  425



>ref|XP_002889973.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66232.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
Length=378

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRISAREKGFQVRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE +CDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERMCDSTNSLYWKSEEDA  352

Query  319  ---GAVGAFGGDAEVHPYVSFTINL  254
               GA+    GD+E +PYVSFTINL
Sbjct  353  GAGGAMAGLAGDSETYPYVSFTINL  377



>ref|XP_006373110.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50907.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=376

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  +R++GFQIRD E++ E  E+RKQELE+++QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSSRDKGFQIRDIEHSSEAQENRKQELERIVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPS+K EK+VRSIL+ L DSSNSTYWK+EDE 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLSPSLKGEKKVRSILDGLGDSSNSTYWKSEDEV  352

Query  319  -GAVGAFGGDAEVHPYVSFTINLV  251
             G +   GGDA+ HPYVSFTINLV
Sbjct  353  VGGMMGLGGDADTHPYVSFTINLV  376



>emb|CDY26596.1| BnaA09g46810D [Brassica napus]
Length=614

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 127/145 (88%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSILE LCDS+NS YWK+E++ 
Sbjct  293  WMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDA  352

Query  319  ---GAVGAFGGDAEVHPYVSFTINL  254
               GA+    GD+E HPYVSFTINL
Sbjct  353  GAGGAMAGLAGDSETHPYVSFTINL  377



>gb|ADE77882.1| unknown [Picea sitchensis]
Length=379

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            AD+FR+ ARE+GFQ+RDFEY+PE  E R+++LE+L+ DQET R  L QWCY SYGEVFSS
Sbjct  236  ADSFRVSAREKGFQVRDFEYDPEAQERRREDLERLISDQETMRGGLQQWCYASYGEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMH CA+R+F ESILRYGLPPSFL+ VL+PS KSEK+VRSILE L   SN+++WK ED+ 
Sbjct  296  WMHLCAIRLFTESILRYGLPPSFLAAVLAPSSKSEKKVRSILERLSGGSNNSFWKAEDDV  355

Query  319  GAVGAFGGDAEVHPYVSFTINL  254
            G  G  GG+ EV+PYVSFTINL
Sbjct  356  GIAGLAGGETEVYPYVSFTINL  377



>ref|XP_008775428.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Phoenix 
dactylifera]
Length=335

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  640  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  461
            + IR+FEY+PE+ E+RKQELEKL+QDQE  RSSLLQWCY SYGEVFS+WMHFCAVR+FAE
Sbjct  206  YVIREFEYSPESQENRKQELEKLLQDQENMRSSLLQWCYASYGEVFSAWMHFCAVRIFAE  265

Query  460  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVH  281
            SILRYGLPP+FL+ VL+P  KSEK+VRSILE L  ++NS +WK+EDE  +   GG+AE +
Sbjct  266  SILRYGLPPAFLAAVLAPPAKSEKKVRSILEELGGNANSAFWKSEDEVGLAGIGGEAEAY  325

Query  280  PYVSFTINLV  251
            PYVSFTIN+V
Sbjct  326  PYVSFTINIV  335



>ref|XP_010528980.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=169

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -3

Query  640  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  461
            FQIRDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAE
Sbjct  38   FQIRDFEYSPEAQESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAE  97

Query  460  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT--EDEGAVGAFGGDAE  287
            SILRYGLPPSFLS VL+PS K EK+VRSI+E L DS+NS YWK   E  G  G  GGDA+
Sbjct  98   SILRYGLPPSFLSCVLAPSSKGEKKVRSIIEGLSDSANSKYWKPEEEGGGMGGLGGGDAD  157

Query  286  VHPYVSFTINL  254
             HPYVSFTINL
Sbjct  158  AHPYVSFTINL  168



>gb|KJB76319.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=349

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTY  338
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSILE LCDS+N  Y
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSILEGLCDSANRQY  345



>gb|KJB76320.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=345

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSS
Sbjct  233  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSN  347
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSILE LCDS+N
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSILEGLCDSAN  342



>gb|AGJ98217.1| DET3, partial [Petunia x hybrida]
Length=268

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            DADNF+IKARERGFQIRDFEY+PET ESRK ELEKLMQDQE FRSS+ QWCYTSYGEVFS
Sbjct  166  DADNFKIKARERGFQIRDFEYDPETQESRKHELEKLMQDQEIFRSSVXQWCYTSYGEVFS  225

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  371
            SWMHFCAVR+FAESILRYGLPPSFLSVVL+PS KSEK+VRSIL
Sbjct  226  SWMHFCAVRIFAESILRYGLPPSFLSVVLAPSTKSEKKVRSIL  268



>ref|XP_006373109.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50906.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=366

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 116/142 (82%), Gaps = 8/142 (6%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  +R++GFQIRD E++ E  E+RKQELE+++QDQE+ RSSLLQWCYTSYGEVFSS
Sbjct  233  ADNFRTSSRDKGFQIRDIEHSSEAQENRKQELERIVQDQESLRSSLLQWCYTSYGEVFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFCAVRVFAESILRYGLPPSFL+ VLSPS+K EK+VRSIL+ L D+        E  G
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLACVLSPSLKGEKKVRSILDGLGDN--------EVVG  344

Query  316  AVGAFGGDAEVHPYVSFTINLV  251
             +   GGDA+ HPYVSFTINLV
Sbjct  345  GMMGLGGDADTHPYVSFTINLV  366



>gb|KCW64312.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=345

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEYN E  E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSS
Sbjct  236  ADNFRTTARERGFQIRDFEYNLEAQEGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSS  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSN  347
            WMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK EK+VRSILE LCD+++
Sbjct  296  WMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEGLCDNTH  345



>gb|AAO72561.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
Length=408

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF+++ARE+GFQ+RDFEY+ E  ESRK+ELEKLMQDQE  R+SLLQWCY SY EVFSS
Sbjct  276  VDNFKVRAREKGFQVRDFEYSSEAQESRKEELEKLMQDQEAMRASLLQWCYASYSEVFSS  335

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMHFC VRVF ESILRYGLPPSFLS VL+PS K EK+VRSIL +   + +S YWK+ED+ 
Sbjct  336  WMHFCLVRVFVESILRYGLPPSFLSAVLAPSQKGEKKVRSILRNSVGNVHSIYWKSEDDV  395

Query  316  AVGAFGGDA  290
             V   GG A
Sbjct  396  GVAGLGGKA  404



>ref|XP_001773067.1| predicted protein [Physcomitrella patens]
 gb|EDQ62107.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGF-QIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            ADNF+   RERGF Q+RDFE +PE   S+++E+ KL +DQ+  R SL QWCY  YGEVFS
Sbjct  235  ADNFKTAGRERGFLQVRDFELDPEGQSSKQEEMAKLQKDQDELRQSLQQWCYAVYGEVFS  294

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
            +WMH CA+R+F ESILRYGLPP FL+ VL+PS K+EK+VR + E L   +NS +W +ED+
Sbjct  295  AWMHVCAIRLFTESILRYGLPPKFLAAVLAPSSKTEKKVRGVCEKLSSGTNSLFWHSEDD  354

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G +G  GGD+EVHPYVS T+NL
Sbjct  355  AGMMGLAGGDSEVHPYVSLTVNL  377



>ref|XP_010939292.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQIR+FEY+PE  ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFS+
Sbjct  233  ADNFKTSARERGFQIREFEYSPEAQESRKQELEKLLQDQENMRSSLLQWCYASYGEVFSA  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC  359
            WMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSILE L 
Sbjct  293  WMHFCAVRVFAESILRYGLPPSFLAAVLAPPAKSEKKVRSILEELS  338



>gb|AFA36545.1| vacuolar ATP synthetase subunit C, partial [Lolium perenne]
Length=184

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSS
Sbjct  90   VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQELMRTSLLQWCYASYSEVFSS  149

Query  496  WMHFCAVRVFAESILRYG  443
            WMHFCAVRVF ESILRYG
Sbjct  150  WMHFCAVRVFVESILRYG  167



>ref|XP_002980160.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
 ref|XP_002992900.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ05989.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ19030.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
Length=380

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNF+  ARERGFQ+RD E++PE  + R+QE +KL ++ ++ RSSL QWC  SYGEVFS+
Sbjct  236  ADNFKSAARERGFQVRDIEFDPEGQQQRRQEQDKLSRELDSLRSSLQQWCCASYGEVFSA  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            WMH CA+R+FAESILRYGLPP FL+ V++PS ++EK+VRS+LE LC++ NS +WK++++ 
Sbjct  296  WMHICAIRIFAESILRYGLPPKFLAAVMAPSQRNEKKVRSMLEGLCNAPNSGFWKSDEDG  355

Query  319  -GAVGAFGGDAEVHPYVSFTINL  254
             G  G  GG+ E HPYVSFT+NL
Sbjct  356  GGVAGIVGGEVEAHPYVSFTLNL  378



>gb|EMT09400.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=377

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 107/141 (76%), Gaps = 8/141 (6%)
 Frame = -3

Query  670  NFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWM  491
            NF+  A+E+GF IRDF Y+PE  ES K +LEKL+QD+E  R+SLLQ  Y  Y EVFSSWM
Sbjct  244  NFKAHAQEKGFLIRDFVYSPEAQES-KDDLEKLLQDEEAMRTSLLQLLYARYSEVFSSWM  302

Query  490  HFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNST-YWKTEDEGA  314
            H CAV VFAESILRYGL PS L V+L+PS++SEK+VR ILE  C ++NS  +WK++D+G 
Sbjct  303  HICAVFVFAESILRYGLSPSILCVILAPSMESEKKVRDILEEHCGNANSNDFWKSDDDG-  361

Query  313  VGAFGGDAEVHPYVSFTINLV  251
                GG  E+HPYVS T+N+V
Sbjct  362  ---LGG--EIHPYVSSTMNVV  377



>ref|XP_010068642.1| PREDICTED: V-type proton ATPase subunit C-like [Eucalyptus grandis]
Length=329

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  634  IRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESI  455
            IRDFEYN E  E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESI
Sbjct  225  IRDFEYNLEAQEGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESI  284

Query  454  LRYGlppsflsvvlspsvkSEKRVRSILESLCDSSN  347
            LRYGLPPSFL+ VL+PSVK EK+VRSILE LCD+++
Sbjct  285  LRYGLPPSFLACVLAPSVKGEKKVRSILEGLCDNTH  320



>ref|XP_005651974.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27430.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
Length=372

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            AD+F+  AR +G+Q+RD+E++ E  E++ +  + L  + ++ RS L QW  ++YGE FS+
Sbjct  230  ADSFKAAARSKGYQVRDYEFDQELQENQSEAAKTLKANADSKRSQLEQWSASAYGEAFSA  289

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H CA+R+F ESILRYGLPP FL+V+L P+ K+  ++R +L SL  SS ++ +   + G
Sbjct  290  WIHICAIRLFVESILRYGLPPKFLAVLLKPNQKNTTKLRKLLASLFGSSGTSQYFDGEAG  349

Query  316  AVGAFGGDAEVHPYVSFTINL  254
            A G   G++E++PYVSFT+++
Sbjct  350  ATGGLAGESEMYPYVSFTVSV  370



>gb|ADI46924.1| ATPvC1m [Volvox carteri f. nagariensis]
Length=376

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 92/142 (65%), Gaps = 4/142 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNP--ETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVF  503
             D+F+  AR +G+Q+R  EYNP  E  E    + E+L +D E  R+++  WC T+YGEVF
Sbjct  229  VDDFKAAARIKGYQVR--EYNPPAEGMELSLMQTEQLKRDVEQRRAAVEHWCKTAYGEVF  286

Query  502  SSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTED  323
            S +MH   VR+F ESILRYGLPP+F + VL P  K+E R+R+ LE+     N+ YWK +D
Sbjct  287  SCYMHILVVRLFVESILRYGLPPTFQAAVLQPQEKAESRLRAELEATFGGGNTHYWKDDD  346

Query  322  EGAVGAFGGDAEVHPYVSFTIN  257
                    GDA++HPYVS TIN
Sbjct  347  TILGNGLIGDADLHPYVSLTIN  368



>gb|KCW64318.1| hypothetical protein EUGRSUZ_G01948 [Eucalyptus grandis]
Length=84

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  571  MQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSE  392
            M+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK E
Sbjct  1    MRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGE  60

Query  391  KRVRSILESLCDSSN  347
            K+VRSILE LCD+++
Sbjct  61   KKVRSILEGLCDNTH  75



>ref|XP_002954527.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
 gb|ADI46857.1| ATPvC1f [Volvox carteri f. nagariensis]
 gb|EFJ44420.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
Length=376

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 96/143 (67%), Gaps = 6/143 (4%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNP--ETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            D+F+  AR +G+Q+R  EYNP  E  E    ++E+L  D E  ++ + QWC T+Y EVFS
Sbjct  230  DDFKAAARTKGYQVR--EYNPPAEGAELSLAQIEQLKHDMEQKKTDVEQWCKTAYSEVFS  287

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE  320
             +MH   V++F ESILRYGLPP+F + V+ P  K+E R+R+ LE+   S  + YW+ +D 
Sbjct  288  CYMHMLVVQLFVESILRYGLPPNFQAAVVRPQDKAEGRLRAELEATFGSGKTHYWR-DDG  346

Query  319  GAVGA-FGGDAEVHPYVSFTINL  254
             ++GA   GDAE+HPYVS T+N+
Sbjct  347  SSLGAGLVGDAELHPYVSLTVNM  369



>gb|KDO47363.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47364.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47365.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=303

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFRI ARE+GFQIRDFEY+ E  ESR QELEKL+ DQE+ RSSLLQWCYTSYGEV S+
Sbjct  233  ADNFRIAAREKGFQIRDFEYSSEAQESRNQELEKLVHDQESLRSSLLQWCYTSYGEVCST  292

Query  496  WMH  488
            ++H
Sbjct  293  FLH  295



>gb|KJB40647.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=323

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGE+  +
Sbjct  233  ADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGELLDA  292

Query  496  WM  491
            ++
Sbjct  293  FL  294



>ref|XP_010663792.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Vitis vinifera]
Length=319

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
            ADNF+  ARERGFQIRDFEY+PET ESRKQELEKLM DQ+T R+SLLQWCYTSYGE F+
Sbjct  233  ADNFKTSARERGFQIRDFEYSPETQESRKQELEKLMLDQDTIRTSLLQWCYTSYGEEFA  291



>ref|XP_001696429.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
 gb|EDP08406.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
Length=373

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 86/139 (62%), Gaps = 0/139 (0%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+  AR +G+Q+R++    E  E    + E+L +D E  +++L QWC T+YGE FS +
Sbjct  230  DDFKAAARSKGYQVREYHAPTEGSELTTAQAEQLKKDVEQKKNALEQWCKTAYGEAFSCY  289

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            MH   VR+F ESILRYGLPPSF + V+ P  KSE R+R  LE+      + YWK +    
Sbjct  290  MHVLVVRLFVESILRYGLPPSFQAAVVRPQDKSEARLRLELETTFGGGKAHYWKDDGSNL  349

Query  313  VGAFGGDAEVHPYVSFTIN  257
                 GD E++PYVS T++
Sbjct  350  GAGLAGDTELYPYVSLTLS  368



>ref|XP_005847214.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
 gb|EFN55112.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
Length=367

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 89/141 (63%), Gaps = 9/141 (6%)
 Frame = -3

Query  673  DNFRIKARERGFQ-IRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            DNF+  AR +GFQ ++D + +PE   S + EL ++  + E  R SL QWC TSYGE FSS
Sbjct  233  DNFKTAARGKGFQQVKDLKVDPEAARSSEAELARVRTEVEQRRVSLEQWCITSYGEAFSS  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H CAVR+F ESILRYGLPP FLSV++ P+ K   ++R ++      + S ++  E   
Sbjct  293  WIHVCAVRLFVESILRYGLPPKFLSVLMRPNAKYTAKLRKLMAHSFSHTGSDHFSAE---  349

Query  316  AVGAFGGDAEVHPYVSFTINL  254
                 G   ++ PYVSFT+N+
Sbjct  350  -----GAGEDMFPYVSFTLNI  365



>gb|KJB76317.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=323

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+  RSSLLQWCY SYGE+  +
Sbjct  233  ADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDMLRSSLLQWCYASYGELLDA  292

Query  496  WMHFCAVRV  470
             +  C  R+
Sbjct  293  LL--CCTRL  299



>ref|XP_002503957.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO65215.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=375

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 6/140 (4%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F   ARE  FQ+R+F  + E  +++  E   L +D +  R+S+ QWC TSYGE F +W
Sbjct  242  DAFNTAARENSFQVREFSLDTEAVQAKIAERNDLERDIKERRTSMFQWCQTSYGEAFGAW  301

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H CA+R+F ESILRYGLPPSF + V+ P  +SEK++R IL +      S++W   D+  
Sbjct  302  VHVCAIRLFVESILRYGLPPSFQACVMKPQKRSEKKLRGILANTFGQGASSHWSNSDDDK  361

Query  313  VGAFGGDAEVHPYVSFTINL  254
                    E  PYVSF+I +
Sbjct  362  ------GEEAFPYVSFSIEI  375



>gb|EPS62747.1| hypothetical protein M569_12043, partial [Genlisea aurea]
Length=310

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  679  DADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEV  506
            DADNFR KARER +QIRDFEYN ET ESRKQELEKL+QDQ+  R+ LLQWCY SYGEV
Sbjct  253  DADNFRTKARERNYQIRDFEYNSETQESRKQELEKLVQDQDALRTGLLQWCYASYGEV  310



>ref|XP_008341246.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C-like [Malus domestica]
Length=299

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVF  503
            ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE  R SLLQWCYTSYGEV 
Sbjct  233  ADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQENLRGSLLQWCYTSYGEVI  290



>sp|Q9SCB9.1|VATC_HORVU RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Hordeum 
vulgare]
 emb|CAB65127.1| vacuolar H+-ATPase subunit C [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQW-CYTSYGEVFS  500
             DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE  R+S +      +   VFS
Sbjct  238  VDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEVMRTSPIAMGAMLATVRVFS  297

Query  499  SWMHF-CAVRVFAESILRYG  443
            SW  F  AVRVF ESILRYG
Sbjct  298  SWDAFSSAVRVFVESILRYG  317



>ref|XP_001756840.1| predicted protein [Physcomitrella patens]
 gb|EDQ78437.1| predicted protein [Physcomitrella patens]
Length=395

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 93/158 (59%), Gaps = 17/158 (11%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPET-HESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  500
             ++F   A  + FQ+R    +P   H + + ELE   ++    R +LL WCY ++GEVFS
Sbjct  232  VESFTNAAGLKNFQVRTLTRDPNGGHFAYRAELEHWQEEHGKKRHALLHWCYATFGEVFS  291

Query  499  SWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSS----------  350
            +W+H CA+R+F ES+LRYGLPP+FL+VVL+P  K+E +V  +LE     +          
Sbjct  292  AWVHLCAIRIFVESVLRYGLPPAFLAVVLAPRQKNESKVCRMLEHFSGGTMRWVTVNHSF  351

Query  349  -----NSTYWKTEDEGAVGAFGGDA-EVHPYVSFTINL  254
                 +  +W TE++ +V +  GD  E HPYVS T+N+
Sbjct  352  HVKIGSGKFWATEEDPSVASLAGDGIESHPYVSLTLNI  389



>emb|CCD60515.1| subfamily S1B unassigned peptidase (S01 family) [Schistosoma 
mansoni]
Length=330

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+F+ +ARE  F +RDF Y+ +  E  + EL KL  D++   + L +W   ++GE FS+
Sbjct  182  TDDFKTQAREFRFVVRDFTYDEKKIEESRNELSKLESDKKRQFAPLFRWLKVNFGEAFSA  241

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
             +H  A+RVF ES+LRYGLP  F +++L P+ K +K++R IL+ L    D S+S+    E
Sbjct  242  MVHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDILKQLYNHLDGSSSSSVLDE  301

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D   VG FG  ++  PYVSF + L
Sbjct  302  DMN-VGGFGTSSDYFPYVSFKVEL  324



>ref|XP_011399399.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
 gb|KFM26467.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
Length=374

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 85/140 (61%), Gaps = 7/140 (5%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+  AR +G+Q ++   + E+ ++ ++ LEKL    E  RS    WC TSY E FS+W
Sbjct  239  DDFKAAARAKGYQAKEITSDAESQKANEEGLEKLRAAVEVKRSEFEAWCLTSYSEAFSAW  298

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  AVR+F ESILRYGLPP FL V++ P+ K+  ++R +L S        ++  E    
Sbjct  299  IHILAVRLFVESILRYGLPPQFLPVLMRPNPKAVAKLRKLLASKYSGVGGQFFSNES---  355

Query  313  VGAFGGDAEVHPYVSFTINL  254
                G D+++ PYVSFT+N+
Sbjct  356  ----GADSDLFPYVSFTLNI  371



>ref|XP_009051892.1| hypothetical protein LOTGIDRAFT_206255 [Lottia gigantea]
 gb|ESO97287.1| hypothetical protein LOTGIDRAFT_206255 [Lottia gigantea]
Length=383

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F+   RE  F +RDF Y+ E  +S K EL KL  D++     L++W   ++GE F++
Sbjct  235  VDEFKHHCRENKFSVRDFTYSEEEIQSGKTELTKLEADKKKQFGPLVKWLKVNFGECFAA  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL-CDSSNSTYWKTEDE  320
            W+H  A+RVF ES+LRYGLP +F ++V+ PS +S KR+R +L+ L     NS   +  DE
Sbjct  295  WLHVKALRVFVESVLRYGLPVNFQAMVVQPSKRSTKRLRDVLKQLYSHLDNSALQQGTDE  354

Query  319  GAVGAFG-GDAEVHPYVSFTINL  254
              +   G G +E +PYVS+ + L
Sbjct  355  VDIPGIGLGGSEYYPYVSYKMTL  377



>ref|XP_001814187.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Tribolium 
castaneum]
 ref|XP_008195427.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Tribolium 
castaneum]
Length=386

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 86/142 (61%), Gaps = 4/142 (3%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARER F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  237  FKLHARERKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  296

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEG  317
              A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L  L    DSS +      D  
Sbjct  297  VKALRVFVESVLRYGLPVNFQAILIHPNKKTMKRLRDVLNQLYGHLDSSAAISGSNADSV  356

Query  316  AVGAFG-GDAEVHPYVSFTINL  254
             +   G G +E +PYV + IN+
Sbjct  357  DIPGLGFGQSEYYPYVYYKINV  378



>gb|KJB40645.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=387

 Score = 83.2 bits (204),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  640  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEV  506
             QIRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEV
Sbjct  296  IQIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGEV  340


 Score = 37.0 bits (84),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -1

Query  510  RFSAPGCTFVLYVSLLKAF  454
            RFSAPGC FVLYVSL +AF
Sbjct  369  RFSAPGCIFVLYVSLQRAF  387



>ref|XP_008195426.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Tribolium 
castaneum]
Length=401

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 86/142 (61%), Gaps = 4/142 (3%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARER F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  252  FKLHARERKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  311

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEG  317
              A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L  L    DSS +      D  
Sbjct  312  VKALRVFVESVLRYGLPVNFQAILIHPNKKTMKRLRDVLNQLYGHLDSSAAISGSNADSV  371

Query  316  AVGAFG-GDAEVHPYVSFTINL  254
             +   G G +E +PYV + IN+
Sbjct  372  DIPGLGFGQSEYYPYVYYKINV  393



>ref|XP_009012372.1| hypothetical protein HELRODRAFT_156435 [Helobdella robusta]
 gb|ESO09279.1| hypothetical protein HELRODRAFT_156435 [Helobdella robusta]
Length=400

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             + F++K RE  F +RDFEYN +  E  K+E+ KL  D+      L++W  T++ E FS 
Sbjct  249  VEEFKLKCRENKFVVRDFEYNEQEMEDGKKEIMKLNTDKAKQEGPLIRWLKTNFTETFSG  308

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES---LCDSSNSTYWKTE  326
            W+H  A+R F ESILRYGLP +F ++V++P  ++ K+++ +L       D+S +   KTE
Sbjct  309  WLHVKALRTFIESILRYGLPVNFQAMVIAPPKRNMKKIKELLNQHYLHLDASGTYDAKTE  368

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
             +   G      E +PYV F INL
Sbjct  369  MDDIPGFTMSSVEYYPYVYFKINL  392



>gb|EFA06700.1| hypothetical protein TcasGA2_TC009631 [Tribolium castaneum]
Length=444

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 86/142 (61%), Gaps = 4/142 (3%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARER F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  295  FKLHARERKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  354

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEG  317
              A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L  L    DSS +      D  
Sbjct  355  VKALRVFVESVLRYGLPVNFQAILIHPNKKTMKRLRDVLNQLYGHLDSSAAISGSNADSV  414

Query  316  AVGAFG-GDAEVHPYVSFTINL  254
             +   G G +E +PYV + IN+
Sbjct  415  DIPGLGFGQSEYYPYVYYKINV  436



>gb|KFB48532.1| AGAP005845-PA-like protein [Anopheles sinensis]
Length=385

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 87/145 (60%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARER F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  234  VDEFKLHARERKFVVREFVYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L+ L    D S S+     
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAILIHPNKKSTKRLRDVLQQLYGHLDGSGSSAGGNA  353

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G +E  PYV + +N+
Sbjct  354  DNVDIPGLGFGQSEYFPYVYYKLNI  378



>ref|XP_006012217.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Latimeria chalumnae]
 ref|XP_006012218.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Latimeria chalumnae]
Length=381

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++KARE  F +R+F +N +  +S K+EL +L  D++     LL+W   ++ E F +
Sbjct  233  VDEFKVKARENKFMVREFTFNEQELQSEKEELTRLAADKKQQYGPLLRWLKVNFSEAFIA  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS  R+R +L +L    D + +++  T+
Sbjct  293  WIHLKALRVFVESVLRYGLPVNFQAMLLQPNKKSINRLRDVLNALYKHLDGAAASFSDTK  352

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
             +   G   G+ E +PYV F I+L
Sbjct  353  IDIP-GLNVGNQEYYPYVYFRIDL  375



>gb|KDR10550.1| V-type proton ATPase subunit C [Zootermopsis nevadensis]
Length=385

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  234  VDEFKLHAREKKFVVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L  L    DSS      + 
Sbjct  294  WVHVKALRVFVESVLRYGLPVNFQAMLLHPNKKNTKRLRDVLNQLYGHLDSSAVQGSASH  353

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G +E  PYV + IN+
Sbjct  354  DSVDIPGLGFGQSEYFPYVYYKINV  378



>emb|CAX70572.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
 emb|CAX70573.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
Length=347

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 89/143 (62%), Gaps = 4/143 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ +ARE  F +RDF Y+ +  E  + EL KL  D++   + L +W   ++GE FS+ 
Sbjct  200  DDFKTQAREHRFVVRDFIYDEKKIEEGRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAM  259

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP  F +++L P+ K +K++R +L+ L    D S+S+    ED
Sbjct  260  VHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDVLKQLYSHLDGSSSSSIIDED  319

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
               VG FG  ++  PYVSF + L
Sbjct  320  VN-VGNFGASSDYFPYVSFKVEL  341



>ref|XP_007513767.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
 emb|CCO16292.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
Length=433

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 92/152 (61%), Gaps = 11/152 (7%)
 Frame = -3

Query  676  ADNFRIKARER--GFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVF  503
             D+F+   RE+   FQ+R++ Y+ +     K+E + L ++ ET R+ L +WC TSYGEV 
Sbjct  282  VDSFKNAVREKNGAFQVREYSYDKDKITENKEEKQSLEEEVETRRNELYEWCQTSYGEVV  341

Query  502  SSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTED  323
            SSW+H   VR+F ESILRYGLPP+F +V++ P  + EK++RS++ +   + +S++W   +
Sbjct  342  SSWIHVVVVRLFVESILRYGLPPAFQAVIMRPKERLEKKLRSVMNAAFGNGSSSHWSATE  401

Query  322  EGAVGAFGGDAEVH---------PYVSFTINL  254
             G     GG   +          PYVSFT+ L
Sbjct  402  SGGGSGGGGGDGLGGERGGDDCFPYVSFTVTL  433



>gb|ABF18462.1| V-ATPase C subunit [Aedes aegypti]
Length=364

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 87/145 (60%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARER F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  213  VDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  272

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L  L    D S ++     
Sbjct  273  WIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVLMQLYGHLDGSAASSGGNA  332

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G +E +PYV + +N+
Sbjct  333  DNVDIPGLGFGQSEYYPYVYYKLNI  357



>emb|CAX70571.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
 emb|CAX75463.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
Length=384

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 89/143 (62%), Gaps = 4/143 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ +ARE  F +RDF Y+ +  E  + EL KL  D++   + L +W   ++GE FS+ 
Sbjct  237  DDFKTQAREHRFVVRDFIYDEKKIEEGRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAM  296

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP  F +++L P+ K +K++R +L+ L    D S+S+    ED
Sbjct  297  VHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDVLKQLYSHLDGSSSSSIIDED  356

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
               VG FG  ++  PYVSF + L
Sbjct  357  VN-VGNFGASSDYFPYVSFKVEL  378



>gb|AIJ50380.1| V-ATPase subunit C [Pectinophora gossypiella]
Length=382

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            AD F++ ARER F +R+F YN     + K E+ KL+ D++     L++W   ++ E F +
Sbjct  233  ADEFKLHARERKFVVREFSYNEADLAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F + VL PS KS K++R +L SL    D S +   + E
Sbjct  293  WIHVKALRVFVESVLRYGLPVNFQAAVLVPSRKSMKKLRDVLHSLYAHLDHSANAGAQAE  352

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
                 G   G +E  PYV + IN+
Sbjct  353  GAELAGLGFGQSEYFPYVFYKINI  376



>gb|ACO11255.1| Vacuolar proton pump subunit C [Caligus rogercresseyi]
Length=384

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 85/141 (60%), Gaps = 0/141 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+F+ KARE  F +RDF Y+P+  E+ K E+ KL  D++     L++W   ++ E F S
Sbjct  235  VDDFKFKAREHKFIVRDFVYDPDELEAGKCEITKLTTDKKKQFGPLVRWLRVNFSEAFIS  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
             +H  A+RVF ES+LR+GLP +F +++L P  K++K++R +L +L    +S+    E   
Sbjct  295  CIHVKALRVFVESVLRFGLPVNFQAMLLLPQKKTQKKLRDVLNNLYSHLDSSGGVNEPMD  354

Query  316  AVGAFGGDAEVHPYVSFTINL  254
                 G + E +PYV + IN+
Sbjct  355  IPAGLGFNQEYYPYVYYKINI  375



>ref|XP_315870.4| AGAP005845-PA [Anopheles gambiae str. PEST]
 gb|EAA11948.4| AGAP005845-PA [Anopheles gambiae str. PEST]
Length=385

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 87/145 (60%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARER F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  234  VDEFKLHARERKFVVREFVYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L+ L    D S ++     
Sbjct  294  WVHVKALRVFVESVLRYGLPVNFQAILIHPNKKSTKRLRDVLQQLYGHLDGSAASSGGNA  353

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G +E  PYV + +N+
Sbjct  354  DNVDIPGLGFGQSEYFPYVYYKLNI  378



>ref|XP_011305233.1| PREDICTED: V-type proton ATPase subunit C [Fopius arisanus]
 ref|XP_011305235.1| PREDICTED: V-type proton ATPase subunit C [Fopius arisanus]
Length=386

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 88/146 (60%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            A+ F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  234  AEEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNS-TYWKT  329
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L  L    DSS S      
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAILLHPNKKNTKRLRDVLNQLYAHLDSSASGAGGGN  353

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
            +D   +   G G  E +PYV + IN+
Sbjct  354  QDSMDIPGLGFGQNEYYPYVYYKINV  379



>ref|NP_958479.1| V-type proton ATPase subunit C 1-A [Danio rerio]
 sp|Q7T385.1|VTC1A_DANRE RecName: Full=V-type proton ATPase subunit C 1-A; Short=V-ATPase 
subunit C 1-A; AltName: Full=Vacuolar proton pump subunit 
C 1-A [Danio rerio]
 gb|AAH53214.1| ATPase, H+ transporting, lysosomal, V1 subunit C, isoform 1 [Danio 
rerio]
 gb|AAI64479.1| Atp6v1c1 protein [Danio rerio]
Length=383

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D+ A
Sbjct  295  VHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSA  354

Query  313  VGAFG---GDAEVHPYVSFTIN  257
            +   G      E +PYV + I+
Sbjct  355  MDIPGLNLSQQEYYPYVYYKID  376



>ref|XP_001843335.1| vacuolar ATP synthase subunit C [Culex quinquefasciatus]
 gb|EDS32198.1| vacuolar ATP synthase subunit C [Culex quinquefasciatus]
Length=528

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 87/145 (60%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARER F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  377  VDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  436

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L  L    D S ++     
Sbjct  437  WIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVLNQLYGHLDGSAASSGGNA  496

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G +E +PYV + +N+
Sbjct  497  DNVDIPGLGFGQSEYYPYVYYKLNI  521



>ref|XP_001418773.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97066.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=374

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F   ARE G   +++ ++PE   + K +   L Q+    R SLL+WC  SYGE FS+
Sbjct  233  VDAFTTAAREIGCTAKEYSHDPEASRAAKSQRGALEQEVVQRRDSLLEWCQISYGEAFST  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
             MH C VRVF ESILRYGLPP F +V++ P++K   ++R +L        S++W  E  G
Sbjct  293  MMHVCTVRVFVESILRYGLPPDFQAVLMRPNMKHVSKLRKVLNQEFGKDASSHWDDEIGG  352

Query  316  AVGAFGGDAE-VHPYVSFTINL  254
               + GG  E ++ YVS T+ +
Sbjct  353  DEKSGGGLVEDMYSYVSLTMKV  374



>ref|XP_008480724.1| PREDICTED: V-type proton ATPase subunit C [Diaphorina citri]
Length=410

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 86/144 (60%), Gaps = 4/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D FR  ARE+ F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  259  DEFRHHAREKKFIVREFVYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAW  318

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L+ L    DSS     +  D
Sbjct  319  IHVKALRVFVESVLRYGLPVNFQAMLLHPNKKNTKRLRDVLQQLYGHLDSSAQGGSQHHD  378

Query  322  EGAVGAFG-GDAEVHPYVSFTINL  254
               +   G G A+  PYV + IN+
Sbjct  379  SVEIPGLGFGQADYFPYVYYKINI  402



>ref|XP_003389520.1| PREDICTED: V-type proton ATPase subunit C 1-B-like [Amphimedon 
queenslandica]
Length=386

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F+++ARE+ F +R++E++P+  E+ ++E EKL +D +     L+ W   ++ +VFS+
Sbjct  237  VDEFKLQAREKRFAVREYEHDPQALEAERKEKEKLERDLKRQFGPLMNWLKVNFSQVFSA  296

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF+ESILRYGL  + +S+VL P  +S K V   L       DS      K +
Sbjct  297  WLHLKALRVFSESILRYGLDSNCVSLVLKPHRRSAKSVHQALNDKYYHLDSMPLKGSKGD  356

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G   AE +PYV F +NL
Sbjct  357  DHIDIPGLGLNQAEYYPYVFFKMNL  381



>emb|CDJ90591.1| ATPase domain containing protein, partial [Haemonchus contortus]
Length=225

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 92/144 (64%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARE  F +RDF Y+ E+ ++ K E +KL+ +++   + L++W   ++GE+F+++
Sbjct  77   DEFKNIARENKFIVRDFVYDEESMKAGKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAY  136

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + ++ P+  S+K++R+ L  L    D S +    T E
Sbjct  137  IHVKALRVFVESVLRYGLPVNFQAALVEPTKGSQKKLRAELHKLYIHLDGSAAGPIDTLE  196

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +NL
Sbjct  197  DSPALMSLGVN-EYYPYVFFKVNL  219



>gb|EFX90034.1| hypothetical protein DAPPUDRAFT_205240 [Daphnia pulex]
Length=385

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 83/143 (58%), Gaps = 2/143 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F+  ARE  F +RDF YN E   + K E+ KL  D++     L++W   ++ E F++
Sbjct  234  VDEFKHHAREHKFVVRDFTYNEEELAAGKNEITKLATDKKKQFGPLVRWLKVNFSEGFTA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL-CDSSNSTYWKTEDE  320
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS KR+R +L  L     NS      D 
Sbjct  294  WVHVKALRVFVESVLRYGLPVNFQAMLLQPNKKSTKRLREVLSQLYIHLDNSALQSAHDN  353

Query  319  GAV-GAFGGDAEVHPYVSFTINL  254
              + G   G +E +PYV + IN+
Sbjct  354  VDIPGLVFGQSEYYPYVYYKINI  376



>ref|XP_001650489.1| AAEL005173-PA [Aedes aegypti]
 gb|EAT43366.1| AAEL005173-PA [Aedes aegypti]
Length=695

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 87/145 (60%), Gaps = 4/145 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARER F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  544  VDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  603

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L  L    D S ++     
Sbjct  604  WIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVLMQLYGHLDGSAASSGGNA  663

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G +E +PYV + +N+
Sbjct  664  DNVDIPGLGFGQSEYYPYVYYKLNI  688



>ref|XP_008895951.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI36368.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK76615.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL30052.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL83284.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM36501.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN18254.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO65122.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP06196.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP34310.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=361

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            ++F+ +A+E+ F +R+F ++P +H S ++ + +L  + +   S+L++WC   +GE F +W
Sbjct  220  EDFKTRAKEKRFVVREFNFDPTSHASNEEAIAELEVEVDRLWSALIRWCKAHFGETFIAW  279

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            MH   VRVF ES+LRYGLP +F+  +  P    EK++R++L           +   +EG+
Sbjct  280  MHIKMVRVFVESVLRYGLPVNFVVAMYKPHSGKEKKLRAVLAKKYAHLQPAQFSGLEEGS  339

Query  313  VGAFGGDAEVHPYVSFTIN  257
             G+     E +PYV+ + N
Sbjct  340  SGS--SQVEYYPYVTNSFN  356



>gb|ACM77810.1| putative vacuolar H+ATPase [Conyza canadensis]
Length=76

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  394  EKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  251
            EK+VRSILE+L DSSNST+WKT+D+G +G  GGDA+ HPYVSFTINL+
Sbjct  29   EKKVRSILETLSDSSNSTFWKTDDDGNMGGLGGDADTHPYVSFTINLI  76



>ref|XP_008559568.1| PREDICTED: V-type proton ATPase subunit C [Microplitis demolitor]
 ref|XP_008559569.1| PREDICTED: V-type proton ATPase subunit C [Microplitis demolitor]
Length=387

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 86/144 (60%), Gaps = 6/144 (4%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  237  FKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  296

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEG  317
              A+RVF ES+LRYGLP +F +++L P  K  KR+R +L  L    DSS ++   + ++ 
Sbjct  297  VKALRVFVESVLRYGLPVNFQAILLHPHKKCTKRLRDVLNQLYAHLDSSAASGGHSANQD  356

Query  316  AVGAFG---GDAEVHPYVSFTINL  254
            +V   G   G  E  PYV + IN+
Sbjct  357  SVDIPGLGFGQNEYFPYVYYKINV  380



>gb|ETN59245.1| vacuolar ATP synthase subunit C [Anopheles darlingi]
Length=635

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 87/144 (60%), Gaps = 4/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARER F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  485  DEFKLHARERKFVVREFVYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFGAW  544

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L+ L    D S ++     D
Sbjct  545  VHVKALRVFVESVLRYGLPVNFQAILIHPNKKSTKRLRDVLQQLYGHLDGSAASSGGNAD  604

Query  322  EGAVGAFG-GDAEVHPYVSFTINL  254
               +   G G +E  PYV + +N+
Sbjct  605  NVDIPGLGFGQSEYFPYVYYKLNV  628



>ref|XP_005098193.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Aplysia 
californica]
 ref|XP_005098194.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Aplysia 
californica]
Length=390

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 84/143 (59%), Gaps = 3/143 (2%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+ K RE  F +RDF+Y+ E  ++ K EL+KL  D++     L++W   ++GE F +W
Sbjct  241  DEFKNKCRENKFIVRDFQYSDEEIQAGKMELDKLNADKKKQFGPLVKWLKINFGESFVAW  300

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            MH  A+RVF ES+LRYGLP +F  +++ P  K+ KR+R +L  L    DS+  +  K   
Sbjct  301  MHIKALRVFVESVLRYGLPVNFQGMLVRPVKKNSKRLRDLLNQLYGHLDSTALSGQKVNS  360

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
                G     ++ +PYV + I+L
Sbjct  361  MDIPGLNLSASDYYPYVFYKISL  383



>gb|EYC06044.1| hypothetical protein Y032_0078g1163 [Ancylostoma ceylanicum]
Length=384

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 93/144 (65%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE  F +RDF Y+ E+ ++ K E +KL+ +++   + L++W   ++GE+F+++
Sbjct  236  DEFKMVARENKFIVRDFVYDEESLKAGKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAY  295

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + V+ PS  S+K++R+ L  L    D S +    T E
Sbjct  296  IHVKALRVFVESVLRYGLPVNFQAAVVEPSKGSQKKLRAELHKLYIHLDGSAAGPIDTLE  355

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +NL
Sbjct  356  DSPALMSLGVN-EYYPYVFFKLNL  378



>ref|XP_009861882.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 2-like [Ciona intestinalis]
Length=382

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F+ K     F +RDF+YN     S K +L KL  D++     LL+W   ++ EVF++WMH
Sbjct  237  FKTKCGRHKFFLRDFQYNERDMASDKDQLTKLTSDKKKMLGPLLRWLKVNFSEVFTAWMH  296

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWK--TEDEGA  314
              A+RVF ES+LRYGLP +F + V+ P  K  KR++  L  L    +ST      ED+  
Sbjct  297  VKALRVFVESVLRYGLPVNFQATVVQPQKKQSKRLQETLNKLYVGLDSTGLAAVNEDDFL  356

Query  313  VGAFGGDAEVHPYVSFTINL  254
             G   G  E HPYV + + L
Sbjct  357  PGLTLGTQEYHPYVFYKVVL  376



>gb|ABO61291.1| vacuolar ATPase subunit C [Lutzomyia longipalpis]
Length=386

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARE+ F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +
Sbjct  234  VDEFKLHAREKKFVVREFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC----DSSNSTYWKT  329
            W+H  A+RVF ES+LRYGLP +F ++++ P  KS KR+R +L  L      S+ S+    
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAILIHPHKKSTKRLRDVLNQLYGHLDGSAASSGGSN  353

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
             D   +   G G +E +PYV + +N+
Sbjct  354  ADNVDIPGLGFGQSEYYPYVYYKLNI  379



>ref|XP_001201267.2| PREDICTED: V-type proton ATPase subunit C-like [Strongylocentrotus 
purpuratus]
Length=383

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 83/146 (57%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D +++ ARE  F +R+F YN E   + K EL KL  D++     L++W   ++ E F +
Sbjct  234  VDEYKLHARENKFMVREFTYNEEELNAGKSELNKLAADKKRQYGPLVRWLKINFSEAFQA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F  ++L P  K++K+++ +L +L    + +   T+D  
Sbjct  294  WVHVKALRVFVESVLRYGLPVNFQPMILQPYKKTQKKLKEVLNTLYGHLDGSNINTKDAK  353

Query  316  AVGAFG-----GDAEVHPYVSFTINL  254
             V AF       + E  PYV + I +
Sbjct  354  GVPAFDMPGLMSNTEYFPYVFYPIQI  379



>ref|XP_006626108.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=381

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = -3

Query  670  NFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWM  491
            +FRIKARE  F +R+F +N    ++ K+E+ +L  D++     LL+W   ++ E F++W+
Sbjct  235  DFRIKARENKFTVREFSFNETELQAEKEEMTRLAADKKQQFGPLLRWLKVNFSEAFTAWI  294

Query  490  HFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAV  311
            H  A+RVF ES+LRYGLP +F +++L PS K+ KR+R IL SL    +     ++ +  V
Sbjct  295  HVKALRVFVESVLRYGLPVNFQAILLQPSKKNSKRLREILNSLYKHLDGVAASSKLDAGV  354

Query  310  GAFG---GDAEVHPYVSFTINL  254
               G    + E + YV FTI++
Sbjct  355  DLPGLGLSNQEYYCYVYFTIDV  376



>ref|XP_006219905.1| PREDICTED: V-type proton ATPase subunit C-like, partial [Vicugna 
pacos]
Length=375

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 92/144 (64%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARE  F +RDF Y+ E+ ++ K E +KL+ +++   + L++W   ++GE+F+++
Sbjct  231  DEFKTIARENKFVVRDFVYDEESLKAGKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAY  290

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + ++ P+  S+K++R+ L  L    D S +    T E
Sbjct  291  IHVKALRVFVESVLRYGLPVNFQAALVEPTKGSQKKLRAELHKLYIHLDGSAAGPIDTLE  350

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +NL
Sbjct  351  DSPALMSLGVN-EYYPYVFFKVNL  373



>ref|XP_007670905.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Ornithorhynchus 
anatinus]
Length=344

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 85/142 (60%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR+KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  196  VDDFRLKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  255

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  256  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSSAAAIIDAP  315

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  316  MDIPGLNLSQQEYYPYVYYKID  337



>ref|XP_008895950.1| hypothetical protein PPTG_03917 [Phytophthora parasitica INRA-310]
 gb|ETI36367.1| hypothetical protein F443_17482 [Phytophthora parasitica P1569]
 gb|ETK76614.1| hypothetical protein L915_17013 [Phytophthora parasitica]
 gb|ETL30051.1| hypothetical protein L916_16911 [Phytophthora parasitica]
 gb|ETL83283.1| hypothetical protein L917_16737 [Phytophthora parasitica]
 gb|ETM36500.1| hypothetical protein L914_16821 [Phytophthora parasitica]
 gb|ETN18253.1| hypothetical protein PPTG_03917 [Phytophthora parasitica INRA-310]
 gb|ETO65121.1| hypothetical protein F444_17522 [Phytophthora parasitica P1976]
 gb|ETP06195.1| hypothetical protein F441_17350 [Phytophthora parasitica CJ01A1]
 gb|ETP34309.1| hypothetical protein F442_17332 [Phytophthora parasitica P10297]
Length=415

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 83/139 (60%), Gaps = 2/139 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            ++F+ +A+E+ F +R+F ++P +H S ++ + +L  + +   S+L++WC   +GE F +W
Sbjct  274  EDFKTRAKEKRFVVREFNFDPTSHASNEEAIAELEVEVDRLWSALIRWCKAHFGETFIAW  333

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            MH   VRVF ES+LRYGLP +F+  +  P    EK++R++L           +   +EG+
Sbjct  334  MHIKMVRVFVESVLRYGLPVNFVVAMYKPHSGKEKKLRAVLAKKYAHLQPAQFSGLEEGS  393

Query  313  VGAFGGDAEVHPYVSFTIN  257
             G+     E +PYV+ + N
Sbjct  394  SGS--SQVEYYPYVTNSFN  410



>ref|NP_001023451.1| Protein VHA-11, isoform a [Caenorhabditis elegans]
 sp|Q9XXU9.1|VATC_CAEEL RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Caenorhabditis 
elegans]
 dbj|BAA75067.1| Vha11 protein [Caenorhabditis elegans]
 emb|CCD66967.1| VHA-11, isoform a [Caenorhabditis elegans]
Length=384

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 90/144 (63%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARE  F +RDF Y+ ET ++ + E +KLM +++   + L++W   ++GE+F+++
Sbjct  237  DEFKNTARENKFIVRDFVYDEETLKAGRTERDKLMAEKQRQYAPLIRWLKINFGEIFAAY  296

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + V+ P+   +K++R  L  L    D S +    T E
Sbjct  297  IHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQELHKLYIHLDGSAAGPIDTLE  356

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +N+
Sbjct  357  DSPALMSLGVN-EYYPYVFFKLNI  379



>ref|XP_002423137.1| vacuolar ATP synthase subunit C, putative [Pediculus humanus 
corporis]
 gb|EEB10399.1| vacuolar ATP synthase subunit C, putative [Pediculus humanus 
corporis]
Length=495

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 85/142 (60%), Gaps = 4/142 (3%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARE+ F +R+F YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  347  FKLHAREKKFVVREFTYNEEEMAAGKNEITKLVLDKKKQFGPLVRWLKVNFSECFCAWIH  406

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEG  317
              A+RVF ES+LRYGLP +F +++L P+ K+ KR+R IL  L    DSS       +D  
Sbjct  407  VKALRVFVESVLRYGLPVNFQAMLLQPNKKNTKRLREILNQLYGHLDSSALQGSGHQDSV  466

Query  316  AVGAFG-GDAEVHPYVSFTINL  254
             +   G G A+  PYV + IN+
Sbjct  467  DIPGLGFGQADYFPYVYYKINI  488



>ref|XP_011504285.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Ceratosolen 
solmsi marchali]
Length=388

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  237  FKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  296

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS---NSTYWKTE  326
              A+RVF ES+LRYGLP +F +++L P  KS KR+R +L  L    DSS    S+    +
Sbjct  297  VKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVLNQLYAHLDSSATAGSSQSSNQ  356

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G ++  PYV + IN+
Sbjct  357  DSVDIPGLGFGQSDYFPYVYYKINV  381



>ref|XP_005797406.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=382

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 86/143 (60%), Gaps = 5/143 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS +    + 
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLNDLYKHLDSSAAVIDASM  353

Query  325  DEGAVGAFGGDAEVHPYVSFTIN  257
            D    G      E +PYV + I+
Sbjct  354  D--IPGLNLSQQEYYPYVYYKID  374



>gb|EYC06045.1| hypothetical protein Y032_0078g1163 [Ancylostoma ceylanicum]
Length=423

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 93/144 (65%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE  F +RDF Y+ E+ ++ K E +KL+ +++   + L++W   ++GE+F+++
Sbjct  275  DEFKMVARENKFIVRDFVYDEESLKAGKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAY  334

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + V+ PS  S+K++R+ L  L    D S +    T E
Sbjct  335  IHVKALRVFVESVLRYGLPVNFQAAVVEPSKGSQKKLRAELHKLYIHLDGSAAGPIDTLE  394

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +NL
Sbjct  395  DSPALMSLGVN-EYYPYVFFKLNL  417



>ref|XP_002645132.1| C. briggsae CBR-VHA-11 protein [Caenorhabditis briggsae]
 sp|Q612A4.1|VATC_CAEBR RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Caenorhabditis 
briggsae]
 emb|CAP34690.1| Protein CBR-VHA-11 [Caenorhabditis briggsae]
Length=385

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 90/144 (63%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARE  F +RDF Y+ ET ++ + E +KL+ +++   + L++W   ++GE+FS++
Sbjct  238  DEFKNIARENKFIVRDFVYDEETLKAGRTERDKLLAEKQKQYAPLIRWLKINFGEIFSAY  297

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + V+ P+    K++R  L+ L    D S +    T E
Sbjct  298  IHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQSKKLRQELQKLYIHLDGSAAGPIDTLE  357

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +N+
Sbjct  358  DSPALMSLGVN-EYYPYVFFKLNI  380



>gb|ENN78483.1| hypothetical protein YQE_05047, partial [Dendroctonus ponderosae]
Length=319

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 82/144 (57%), Gaps = 4/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARER F +RDF Y+ E   + K E+ KL  D++     L++W   ++ E F +W
Sbjct  168  DEFKHHARERKFIVRDFTYDEEQLAAGKNEITKLATDKKKQFGPLVRWLKVNFSECFCAW  227

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F ++++ P  K+ KR+R +L  L    D S        D
Sbjct  228  IHVKALRVFVESVLRYGLPVNFQAILIHPHKKTMKRLRDVLNQLYGHLDGSVGHQGANMD  287

Query  322  EGAVGAFG-GDAEVHPYVSFTINL  254
               +   G G +E +PYV + +N+
Sbjct  288  NVDIPGLGFGQSEYYPYVYYKLNV  311



>dbj|BAB24526.1| unnamed protein product [Mus musculus]
Length=382

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 85/142 (60%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ EVF +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEVFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_001506621.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ornithorhynchus 
anatinus]
Length=382

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 85/142 (60%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR+KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRLKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_009170324.1| hypothetical protein T265_06723 [Opisthorchis viverrini]
 gb|KER25916.1| hypothetical protein T265_06723 [Opisthorchis viverrini]
Length=413

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 5/143 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            ++F+ + RER F +RDFEY+ +  E  K EL KL  D++   + L +W   ++GE FS+ 
Sbjct  267  EDFKNRCRERRFIVRDFEYDEKKIEEGKTELSKLESDKKRQFAPLFRWLKINFGEAFSAM  326

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP  F +V++ P+ K+ KR+R +L  L    DS+ S+    E+
Sbjct  327  VHTKALRVFVESVLRYGLPVDFQAVLIQPNKKAHKRLRELLRQLYSHLDSTASSNVVDEE  386

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
               VG      + +PYVSF + L
Sbjct  387  IALVGV--SPVDYYPYVSFKVEL  407



>ref|XP_011144745.1| PREDICTED: V-type proton ATPase subunit C [Harpegnathos saltator]
 ref|XP_011144746.1| PREDICTED: V-type proton ATPase subunit C [Harpegnathos saltator]
 gb|EFN81041.1| Vacuolar proton pump subunit C [Harpegnathos saltator]
Length=388

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 86/147 (59%), Gaps = 7/147 (5%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  235  DEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS---NSTYWK  332
            +H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L  L    DSS   ++    
Sbjct  295  IHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVLNQLYAHLDSSATASTAAQH  354

Query  331  TEDEGAVGAFG-GDAEVHPYVSFTINL  254
             +D   +   G G ++  PYV + IN+
Sbjct  355  NQDNVDIPGLGFGQSDYFPYVYYKINV  381



>ref|XP_010898239.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Esox lucius]
Length=381

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 85/142 (60%), Gaps = 5/142 (4%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+FR KARE  F +RDF+YN +   + K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFRHKARENKFTVRDFQYNEQEMNADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS S    T D
Sbjct  295  VHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNIKKLREVLSELYKHLDSSASIIDATMD  354

Query  322  EGAVGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  355  --IPGLNLSQQEYYPYVYYKID  374



>ref|XP_001960901.1| GF11269 [Drosophila ananassae]
 gb|EDV37723.1| GF11269 [Drosophila ananassae]
Length=388

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            A+ F++ ARER F +RDF YN E   + K E+ KLM D++     L++W   ++ E F +
Sbjct  235  AEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCA  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC----DSSNSTYWKT  329
             +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L  L      +S      +
Sbjct  295  LIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSS  354

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
             D   +   G G +E +PYV + +N+
Sbjct  355  ADNVDIPGLGFGQSEYYPYVFYKVNI  380



>ref|XP_004077677.1| PREDICTED: V-type proton ATPase subunit C 1 [Oryzias latipes]
Length=383

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 86/142 (61%), Gaps = 4/142 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS +    T  
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAAAIMDTAM  354

Query  322  EGAVGAFGGDAEVHPYVSFTIN  257
            +   G      E +PYV + I+
Sbjct  355  DIP-GLNLSQQEYYPYVYYKID  375



>dbj|BAM20425.1| vacuolar H[+] ATPase 44kD C subunit [Papilio polytes]
Length=385

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F++ ARER F +R+F YN     + K E+ KL+ D++     L++W   ++ E F +
Sbjct  233  VDEFKLHARERKFVVREFSYNEADLAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCA  292

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC----DSSNSTYWKT  329
            W+H  A+RVF ES+LRYGLP +F + V+ P+ KS K++R +L+ L      S++  + + 
Sbjct  293  WIHVKALRVFVESVLRYGLPVNFQAAVVVPARKSMKKLRDVLQQLYAHLDHSAHQGHGQA  352

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
             +   +   G G +E  PYV + IN+
Sbjct  353  SENVEIAGLGFGQSEYFPYVFYKINI  378



>ref|XP_004580713.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Ochotona 
princeps]
 ref|XP_004580714.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Ochotona 
princeps]
Length=307

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_007249407.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Astyanax 
mexicanus]
Length=380

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 88/143 (62%), Gaps = 5/143 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ +ARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  234  DDFKHQARENKFAVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  293

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L+ L    DSS +    + D
Sbjct  294  IHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNMKKLREVLQELYKHLDSSAAIIDASMD  353

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
                G      E +PYV + I+L
Sbjct  354  --IPGLNLSQQEYYPYVYYKIDL  374



>ref|XP_007547766.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Poecilia 
formosa]
 ref|XP_007547767.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Poecilia 
formosa]
Length=382

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 86/143 (60%), Gaps = 5/143 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS +    + 
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAVIDASM  353

Query  325  DEGAVGAFGGDAEVHPYVSFTIN  257
            D    G      E +PYV + I+
Sbjct  354  D--IPGLNLSQQEYYPYVYYKID  374



>gb|EZA45856.1| S-methyl-5'-thioadenosine phosphorylase-like protein-3 [Microplitis 
demolitor]
Length=556

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 86/144 (60%), Gaps = 6/144 (4%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  406  FKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  465

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEG  317
              A+RVF ES+LRYGLP +F +++L P  K  KR+R +L  L    DSS ++   + ++ 
Sbjct  466  VKALRVFVESVLRYGLPVNFQAILLHPHKKCTKRLRDVLNQLYAHLDSSAASGGHSANQD  525

Query  316  AVGAFG---GDAEVHPYVSFTINL  254
            +V   G   G  E  PYV + IN+
Sbjct  526  SVDIPGLGFGQNEYFPYVYYKINV  549



>ref|XP_008420198.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia reticulata]
Length=382

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 86/143 (60%), Gaps = 5/143 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS +    + 
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAVIDASM  353

Query  325  DEGAVGAFGGDAEVHPYVSFTIN  257
            D    G      E +PYV + I+
Sbjct  354  D--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_010954093.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 1 [Camelus bactrianus]
Length=381

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 84/141 (60%), Gaps = 1/141 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  353

Query  316  A-VGAFGGDAEVHPYVSFTIN  257
              +       E +PYV + I+
Sbjct  354  MDIPGLNLSXEYYPYVYYKID  374



>ref|XP_004993351.1| hypothetical protein PTSG_05481 [Salpingoeca rosetta]
 gb|EGD73788.1| hypothetical protein PTSG_05481 [Salpingoeca rosetta]
Length=373

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 82/144 (57%), Gaps = 7/144 (5%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            AD+FR  ARE+ F +RDFE++ ET   ++ +   L  + +   + L+ W   S+ + F++
Sbjct  227  ADDFRAAAREKKFTVRDFEFDEETVAQQEADTTHLANEFKEKHARLMDWLQLSFDQCFTA  286

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            WMH  A+R+F ES+LRYGLPP F    +S     EKR+R+ L+ L    D + +   +  
Sbjct  287  WMHLKALRLFVESVLRYGLPPKFSFYAVSFKPDEEKRMRTALQRLYGHLDKAGAEAGEVA  346

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D    G F G  E  PYVSF++ L
Sbjct  347  D--VPGLFQG--EYFPYVSFSVRL  366



>ref|XP_002940167.1| PREDICTED: V-type proton ATPase subunit C 2 [Xenopus (Silurana) 
tropicalis]
Length=381

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 3/143 (2%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +R+F +N +  +S K E+ KL  D++     LL+W   ++ E F  W
Sbjct  234  DDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYGPLLRWLKVNFSEAFIGW  293

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F +VVL P+ KS KR+R +L ++    D + +   K   
Sbjct  294  IHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLDENAAANMKDIG  353

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
                G      + +PYV F I+L
Sbjct  354  MEIPGLQLSSQDYYPYVCFKIDL  376



>ref|XP_004047450.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_004090842.1| PREDICTED: V-type proton ATPase subunit C 1 [Nomascus leucogenys]
Length=307

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_004679737.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Condylura 
cristata]
 ref|XP_004679738.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Condylura 
cristata]
Length=307

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_010768583.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Notothenia 
coriiceps]
Length=177

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 88/146 (60%), Gaps = 10/146 (7%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  28   VDDFKHKARENKFVVRDFQYNEEELKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  87

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L PS K+ KR+R +L  L    DSS S      
Sbjct  88   WIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKRLREVLNDLYKHLDSSASAII---  144

Query  325  DEGAVGAFGGDAEV---HPYVSFTIN  257
             + A+   G +  V   +PYV + I+
Sbjct  145  -DCAMDIPGLNLSVQEYYPYVYYKID  169



>gb|ERL87116.1| hypothetical protein D910_04516 [Dendroctonus ponderosae]
Length=386

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 82/144 (57%), Gaps = 4/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARER F +RDF Y+ E   + K E+ KL  D++     L++W   ++ E F +W
Sbjct  235  DEFKHHARERKFIVRDFTYDEEQLAAGKNEITKLATDKKKQFGPLVRWLKVNFSECFCAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F ++++ P  K+ KR+R +L  L    D S        D
Sbjct  295  IHVKALRVFVESVLRYGLPVNFQAILIHPHKKTMKRLRDVLNQLYGHLDGSVGHQGANMD  354

Query  322  EGAVGAFG-GDAEVHPYVSFTINL  254
               +   G G +E +PYV + +N+
Sbjct  355  NVDIPGLGFGQSEYYPYVYYKLNV  378



>dbj|GAA48137.1| V-type proton ATPase subunit C 1-A [Clonorchis sinensis]
Length=574

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 5/143 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            ++F+ + RER F +RDFEY+ +  E  K EL KL  D++   + L +W   ++GE FS+ 
Sbjct  428  EDFKNRCRERRFIVRDFEYDEKKIEEGKTELSKLESDKKRQFAPLFRWLKINFGEAFSAM  487

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP  F +V++ P+ K+ KR+R +L  L    DS+ S+    E+
Sbjct  488  VHTKALRVFVESVLRYGLPVDFQAVLIQPNKKAHKRLRELLRQLYSHLDSTASSNVVDEE  547

Query  322  EGAVGAFGGDAEVHPYVSFTINL  254
               VG      + +PYVSF + L
Sbjct  548  VALVGV--SPVDYYPYVSFKVEL  568



>ref|XP_011268884.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011268972.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011269062.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011269145.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
Length=387

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 6/146 (4%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  235  DEFKLHAREKKFIVRDFIYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS--NSTYWKT  329
            +H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L  L    DSS   +     
Sbjct  295  IHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVLNQLYAHLDSSATGTPAQHN  354

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
            +D   +   G G ++  PYV + IN+
Sbjct  355  QDNLDIPGLGFGQSDYFPYVYYKINV  380



>emb|CAF93730.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=366

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  217  VDDFKHKARENKFVVRDFQYNEEEMKADKEEMTRLCTDKKKQFGPLVRWLKVNFSEAFIA  276

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L  L    +S+     D  
Sbjct  277  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKRLREVLNDLYKHLDSSAAAIIDSA  336

Query  316  A--VGAFGGDAEVHPYVSFTI  260
                G      E +PYV + I
Sbjct  337  MDIPGLNLSQQEYYPYVYYKI  357



>ref|XP_001946227.1| PREDICTED: V-type proton ATPase subunit C [Acyrthosiphon pisum]
 ref|XP_008181338.1| PREDICTED: V-type proton ATPase subunit C [Acyrthosiphon pisum]
Length=387

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 86/150 (57%), Gaps = 12/150 (8%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            A+ F+  ARER F +R+F YN     + K E+ KL+ D++     L++W   ++ E F +
Sbjct  234  AEEFKHHARERKFIVREFTYNEVELAAGKNEISKLVTDKKKQFGPLVRWLKVNFSECFCA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L  L    +S+    +  G
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLHPNKKNTKRLRDVLHQLYGHLDSS---AQQGG  350

Query  316  AVGAFG---------GDAEVHPYVSFTINL  254
            A GA           G AE  PYV + IN+
Sbjct  351  ATGAHDSVDIPGLGFGQAEYFPYVYYKINI  380



>ref|XP_004663083.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Jaculus 
jaculus]
 ref|XP_004663084.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Jaculus 
jaculus]
Length=307

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTVKKLREVLHELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_010751636.1| PREDICTED: V-type proton ATPase subunit C 1-A [Larimichthys crocea]
Length=382

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 86/142 (61%), Gaps = 5/142 (4%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTED  323
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS +    + D
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYELYKHLDSSAAIIDASMD  354

Query  322  EGAVGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  355  --IPGLNLSQQEYYPYVYYKID  374



>ref|XP_008211658.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Nasonia 
vitripennis]
Length=388

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  237  FKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  296

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNS---TYWKTE  326
              A+RVF ES+LRYGLP +F +++L P  KS KR+R +L  L    DSS +   +    +
Sbjct  297  VKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVLNQLYAHLDSSATAGGSQSGNQ  356

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G ++  PYV + IN+
Sbjct  357  DSVDIPGLGFGQSDYFPYVYYKINV  381



>gb|EDM16360.1| rCG60064, isoform CRA_a [Rattus norvegicus]
Length=273

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E   + K+E+ +L  D++     L++W   ++ E F +
Sbjct  125  VDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  184

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  185  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAP  244

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  245  MDIPGLNLSQQEYYPYVYYKID  266



>gb|AAA36803.1| H+ -ATPase C subunit, partial [Homo sapiens]
Length=347

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  199  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  258

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  259  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAP  318

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  319  MDIPGLNLSQQEYYPYVYYKID  340



>ref|XP_003094835.1| CRE-VHA-11 protein [Caenorhabditis remanei]
 gb|EFO90482.1| CRE-VHA-11 protein [Caenorhabditis remanei]
Length=386

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 89/144 (62%), Gaps = 5/144 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F+  ARE  F +RDF Y+ ET ++ + E +KL  +++   + L++W   ++GE+FS++
Sbjct  239  DEFKNTARENKFIVRDFVYDEETLKAGRTERDKLQAEKQRQYAPLIRWLKINFGEIFSAY  298

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKT-E  326
            +H  A+RVF ES+LRYGLP +F + V+ P+   +K++R  L  L    D S +    T E
Sbjct  299  IHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQELHKLYIHLDGSAAGPIDTLE  358

Query  325  DEGAVGAFGGDAEVHPYVSFTINL  254
            D  A+ + G + E +PYV F +N+
Sbjct  359  DSPALMSLGVN-EYYPYVFFKLNI  381



>ref|NP_001088261.1| V-type proton ATPase subunit C 1 [Xenopus laevis]
 sp|Q5XH14.1|VATC1_XENLA RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Xenopus laevis]
 gb|AAH84262.1| Atp6v1c1 protein [Xenopus laevis]
Length=382

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 4/143 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSSNSTYWKTE  326
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    DSS ++     
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAASIIDAP  353

Query  325  DEGAVGAFGGDAEVHPYVSFTIN  257
             +   G      E +PYV + I+
Sbjct  354  MDIP-GLNLSQQEYYPYVYYKID  375



>gb|EFN75043.1| Vacuolar proton pump subunit C [Camponotus floridanus]
Length=402

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 6/146 (4%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  250  DEFKLHAREKKFIVRDFIYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAW  309

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS--NSTYWKT  329
            +H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L  L    DSS   +     
Sbjct  310  IHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVLNQLYAHLDSSATGTPAQHN  369

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
            +D   +   G G ++  PYV + IN+
Sbjct  370  QDNLDIPGLGFGQSDYFPYVYYKINV  395



>gb|AAB62571.1| V-ATPase C subunit [Drosophila melanogaster]
Length=388

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            A+ F++ ARER F +RDF YN E   + K E+ KLM D++     L++W   ++ E F +
Sbjct  235  AEEFKLHARERKFIVRDFVYNEEELAAGKNEMPKLMTDKKKQFGPLVRWLKVNFSEAFCA  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC----DSSNSTYWKT  329
             +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L  L      +S      +
Sbjct  295  LIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSS  354

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
             D   +   G G +E  PYV + +N+
Sbjct  355  ADNVDIPGLGFGQSEYFPYVFYKVNI  380



>ref|XP_007550565.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia formosa]
 ref|XP_007550567.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X2 [Poecilia 
formosa]
Length=383

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L  L    +S+     D   
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAM  354

Query  313  --VGAFGGDAEVHPYVSFTIN  257
               G      E +PYV + I+
Sbjct  355  DIPGLNLSQQEYYPYVYYKID  375



>ref|XP_010744926.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Larimichthys 
crocea]
Length=383

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D   
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDSAM  354

Query  313  --VGAFGGDAEVHPYVSFTIN  257
               G      E +PYV + I+
Sbjct  355  DIPGLNLSQQEYYPYVYYKID  375



>ref|XP_007550566.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X1 [Poecilia 
formosa]
Length=383

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L  L    +S+     D   
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAM  354

Query  313  --VGAFGGDAEVHPYVSFTIN  257
               G      E +PYV + I+
Sbjct  355  DIPGLNLSQQEYYPYVYYKID  375



>ref|XP_005803508.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=383

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L  L    +S+     D   
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAM  354

Query  313  --VGAFGGDAEVHPYVSFTIN  257
               G      E +PYV + I+
Sbjct  355  DIPGLNLSQQEYYPYVYYKID  375



>ref|XP_005316339.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Ictidomys 
tridecemlineatus]
Length=307

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K  K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKMMKKLREVLYELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_010610418.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
 ref|XP_010610419.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
 ref|XP_010610420.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
 ref|XP_010610421.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
Length=384

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  236  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  295

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  296  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  355

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  356  VDIPGLNLSQQEYYPYVYYKID  377



>gb|KFO20049.1| V-type proton ATPase subunit C 1 [Fukomys damarensis]
Length=382

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  VDIPGLNLSQQEYYPYVYYKID  375



>gb|KFP57056.1| V-type proton ATPase subunit C 1, partial [Cathartes aura]
Length=200

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  52   VDDFKHKAREYKFMVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  111

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  112  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSSAAAIIDAT  171

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  172  MDIPGLNLSQQEYYPYVYYKID  193



>ref|XP_005306086.1| PREDICTED: V-type proton ATPase subunit C 1 [Chrysemys picta 
bellii]
Length=382

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKAREYKFMVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAASIIDAT  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_008146707.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Eptesicus 
fuscus]
Length=307

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_004457641.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 2 [Dasypus 
novemcinctus]
Length=307

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_003782478.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 2 [Otolemur 
garnettii]
Length=307

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_003459431.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004560058.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Maylandia 
zebra]
 ref|XP_005464958.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005742954.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_005930197.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005930198.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Haplochromis burtoni]
Length=383

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D   
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDSAM  354

Query  313  --VGAFGGDAEVHPYVSFTIN  257
               G      E +PYV + I+
Sbjct  355  DIPGLNLSQQEYYPYVYYKID  375



>ref|XP_006212224.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Vicugna 
pacos]
Length=307

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_004316545.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform 2 [Tursiops 
truncatus]
 ref|XP_004316546.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform 3 [Tursiops 
truncatus]
 ref|XP_004402385.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004402386.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 3 [Odobenus 
rosmarus divergens]
 ref|XP_005899432.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Bos mutus]
 ref|XP_006192891.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Camelus 
ferus]
 ref|XP_006744696.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Leptonychotes 
weddellii]
 ref|XP_007463324.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Lipotes 
vexillifer]
 ref|XP_008687453.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Ursus 
maritimus]
 ref|XP_011227438.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Ailuropoda 
melanoleuca]
Length=307

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  159  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  218

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  219  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  278

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  279  MDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_005367598.1| PREDICTED: V-type proton ATPase subunit C 1 [Microtus ochrogaster]
Length=382

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_006122461.1| PREDICTED: V-type proton ATPase subunit C 1 [Pelodiscus sinensis]
Length=382

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKAREYKFMVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDAT  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_007056164.1| PREDICTED: V-type proton ATPase subunit C 1 [Chelonia mydas]
Length=382

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKAREYKFMVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-  320
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDAT  353

Query  319  -GAVGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_004457640.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Dasypus 
novemcinctus]
Length=324

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  176  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  235

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  236  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAP  295

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  296  MDIPGLNLSQQEYYPYVYYKID  317



>ref|XP_006982882.1| PREDICTED: V-type proton ATPase subunit C 1 [Peromyscus maniculatus 
bairdii]
Length=382

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_004011849.1| PREDICTED: V-type proton ATPase subunit C 1 [Ovis aries]
 ref|XP_005689239.1| PREDICTED: V-type proton ATPase subunit C 1 [Capra hircus]
Length=382

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_005072734.1| PREDICTED: V-type proton ATPase subunit C 1 [Mesocricetus auratus]
Length=374

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  226  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  285

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  286  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTVKKLREVLHELYKHLDSSAAAIIDAP  345

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  346  MDIPGLNLSQQEYYPYVYYKID  367



>ref|XP_003701871.1| PREDICTED: V-type proton ATPase subunit C-like [Megachile rotundata]
Length=595

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 85/145 (59%), Gaps = 5/145 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  444  DEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAW  503

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS-NSTYWKTE  326
            +H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L  L    DSS  S+    +
Sbjct  504  IHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVLNQLYAHLDSSATSSTQGNQ  563

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G  +  PYV + IN+
Sbjct  564  DSVDIPGLGFGQNDYFPYVYYKINV  588



>ref|XP_008849773.1| PREDICTED: V-type proton ATPase subunit C 1 [Nannospalax galili]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|NP_477266.1| vacuolar H[+] ATPase 44kD subunit, isoform A [Drosophila melanogaster]
 ref|NP_599140.1| vacuolar H[+] ATPase 44kD subunit, isoform B [Drosophila melanogaster]
 ref|XP_002034118.1| GM20063 [Drosophila sechellia]
 ref|XP_002081761.1| GD25545 [Drosophila simulans]
 gb|AAF58011.1| vacuolar H[+] ATPase 44kD subunit, isoform A [Drosophila melanogaster]
 gb|AAL28586.1| HL07758p [Drosophila melanogaster]
 gb|AAM27505.1| LD12844p [Drosophila melanogaster]
 gb|AAM68515.1| vacuolar H[+] ATPase 44kD subunit, isoform B [Drosophila melanogaster]
 gb|EDW48131.1| GM20063 [Drosophila sechellia]
 gb|EDX07346.1| GD25545 [Drosophila simulans]
 gb|ACL84134.1| Vha44-PA, partial [synthetic construct]
 gb|ACL89238.1| Vha44-PA [synthetic construct]
Length=388

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
            A+ F++ ARER F +RDF YN E   + K E+ KLM D++     L++W   ++ E F +
Sbjct  235  AEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCA  294

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC----DSSNSTYWKT  329
             +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L  L      +S      +
Sbjct  295  LIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSS  354

Query  328  EDEGAVGAFG-GDAEVHPYVSFTINL  254
             D   +   G G +E  PYV + +N+
Sbjct  355  ADNVDIPGLGFGQSEYFPYVFYKVNI  380



>ref|XP_002710769.1| PREDICTED: V-type proton ATPase subunit C 1 [Oryctolagus cuniculus]
 ref|XP_004580712.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ochotona 
princeps]
 ref|XP_007112273.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Physeter 
catodon]
 ref|XP_007112274.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Physeter 
catodon]
 ref|XP_007112275.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Physeter 
catodon]
 ref|XP_007112276.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X4 [Physeter 
catodon]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_011504284.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Ceratosolen 
solmsi marchali]
Length=542

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W+H
Sbjct  391  FKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIH  450

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS---NSTYWKTE  326
              A+RVF ES+LRYGLP +F +++L P  KS KR+R +L  L    DSS    S+    +
Sbjct  451  VKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVLNQLYAHLDSSATAGSSQSSNQ  510

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G ++  PYV + IN+
Sbjct  511  DSVDIPGLGFGQSDYFPYVYYKINV  535



>ref|XP_007634426.1| PREDICTED: V-type proton ATPase subunit C 1 [Cricetulus griseus]
 gb|ERE52432.1| V-type proton ATPase subunit C 1 [Cricetulus griseus]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_003940719.1| PREDICTED: V-type proton ATPase subunit C 1 [Saimiri boliviensis 
boliviensis]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_006145636.1| PREDICTED: V-type proton ATPase subunit C 1 [Tupaia chinensis]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_008290531.1| PREDICTED: V-type proton ATPase subunit C 1 [Stegastes partitus]
Length=383

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +W
Sbjct  235  DDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA  314
            +H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D   
Sbjct  295  IHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLNDLYKHLDSSAAAIIDSAM  354

Query  313  --VGAFGGDAEVHPYVSFTIN  257
               G      E +PYV + I+
Sbjct  355  DIPGLNLSQQEYYPYVYYKID  375



>ref|XP_004768925.1| PREDICTED: V-type proton ATPase subunit C 1 [Mustela putorius 
furo]
 ref|XP_004796128.1| PREDICTED: V-type proton ATPase subunit C 1 [Mustela putorius 
furo]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_006241664.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Rattus 
norvegicus]
Length=349

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E   + K+E+ +L  D++     L++W   ++ E F +
Sbjct  201  VDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  260

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  261  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAP  320

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  321  MDIPGLNLSQQEYYPYVYYKID  342



>ref|XP_002015982.1| GL11349 [Drosophila persimilis]
 gb|EDW31872.1| GL11349 [Drosophila persimilis]
Length=388

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 84/143 (59%), Gaps = 5/143 (3%)
 Frame = -3

Query  667  FRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  488
            F++ ARER F +RDF YN E   + K E+ KLM D++     L++W   ++ E F + +H
Sbjct  238  FKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIH  297

Query  487  FCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLC----DSSNSTYWKTEDE  320
              A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L  L      +S      + D 
Sbjct  298  VKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGQVSSADN  357

Query  319  GAVGAFG-GDAEVHPYVSFTINL  254
              +   G G +E +PYV + +N+
Sbjct  358  VDIPGLGFGQSEYYPYVFYKVNI  380



>ref|XP_003509877.1| PREDICTED: V-type proton ATPase subunit C 1 [Cricetulus griseus]
 gb|EGW12831.1| V-type proton ATPase subunit C 1 [Cricetulus griseus]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAALIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>gb|EGI57447.1| V-type proton ATPase subunit C [Acromyrmex echinatior]
Length=386

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 84/145 (58%), Gaps = 5/145 (3%)
 Frame = -3

Query  673  DNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSW  494
            D F++ ARE+ F +RDF YN E   + K E+ KL+ D++     L++W   ++ E F +W
Sbjct  235  DEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAW  294

Query  493  MHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESL---CDSS-NSTYWKTE  326
            +H  A+RVF ES+LRYGLP +F +++L P  K  +R+R  L  L    DSS  ++    +
Sbjct  295  IHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDALNQLYAHLDSSATASTAHNQ  354

Query  325  DEGAVGAFG-GDAEVHPYVSFTINL  254
            D   +   G G  +  PYV + IN+
Sbjct  355  DNVDIPGLGFGQNDYFPYVYYKINV  379



>ref|NP_001686.1| V-type proton ATPase subunit C 1 [Homo sapiens]
 ref|NP_001125006.1| V-type proton ATPase subunit C 1 [Pongo abelii]
 ref|NP_001247698.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Macaca 
mulatta]
 ref|NP_001271984.1| V-type proton ATPase subunit C 1 [Macaca fascicularis]
 ref|XP_001155312.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan troglodytes]
 ref|XP_003256129.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Nomascus 
leucogenys]
 ref|XP_003821776.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan paniscus]
 ref|XP_003903096.1| PREDICTED: V-type proton ATPase subunit C 1 [Papio anubis]
 ref|XP_004047448.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004047449.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_005563904.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Macaca 
fascicularis]
 ref|XP_007999459.1| PREDICTED: V-type proton ATPase subunit C 1 [Chlorocebus sabaeus]
 ref|XP_009211717.1| PREDICTED: V-type proton ATPase subunit C 1 [Papio anubis]
 ref|XP_009454031.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan troglodytes]
 ref|XP_010352829.1| PREDICTED: V-type proton ATPase subunit C 1 [Rhinopithecus roxellana]
 sp|P21283.4|VATC1_HUMAN RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Homo sapiens]
 sp|Q5RDQ7.1|VATC1_PONAB RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Pongo abelii]
 sp|Q4R5H9.1|VATC1_MACFA RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Macaca fascicularis]
 emb|CAA48903.1| vacuolar proton-ATPase [Homo sapiens]
 gb|AAH10960.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Homo 
sapiens]
 gb|AAL50383.1| ATPase H+ transporting lysosomal protein [Homo sapiens]
 emb|CAH90100.1| hypothetical protein [Pongo abelii]
 dbj|BAE01646.1| unnamed protein product [Macaca fascicularis]
 gb|EAW91859.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, isoform 
CRA_a [Homo sapiens]
 gb|EAW91860.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, isoform 
CRA_a [Homo sapiens]
 gb|ACE86916.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 protein 
[synthetic construct]
 gb|ACE87603.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 protein 
[synthetic construct]
 dbj|BAJ17803.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [synthetic 
construct]
 gb|ADQ31698.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [synthetic 
construct]
 gb|EHH28693.1| V-type proton ATPase subunit C 1 [Macaca mulatta]
 gb|EHH64350.1| V-type proton ATPase subunit C 1 [Macaca fascicularis]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_008051075.1| PREDICTED: V-type proton ATPase subunit C 1 [Tarsius syrichta]
 ref|XP_008051076.1| PREDICTED: V-type proton ATPase subunit C 1 [Tarsius syrichta]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>dbj|BAE40727.1| unnamed protein product [Mus musculus]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>ref|NP_079770.2| V-type proton ATPase subunit C 1 [Mus musculus]
 sp|Q9Z1G3.4|VATC1_MOUSE RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Mus musculus]
 gb|AAH10217.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Mus musculus]
 dbj|BAC35953.1| unnamed protein product [Mus musculus]
 dbj|BAC57953.1| proton-translocating ATPase C subunit isoform C1 [Mus musculus]
 dbj|BAE30229.1| unnamed protein product [Mus musculus]
 gb|EDL08791.1| \ATPase, H+ transporting, lysosomal V1 subunit C1, isoform CRA_a 
[Mus musculus]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ KS K++R +L  L    +S+     D  
Sbjct  294  WIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>gb|AIC48333.1| ATP6V1C1, partial [synthetic construct]
Length=382

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++     L++W   ++ E F +
Sbjct  234  VDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIA  293

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L  L    +S+     D  
Sbjct  294  WIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAP  353

Query  316  A--VGAFGGDAEVHPYVSFTIN  257
                G      E +PYV + I+
Sbjct  354  MDIPGLNLSQQEYYPYVYYKID  375



>gb|KDO34219.1| hypothetical protein SPRG_01434 [Saprolegnia parasitica CBS 223.65]
Length=412

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = -3

Query  676  ADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSS  497
             D F+  ARE+ FQ RDF Y+P  H + +  + +L  +     + LL+WC   +GE F +
Sbjct  273  VDKFKNAAREKRFQARDFTYDPTAHATNETMIAELEVEVNRLYTGLLRWCKAHFGETFIA  332

Query  496  WMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG  317
            WMH  AVR F E++LRYGLP +F +++       EK++R++LE   +    + + + +E 
Sbjct  333  WMHVKAVRTFVEAVLRYGLPVNFTAILYRLKAGKEKKLRTVLEKRYEHLQPSQFASVEEA  392

Query  316  A  314
            A
Sbjct  393  A  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060