BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036M14

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        232   9e-68   Nicotiana tomentosiformis
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        229   6e-67   Nicotiana sylvestris
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        222   4e-64   Solanum tuberosum [potatoes]
ref|XP_002527509.1|  zinc finger protein, putative                      221   9e-64   Ricinus communis
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             221   2e-63   Solanum lycopersicum
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             219   4e-63   Citrus clementina [clementine]
gb|KJB32252.1|  hypothetical protein B456_005G231800                    218   1e-62   Gossypium raimondii
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   218   2e-62   Citrus sinensis [apfelsine]
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   218   2e-62   Citrus sinensis [apfelsine]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        218   2e-62   Citrus sinensis [apfelsine]
emb|CDO97275.1|  unnamed protein product                                217   3e-62   Coffea canephora [robusta coffee]
gb|AAF22842.1|AF209910_1  vacuolar sorting receptor protein             203   8e-62   Prunus dulcis [sweet almond]
gb|KDP44487.1|  hypothetical protein JCGZ_16320                         216   1e-61   Jatropha curcas
gb|KHG15071.1|  Vacuolar-sorting receptor 3 -like protein               210   3e-61   Gossypium arboreum [tree cotton]
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             214   5e-61   Theobroma cacao [chocolate]
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               214   6e-61   Gossypium arboreum [tree cotton]
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        214   6e-61   Nelumbo nucifera [Indian lotus]
gb|KJB79450.1|  hypothetical protein B456_013G050300                    213   7e-61   Gossypium raimondii
emb|CBI22461.3|  unnamed protein product                                213   9e-61   Vitis vinifera
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                213   9e-61   Erythranthe guttata [common monkey flower]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        213   9e-61   Sesamum indicum [beniseed]
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             213   1e-60   Vitis vinifera
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             214   1e-60   
ref|NP_179081.1|  vacuolar-sorting receptor 3                           209   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81459.1|  BnaC09g08700D                                          209   2e-59   
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             209   4e-59   Prunus mume [ume]
emb|CDX93144.1|  BnaA03g38660D                                          208   4e-59   
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             209   4e-59   
emb|CDY65441.1|  BnaCnng47180D                                          208   5e-59   Brassica napus [oilseed rape]
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             208   6e-59   Eutrema salsugineum [saltwater cress]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             208   6e-59   Brassica rapa
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        208   7e-59   Nelumbo nucifera [Indian lotus]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    208   8e-59   Arabis alpina [alpine rockcress]
emb|CDY37219.1|  BnaA09g08400D                                          207   9e-59   Brassica napus [oilseed rape]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        207   1e-58   Sesamum indicum [beniseed]
ref|NP_179079.1|  vacuolar-sorting receptor 4                           207   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             207   2e-58   Populus euphratica
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             206   4e-58   Capsella rubella
gb|AAB72112.1|  vacuolar sorting receptor homolog                       206   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        206   5e-58   Cucumis melo [Oriental melon]
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    206   5e-58   
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        206   5e-58   Cucumis sativus [cucumbers]
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            206   5e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        206   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             205   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002489188.1|  hypothetical protein SORBIDRAFT_0013s004010        193   8e-58   
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             205   8e-58   Tarenaya hassleriana [spider flower]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        205   9e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        205   1e-57   Tarenaya hassleriana [spider flower]
gb|KJB12292.1|  hypothetical protein B456_002G010300                    205   1e-57   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                    204   1e-57   Gossypium raimondii
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             204   1e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        204   2e-57   Brassica rapa
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             204   2e-57   Camelina sativa [gold-of-pleasure]
gb|AEZ00905.1|  putative BP-80 vacuolar sorting receptor protein        194   2e-57   Elaeis guineensis
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             204   2e-57   Prunus persica
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        204   3e-57   Eucalyptus grandis [rose gum]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        203   5e-57   Populus euphratica
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        203   5e-57   Glycine max [soybeans]
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        203   5e-57   Camelina sativa [gold-of-pleasure]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             203   6e-57   Glycine soja [wild soybean]
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        203   6e-57   
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    202   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    202   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002885935.1|  VSR-2                                              202   9e-57   
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        202   9e-57   Pyrus x bretschneideri [bai li]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        202   1e-56   
ref|XP_003610620.1|  Vacuolar-sorting receptor                          202   2e-56   
gb|EAY78120.1|  hypothetical protein OsI_33166                          191   2e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             201   2e-56   Phaseolus vulgaris [French bean]
gb|AGV54776.1|  vacuolar-sorting receptor                               201   3e-56   Phaseolus vulgaris [French bean]
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220          200   4e-56   
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             200   5e-56   Populus trichocarpa [western balsam poplar]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    200   6e-56   Glycine max [soybeans]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             200   7e-56   Glycine soja [wild soybean]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    200   7e-56   Arabis alpina [alpine rockcress]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             200   9e-56   Phaseolus vulgaris [French bean]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        199   1e-55   Cicer arietinum [garbanzo]
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        199   2e-55   Phoenix dactylifera
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             198   4e-55   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    198   4e-55   Glycine max [soybeans]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             197   8e-55   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    197   9e-55   Glycine max [soybeans]
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    197   1e-54   Cicer arietinum [garbanzo]
ref|NP_001064400.1|  Os10g0346600                                       197   1e-54   
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    197   1e-54   
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        196   2e-54   Elaeis guineensis
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        196   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          195   3e-54   
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    195   4e-54   Pisum sativum [garden pea]
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  195   5e-54   Medicago truncatula
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        194   8e-54   Morus notabilis
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        194   9e-54   
ref|XP_008779827.1|  PREDICTED: vacuolar-sorting receptor 4-like        182   1e-53   
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        194   1e-53   Elaeis guineensis
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             192   4e-53   Fragaria vesca subsp. vesca
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like        192   7e-53   Cucumis sativus [cucumbers]
gb|ABR17683.1|  unknown                                                 192   9e-53   Picea sitchensis
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    189   9e-52   Cucumis melo [Oriental melon]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    189   1e-51   Cucumis melo [Oriental melon]
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              188   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        185   2e-50   Fragaria vesca subsp. vesca
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        184   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        183   8e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS68621.1|  Vacuolar-sorting receptor 4                             176   1e-49   Triticum urartu
gb|ACS91931.1|  vacuolar sorting receptor protein                       181   2e-49   Lilium longiflorum [Easter lily]
gb|EPS72755.1|  hypothetical protein M569_02000                         180   5e-49   Genlisea aurea
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        181   6e-49   
dbj|BAJ85815.1|  predicted protein                                      178   8e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN30885.1|  unknown                                                 180   9e-49   Zea mays [maize]
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     181   9e-49   Zea mays [maize]
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    180   1e-48   Ricinus communis
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        180   2e-48   Brachypodium distachyon [annual false brome]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    179   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    179   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             179   3e-48   Prunus persica
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like        177   4e-48   Populus euphratica
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    179   4e-48   Nicotiana sylvestris
ref|XP_002309184.1|  vacuolar sorting receptor family protein           178   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    178   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        178   7e-48   Populus euphratica
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        177   9e-48   Sesamum indicum [beniseed]
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             177   1e-47   Vitis vinifera
emb|CDP06387.1|  unnamed protein product                                177   1e-47   Coffea canephora [robusta coffee]
gb|EPS57970.1|  hypothetical protein M569_16845                         177   1e-47   Genlisea aurea
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230          177   2e-47   Amborella trichopoda
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             177   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    176   3e-47   Nicotiana sylvestris
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g             175   5e-47   
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        175   7e-47   Setaria italica
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        175   7e-47   Populus euphratica
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        175   1e-46   Sesamum indicum [beniseed]
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    174   2e-46   Nicotiana tomentosiformis
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        174   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        174   2e-46   Oryza brachyantha
gb|KDP21863.1|  hypothetical protein JCGZ_00650                         172   6e-46   Jatropha curcas
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        172   7e-46   Eucalyptus grandis [rose gum]
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    172   1e-45   Nicotiana tomentosiformis
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    171   1e-45   Solanum lycopersicum
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                171   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like        171   2e-45   Cucumis sativus [cucumbers]
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    171   2e-45   
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        171   2e-45   
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        171   2e-45   Elaeis guineensis
gb|KGN58685.1|  hypothetical protein Csa_3G728020                       160   3e-45   Cucumis sativus [cucumbers]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    171   3e-45   Solanum lycopersicum
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        171   3e-45   Solanum tuberosum [potatoes]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    171   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        171   3e-45   Phoenix dactylifera
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             170   4e-45   Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             170   4e-45   
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        169   1e-44   Phoenix dactylifera
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             169   1e-44   
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        168   2e-44   Morus notabilis
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          168   3e-44   Sorghum bicolor [broomcorn]
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                168   3e-44   
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             167   3e-44   Eutrema salsugineum [saltwater cress]
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             167   4e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        167   4e-44   
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    167   5e-44   
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               167   5e-44   Gossypium arboreum [tree cotton]
gb|ACN25155.1|  unknown                                                 162   5e-44   Zea mays [maize]
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    167   6e-44
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    167   6e-44   
ref|NP_190853.1|  vacuolar-sorting receptor 1                           166   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       166   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EEE52644.1|  hypothetical protein OsJ_35003                          166   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   1e-43   Prunus mume [ume]
gb|AAK82551.1|  AT3g52850/F8J2_20                                       166   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72113.1|  vacuolar sorting receptor homolog                       156   1e-43   
gb|EEE51529.1|  hypothetical protein OsJ_32728                          166   1e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                          166   1e-43   Oryza sativa Indica Group [Indian rice]
gb|EEC68730.1|  hypothetical protein OsI_37233                          166   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   2e-43   Nicotiana sylvestris
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   2e-43   Eucalyptus grandis [rose gum]
dbj|BAK03786.1|  predicted protein                                      166   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    165   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        165   3e-43   Oryza brachyantha
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             167   3e-43   Triticum urartu
ref|NP_001065992.1|  Os12g0116000                                       165   3e-43   
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        165   3e-43   Oryza brachyantha
gb|KJB71519.1|  hypothetical protein B456_011G126800                    165   4e-43   Gossypium raimondii
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             164   6e-43   Capsella rubella
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             166   6e-43   Triticum urartu
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             164   6e-43   Eutrema salsugineum [saltwater cress]
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    164   6e-43   Arabis alpina [alpine rockcress]
emb|CAN66483.1|  hypothetical protein VITISV_015390                     164   7e-43   Vitis vinifera
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        164   8e-43   Nicotiana tomentosiformis
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             164   9e-43   
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              163   9e-43   
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        163   1e-42   Zea mays [maize]
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             163   1e-42   Cucumis melo [Oriental melon]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               163   1e-42   Gossypium arboreum [tree cotton]
emb|CDX78128.1|  BnaA09g33230D                                          163   2e-42   
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        162   2e-42   Camelina sativa [gold-of-pleasure]
emb|CDY13344.1|  BnaC06g14130D                                          162   3e-42   Brassica napus [oilseed rape]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        162   3e-42   
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        162   3e-42   Brassica rapa
emb|CDX67539.1|  BnaA07g15790D                                          162   3e-42   
gb|EEC82690.1|  hypothetical protein OsI_27347                          162   3e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001060643.1|  Os07g0680000                                       162   3e-42   
gb|ACR34782.1|  unknown                                                 157   4e-42   Zea mays [maize]
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    161   5e-42   
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             161   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             161   6e-42   Citrus clementina [clementine]
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                161   6e-42   Erythranthe guttata [common monkey flower]
ref|NP_001050034.1|  Os03g0335300                                       161   7e-42   
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        160   1e-41   Oryza brachyantha
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    160   1e-41   Solanum tuberosum [potatoes]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        160   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252052.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    159   1e-41   
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             160   1e-41   Glycine soja [wild soybean]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        160   1e-41   Glycine max [soybeans]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    160   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_001777810.1|  predicted protein                                  160   2e-41   
emb|CDX73599.1|  BnaC08g24040D                                          160   2e-41   
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             160   2e-41   Brassica rapa
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        159   2e-41   Brassica rapa
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          159   2e-41   Sorghum bicolor [broomcorn]
emb|CDY60753.1|  BnaA05g34780D                                          159   2e-41   Brassica napus [oilseed rape]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        159   3e-41   Oryza brachyantha
dbj|BAK00302.1|  predicted protein                                      159   3e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004172174.1|  PREDICTED: vacuolar-sorting receptor 4-like        148   4e-41   
emb|CDY38158.1|  BnaA07g02250D                                          154   4e-41   Brassica napus [oilseed rape]
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    159   6e-41   
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    158   6e-41   Setaria italica
ref|XP_003626680.1|  Vacuolar sorting receptor                          158   7e-41   Medicago truncatula
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             158   8e-41   Phaseolus vulgaris [French bean]
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             158   8e-41   
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             158   9e-41   Selaginella moellendorffii
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             157   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX91478.1|  BnaC04g06720D                                          157   1e-40   
gb|KJB29888.1|  hypothetical protein B456_005G122400                    157   1e-40   Gossypium raimondii
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        157   2e-40   Solanum lycopersicum
emb|CDY04821.1|  BnaAnng00030D                                          157   2e-40   
emb|CDY62642.1|  BnaCnng40690D                                          147   2e-40   Brassica napus [oilseed rape]
gb|KJB32254.1|  hypothetical protein B456_005G231800                    156   2e-40   Gossypium raimondii
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             156   3e-40   
gb|EPS73119.1|  hypothetical protein M569_01632                         156   3e-40   Genlisea aurea
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1             156   3e-40   
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        156   4e-40   Glycine max [soybeans]
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        155   5e-40   Brachypodium distachyon [annual false brome]
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             155   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        155   8e-40   Glycine max [soybeans]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             155   8e-40   Glycine soja [wild soybean]
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             155   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        155   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        154   1e-39   Camelina sativa [gold-of-pleasure]
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    154   1e-39   Arabis alpina [alpine rockcress]
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             154   3e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             154   3e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             153   3e-39   
dbj|BAB64531.1|  vacuolar sorting receptor                              153   4e-39   Vigna mungo [urad dal]
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             153   5e-39   Phaseolus vulgaris [French bean]
gb|KJB29887.1|  hypothetical protein B456_005G122400                    153   6e-39   Gossypium raimondii
gb|KJB29886.1|  hypothetical protein B456_005G122400                    152   6e-39   Gossypium raimondii
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        152   6e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        152   7e-39   Cicer arietinum [garbanzo]
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like        152   9e-39   Pyrus x bretschneideri [bai li]
gb|ABR17707.1|  unknown                                                 151   2e-38   Picea sitchensis
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        151   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like        151   2e-38   Pyrus x bretschneideri [bai li]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           151   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          150   3e-38   Sorghum bicolor [broomcorn]
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like        150   3e-38   Malus domestica [apple tree]
ref|NP_001169232.1|  hypothetical protein precursor                     150   3e-38   Zea mays [maize]
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        150   4e-38   Cicer arietinum [garbanzo]
ref|XP_001759820.1|  predicted protein                                  150   4e-38   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             150   5e-38   Elaeis guineensis
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   150   6e-38   Zea mays [maize]
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like        150   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_003623631.1|  Vacuolar sorting receptor                          150   7e-38   Medicago truncatula
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like        149   1e-37   Phoenix dactylifera
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        149   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg             149   1e-37   Prunus persica
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7             149   1e-37   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like        148   2e-37   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        148   2e-37   Nicotiana tomentosiformis
gb|EMT02959.1|  Vacuolar-sorting receptor 4                             148   2e-37   
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             148   3e-37   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6             148   3e-37   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        148   3e-37   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6             148   3e-37   
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    147   4e-37   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like        147   5e-37   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    147   5e-37   
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    147   6e-37   
gb|KJB12294.1|  hypothetical protein B456_002G010300                    147   6e-37   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                        147   7e-37   
dbj|BAK05589.1|  predicted protein                                      148   9e-37   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180          146   2e-36   
emb|CBI27239.3|  unnamed protein product                                148   2e-36   
gb|AAG60258.1|  EGF receptor-like protein                               143   2e-36   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    145   3e-36   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7             145   3e-36   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        145   3e-36   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        144   5e-36   
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             144   5e-36   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        144   6e-36   
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        144   7e-36   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like        144   8e-36   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg             144   1e-35   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg             144   1e-35   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             143   1e-35   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like        143   1e-35   
gb|EEE61664.1|  hypothetical protein OsJ_16123                          143   1e-35   
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    143   2e-35   
ref|XP_001785165.1|  predicted protein                                  143   2e-35   
ref|NP_001053838.1|  Os04g0611400                                       143   2e-35   
emb|CAE03573.2|  OSJNBa0085I10.18                                       143   2e-35   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like        142   3e-35   
gb|KDP43132.1|  hypothetical protein JCGZ_26665                         142   4e-35   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg             142   4e-35   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6             142   5e-35   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like        142   5e-35   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g             142   5e-35   
ref|XP_001765481.1|  predicted protein                                  141   6e-35   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    141   8e-35   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like        141   9e-35   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5             141   9e-35   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5             140   1e-34   
ref|NP_174375.1|  vacuolar sorting receptor 6                           140   1e-34   
gb|KEH37345.1|  vacuolar-sorting receptor                               140   1e-34   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like        140   1e-34   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             140   1e-34   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg             140   2e-34   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7             140   2e-34   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg             140   2e-34   
emb|CDY50060.1|  BnaCnng18670D                                          140   2e-34   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    140   2e-34   
ref|XP_006853456.1|  hypothetical protein AMTR_s00032p00189440          140   2e-34   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             140   3e-34   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    139   3e-34   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7             139   3e-34   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    139   3e-34   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                    139   4e-34   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg                139   4e-34   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210             139   4e-34   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                        139   4e-34   
ref|NP_193744.1|  vacuolar-sorting receptor 7                           139   4e-34   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                  139   4e-34   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like        139   4e-34   
ref|XP_001776090.1|  predicted protein                                  139   5e-34   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               139   6e-34   
emb|CDY43178.1|  BnaCnng11060D                                          139   6e-34   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6             139   7e-34   
emb|CDY02347.1|  BnaA09g25550D                                          139   7e-34   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857             138   8e-34   
ref|XP_001759928.1|  predicted protein                                  138   8e-34   
emb|CDX78975.1|  BnaA01g10420D                                          138   8e-34   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    138   8e-34   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                    138   8e-34   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733             138   8e-34   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    138   9e-34   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like        138   9e-34   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like        138   1e-33   
gb|EEC81131.1|  hypothetical protein OsI_24020                          137   1e-33   
ref|NP_001058298.1|  Os06g0664300                                       138   1e-33   
gb|KHN26599.1|  Vacuolar-sorting receptor 6                             137   1e-33   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    137   2e-33   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg             137   2e-33   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg             137   2e-33   
ref|XP_002304606.1|  vacuolar sorting receptor family protein           137   2e-33   
gb|AFW87686.1|  vacuolar sorting receptor 7                             137   2e-33   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg             137   2e-33   
gb|ACN28195.1|  unknown                                                 137   2e-33   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              137   2e-33   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    137   3e-33   
gb|KJB48040.1|  hypothetical protein B456_008G051500                    137   3e-33   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like        136   3e-33   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6-like        136   4e-33   
emb|CDP18160.1|  unnamed protein product                                136   4e-33   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        136   6e-33   
gb|KDO64104.1|  hypothetical protein CISIN_1g0100102mg                  127   6e-33   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg             135   9e-33   
ref|XP_002528135.1|  hypothetical protein RCOM_1195900                  129   1e-32   
emb|CDY64650.1|  BnaAnng19540D                                          135   1e-32   
emb|CDY43647.1|  BnaA04g20440D                                          135   1e-32   
dbj|BAJ97179.1|  predicted protein                                      135   2e-32   
emb|CAA16619.1|  vacuolar sorting receptor-like protein                 134   2e-32   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        135   2e-32   
dbj|BAJ91572.1|  predicted protein                                      135   2e-32   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             134   5e-32   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like        133   6e-32   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    135   8e-32   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                        133   9e-32   
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    132   1e-31   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          132   1e-31   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6             131   3e-31   
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             132   3e-31   
ref|NP_181040.1|  vacuolar-sorting receptor 5                           131   3e-31   
gb|EMS55782.1|  Vacuolar-sorting receptor 7                             129   1e-30   
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             129   2e-30   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    126   1e-29   
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    126   2e-29   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                     126   2e-29   
ref|XP_001751750.1|  predicted protein                                  126   2e-29   
dbj|BAJ91429.1|  predicted protein                                      118   9e-29   
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        119   3e-27   
gb|AAF98196.1|AC000107_19  F17F8.23                                     119   7e-27   
dbj|BAJ88964.1|  predicted protein                                      118   1e-26   
gb|EYU23259.1|  hypothetical protein MIMGU_mgv1a0227551mg               112   1e-26   
gb|KJB71518.1|  hypothetical protein B456_011G126800                    112   2e-24   
dbj|BAD94353.1|  putative vacuolar sorting receptor                     103   2e-24   
gb|EPS72005.1|  hypothetical protein M569_02753                         109   1e-23   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                  101   1e-20   
gb|KJB48041.1|  hypothetical protein B456_008G051500                    100   3e-20   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  99.8    4e-20   
emb|CDP17487.1|  unnamed protein product                              97.1    2e-19   
emb|CDY12449.1|  BnaC08g09380D                                        93.6    5e-19   
gb|KDO64105.1|  hypothetical protein CISIN_1g0100102mg                85.9    8e-18   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)        90.5    6e-17   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site     90.9    6e-17   
ref|XP_001419041.1|  predicted protein                                84.3    5e-15   
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  83.6    1e-14   
ref|XP_002501531.1|  predicted protein                                79.7    2e-13   
gb|EMT15960.1|  hypothetical protein F775_17906                       75.9    2e-12   
gb|AFW64624.1|  hypothetical protein ZEAMMB73_291086                  70.9    2e-12   
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                 53.5    2e-11   
ref|XP_002501193.1|  predicted protein                                72.8    3e-11   
ref|XP_003064631.1|  predicted protein                                64.7    2e-08   
gb|EHB10201.1|  Nidogen-2                                             63.5    4e-08   
ref|XP_006006884.1|  PREDICTED: nidogen-1                             63.5    4e-08   
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                   43.9    6e-08   
ref|XP_004896014.1|  PREDICTED: nidogen-2 isoform X2                  62.8    8e-08   
ref|XP_004896015.1|  PREDICTED: nidogen-2 isoform X3                  62.8    8e-08   
ref|XP_004896013.1|  PREDICTED: nidogen-2 isoform X1                  62.8    8e-08   
ref|XP_004835594.1|  PREDICTED: nidogen-2 isoform X2                  62.8    8e-08   
ref|XP_004896016.1|  PREDICTED: nidogen-2 isoform X4                  62.8    8e-08   
ref|XP_006998028.1|  PREDICTED: nidogen-2                             62.0    1e-07   
ref|XP_005083640.1|  PREDICTED: nidogen-2                             61.2    2e-07   
gb|KJB32253.1|  hypothetical protein B456_005G231800                  60.8    2e-07   
ref|XP_006808769.1|  PREDICTED: nidogen-1-like                        60.8    3e-07   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335            60.8    3e-07   
ref|XP_004054829.1|  PREDICTED: growth arrest-specific protein 6      60.5    4e-07   
ref|XP_004649240.1|  PREDICTED: nidogen-2                             60.1    5e-07   
ref|XP_007551563.1|  PREDICTED: nidogen-1                             59.7    7e-07   
ref|XP_005795282.1|  PREDICTED: nidogen-1-like                        59.7    8e-07   
ref|XP_007885762.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.7    8e-07   
ref|XP_007885758.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.7    9e-07   
ref|XP_007885760.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.3    9e-07   
ref|XP_007885759.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.3    9e-07   
ref|XP_011479398.1|  PREDICTED: nidogen-1-like                        59.7    9e-07   
ref|XP_008300391.1|  PREDICTED: nidogen-1-like                        59.3    1e-06   
ref|XP_007885761.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.3    1e-06   
ref|XP_007885765.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.3    1e-06   
ref|XP_007892037.1|  PREDICTED: nidogen-1                             59.3    1e-06   
ref|XP_007885763.1|  PREDICTED: signal peptide, CUB and EGF-like ...  59.3    1e-06   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100           58.2    2e-06   
ref|XP_003282370.2|  PREDICTED: uncharacterized protein LOC100592646  58.2    3e-06   
ref|XP_001750392.1|  hypothetical protein                             58.2    3e-06   
ref|XP_006872431.1|  PREDICTED: nidogen-2                             58.2    3e-06   
ref|XP_007502851.1|  PREDICTED: signal peptide, CUB domain, EGF-l...  57.4    4e-06   
ref|XP_006937146.1|  PREDICTED: signal peptide, CUB and EGF-like ...  57.4    5e-06   
ref|XP_007083259.1|  PREDICTED: signal peptide, CUB and EGF-like ...  57.4    5e-06   
ref|XP_008052766.1|  PREDICTED: signal peptide, CUB and EGF-like ...  57.4    5e-06   
ref|XP_005808219.1|  PREDICTED: signal peptide, CUB and EGF-like ...  57.4    5e-06   
gb|EYF00643.1|  Fibrillin-1 precursor protein                         57.0    5e-06   
ref|XP_005461388.1|  PREDICTED: nidogen-1-like isoform X1             57.0    6e-06   
ref|XP_003781560.1|  PREDICTED: signal peptide, CUB and EGF-like ...  57.0    6e-06   
ref|XP_006937147.1|  PREDICTED: signal peptide, CUB and EGF-like ...  57.0    6e-06   
ref|XP_005958543.1|  PREDICTED: signal peptide, CUB and EGF-like ...  54.3    6e-06   
ref|XP_005724384.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    7e-06   
ref|XP_006780244.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    7e-06   
ref|XP_005936562.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    7e-06   
ref|XP_004470346.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    7e-06   
ref|XP_005936561.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_005936560.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_005936563.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_004543222.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_004543223.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_006780242.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_005936559.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_006633159.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_005936564.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_006780243.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_005467054.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_005936565.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    8e-06   
ref|XP_004572433.1|  PREDICTED: nidogen-1-like                        56.6    8e-06   
ref|XP_005753342.1|  PREDICTED: nidogen-1-like                        56.6    9e-06   
ref|XP_005950478.1|  PREDICTED: nidogen-1-like                        56.6    9e-06   
ref|XP_007444806.1|  PREDICTED: uncharacterized protein LOC103052886  56.2    1e-05   
ref|XP_966993.2|  PREDICTED: fibulin-2-like                           56.6    1e-05   
gb|EFA11450.1|  hypothetical protein TcasGA2_TC013635                 56.2    1e-05   
ref|XP_011377898.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    1e-05   
ref|XP_004418707.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    1e-05   
ref|XP_005326918.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    1e-05   
ref|XP_007233666.1|  PREDICTED: signal peptide, CUB and EGF-like ...  53.5    1e-05   
gb|EPQ12518.1|  Signal peptide, CUB and EGF-like domain-containin...  56.2    1e-05   
ref|XP_004369689.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    1e-05   
dbj|BAG64249.1|  unnamed protein product                              55.8    1e-05   
ref|XP_010902658.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    1e-05   
ref|XP_004900658.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    1e-05   
ref|XP_008955770.1|  PREDICTED: growth arrest-specific protein 6 ...  55.8    1e-05   
ref|XP_010786589.1|  PREDICTED: nidogen-1                             55.8    1e-05   
gb|KFO18726.1|  Signal peptide, CUB and EGF-like domain-containin...  55.8    1e-05   
ref|XP_006873053.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    2e-05   
ref|XP_863502.1|  PREDICTED: signal peptide, CUB domain, EGF-like...  55.8    2e-05   
ref|XP_010613606.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    2e-05   



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+GHTYSACV +EEGKC+CPPGFKGDG KSCED+DECKDK ACQCPECSCKNTWGSY+C
Sbjct  487  TRDGHTYSACVDNEEGKCSCPPGFKGDGFKSCEDVDECKDKKACQCPECSCKNTWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  547  SCSGDLLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVSD RA
Sbjct  607  RAIMAQYMPLDSQNEVPNHVSDERA  631



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+GHTYSACV +EEGKC+CPPGFKGDG KSC+DIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  487  TRDGHTYSACVDNEEGKCSCPPGFKGDGVKSCDDIDECKEKKACQCPECSCKNTWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  547  SCSGDLLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVSD RA
Sbjct  607  RAIMAQYMPLDSQNEVPNHVSDERA  631



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+GHT+SACV +EEGKC+CPPGFKGDG KSCEDIDEC++K ACQCPECSCKNTWGSY+C
Sbjct  486  TRDGHTFSACVDNEEGKCSCPPGFKGDGVKSCEDIDECREKKACQCPECSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  546  SCSGELLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+ NHV++  A
Sbjct  606  RAIMAQYMPLDSQSEVQNHVNEDHA  630



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNGHT+SAC  +  GKC CPPGFKGDG KSCEDIDECK+K ACQCP+CSCKNTWGSYDC
Sbjct  489  SRNGHTFSACSDANGGKCECPPGFKGDGVKSCEDIDECKEKKACQCPDCSCKNTWGSYDC  548

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISKR T+V+SAWAA WVILIGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  549  TCSGDLLYIRDHDTCISKRGTEVRSAWAAFWVILIGLAMAAGGAYLVYKYRLRSYMDSEI  608

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  609  RAIMAQYMPLDSQAEVPNHVNDERA  633



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+GHT+SACV +EEGKCTCPPGFKGDG KSCEDIDEC++K ACQCPECSCKNTWGSY+C
Sbjct  486  TRDGHTFSACVDNEEGKCTCPPGFKGDGVKSCEDIDECREKKACQCPECSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  546  SCSGELLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+ +HV++  A
Sbjct  606  RAIMAQYMPLDSQNEVQSHVNEGHA  630



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECSCKNTWGSY+C
Sbjct  487  SKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKNTWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  547  TCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  607  RAIMAQYMPLDSQSEVPNHVNDERA  631



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             R+GH YSAC+    GKC CPPGFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  486  ARDGHAYSACLDDGNGKCQCPPGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK  T+V+S+WAAVWVILIGL + +GGAYL+YKYRLRSYMD+EI
Sbjct  546  TCSGDLLYIRDHDTCISKSGTEVRSSWAAVWVILIGLAMASGGAYLIYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVSDSRA
Sbjct  606  RAIMAQYMPLDSQAEVPNHVSDSRA  630



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECSCK+TWGSY+C
Sbjct  487  SKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  547  TCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  607  RAIMAQYMPLDSQSEVPNHVNDERA  631



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECSCK+TWGSY+C
Sbjct  485  SKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  545  TCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  605  RAIMAQYMPLDSQSEVPNHVNDERA  629



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECSCK+TWGSY+C
Sbjct  487  SKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  547  TCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  607  RAIMAQYMPLDSQSEVPNHVNDERA  631



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G ++SAC+  E GKC CPPGFKGDG KSCED+DECK+K ACQC ECSCKNTWGSYDC
Sbjct  486  TRDGRSFSACMDHEGGKCACPPGFKGDGVKSCEDVDECKEKKACQCAECSCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISKRAT+VKS WAAVWVILIGLG+  GGAYLVYKYR RSYMD+EI
Sbjct  546  SCSGDLLYIRDHDTCISKRATEVKSGWAAVWVILIGLGMAGGGAYLVYKYRWRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVSD RA
Sbjct  606  RAIMAQYMPLDSQNEVPNHVSDDRA  630



>gb|AAF22842.1|AF209910_1 vacuolar sorting receptor protein [Prunus dulcis]
Length=159

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             R+GH +SAC  + E +C CP GFKGDG KSCED+DECK+K ACQCPEC+CKNTWGSYDC
Sbjct  15   ARDGHAFSACTDNGEVQCQCPHGFKGDGVKSCEDVDECKEKKACQCPECTCKNTWGSYDC  74

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  75   SCSGNLLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEI  134

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  135  RAIMAQYMPLDSQAEVPNHVNDERA  159



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNGHT+SAC   E  KC CP GFKGDG + CEDIDECKD+TACQCPEC+CKNTWGSYDC
Sbjct  486  SRNGHTFSACSDVEGTKCQCPTGFKGDGTTKCEDIDECKDRTACQCPECNCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISKR T+V+SAWAA WVILIGLG+ AGG YL+YKYRLRSYMD+EI
Sbjct  546  TCSGDLLYIRDHDTCISKRGTEVRSAWAAFWVILIGLGMAAGGGYLIYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  606  RAIMAQYMPLDSQAEVPNHVNDERA  630



>gb|KHG15071.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=418

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNG  YSAC+ + + KC CPPGFKGDG KSCEDIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  274  SRNGRAYSACLDNGDVKCQCPPGFKGDGVKSCEDIDECKEKRACQCPECSCKNTWGSYEC  333

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TC+  LLYIRDHDTCISK  T+V+SAWAA+WVILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  334  TCNGDLLYIRDHDTCISKSGTEVRSAWAAMWVILIGLAMAGGGAYLVYKYRLRSYMDSEI  393

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q E+PNHVS+ RA
Sbjct  394  RAIMAQYMPLDSQGEVPNHVSNDRA  418



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+GH YSAC+   + KC CPPGFKGDG KSCED+DEC +K ACQCPECSCKNTWGSY+C
Sbjct  482  SRDGHAYSACLGIGDSKCQCPPGFKGDGVKSCEDVDECNEKKACQCPECSCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK  T+V+SAWAAVWVI+IGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  542  TCSGDLLYIRDHDTCISKSGTEVRSAWAAVWVIVIGLAMAAGGAYLVYKYRLRSYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVS+ RA
Sbjct  602  RAIMAQYMPLDSQAEVPNHVSEDRA  626



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHTYSACV + + KC CPPGF+GDG  SC+DIDECK+K ACQCPECSCK+TWGSY+C
Sbjct  484  SQDGHTYSACVDTGDVKCQCPPGFRGDGINSCDDIDECKEKKACQCPECSCKDTWGSYEC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK  T+VKSAWAAVWVILIGL + +GGAYLVYKYRLRSYMD+EI
Sbjct  544  TCSGDLLYIRDHDTCISKSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  604  RAIMAQYMPLDSQSEVPNHVSEDRA  628



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G T+SACV  E  KC CPPGF+GDG KSCEDIDECK+K  CQCPECSCKNTWGSYDC
Sbjct  491  TRDGKTFSACVDVEGSKCKCPPGFRGDGVKSCEDIDECKEKKRCQCPECSCKNTWGSYDC  550

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISKRA +VK+AWAAVWVILIGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  551  TCSGELLYIRDHDTCISKRAGEVKTAWAAVWVILIGLAIAAGGAYLVYKYRLRSYMDSEI  610

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q+E+PNHV   R
Sbjct  611  RAIMAQYMPLDSQTEVPNHVGHDR  634



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHTYSACV + + KC CPPGF+GDG  +CEDIDECK+K ACQCPECSCK+TWGSY+C
Sbjct  484  SQDGHTYSACVDTGDVKCQCPPGFRGDGINNCEDIDECKEKKACQCPECSCKDTWGSYEC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK  T+VKSAWAAVWVILIGL + +GGAYLVYKYRLRSYMD+EI
Sbjct  544  TCSGDLLYIRDHDTCISKSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  604  RAIMAQYMPLDSQSEVPNHVSEDRA  628



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++G ++SAC+  + GKC CPPGFKGDG KSC+D+DECK+K ACQCPECSCKNTWGSY+C
Sbjct  487  SQDGQSFSACLDIDGGKCECPPGFKGDGVKSCKDVDECKEKKACQCPECSCKNTWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISKRAT+VKSAWAAVWVILIGL +   GAYLVYKYR+RSYMD+EI
Sbjct  547  TCSGDLLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVS+  A
Sbjct  607  RAIMAQYMPLDSQTEVPNHVSEDHA  631



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 132/146 (90%), Gaps = 2/146 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGD--GKSCEDIDECKDKTACQCPECSCKNTWGSYD  584
            T++G T+SACV +EEGKC CPPGFKGD   KSCEDIDECK+K ACQCP+CSCKNTWGSY+
Sbjct  486  TKDGITFSACVDNEEGKCQCPPGFKGDDGAKSCEDIDECKEKKACQCPDCSCKNTWGSYE  545

Query  583  CTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            CTC   LLYIRDHDTCISKRA++VKSAW AVW+IL+GLG+ AGGAYLVYK+RLRSYMD+E
Sbjct  546  CTCGGDLLYIRDHDTCISKRASEVKSAWTAVWIILLGLGMAAGGAYLVYKHRLRSYMDSE  605

Query  403  IRAIMAQYMPLDNQSEIPNHVSDSRA  326
            IRAIMAQYMPLD+Q+E+ NHV+D RA
Sbjct  606  IRAIMAQYMPLDSQNEVQNHVNDERA  631



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNG T+SACV +EEGKCTCPPGF+GDG KSC DIDECK+K ACQCPECSCKNTWGSY+C 
Sbjct  487  RNGITFSACVDNEEGKCTCPPGFRGDGVKSCVDIDECKEKKACQCPECSCKNTWGSYECA  546

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIR+HDTCISK   +VKSAW AVW+ILIGL + AGGAYLVYKYRLRSYMD+EIR
Sbjct  547  CSGDLLYIREHDTCISKTTAEVKSAWTAVWIILIGLAMAAGGAYLVYKYRLRSYMDSEIR  606

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV + RA
Sbjct  607  AIMAQYMPLDSQNEVPNHVHEDRA  630



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++G ++SAC+  + GKC CPPGFKGDG KSC+D+DECK+K ACQCPECSCKNTWGSY+C
Sbjct  492  SQDGQSFSACLDIDGGKCECPPGFKGDGVKSCKDVDECKEKKACQCPECSCKNTWGSYEC  551

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISKRAT+VKSAWAAVWVILIGL +   GAYLVYKYR+RSYMD+EI
Sbjct  552  TCSGDLLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRSYMDSEI  611

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHVS+  A
Sbjct  612  RAIMAQYMPLDSQTEVPNHVSEDHA  636



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  555  RDGHAFSACVDKDIVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECS  614

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS GLLYIRDHDTCISK   QVKSAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  615  CSGGLLYIRDHDTCISKTGAQVKSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  674

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q EIPNHV+D RA
Sbjct  675  AIMAQYMPLDSQPEIPNHVNDERA  698



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  485  RDGHAFSACVDKDSVKCECPPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECS  544

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  545  CSGDLLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  604

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q EIPNHV+D RA
Sbjct  605  AIMAQYMPLDSQPEIPNHVNDERA  628



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSYDC+
Sbjct  481  RDGHAFSACVDKDSVKCECPPGFKGDGFKKCEDINECKEKKACQCPECSCKNTWGSYDCS  540

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  541  CSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  600

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D RA
Sbjct  601  AIMAQYMPLDSQPEVPNHVNDERA  624



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            ++GH +SAC  + E +C CPPGFKGDG KSCED+DECK+K ACQCPECSCKNTWGSYDC+
Sbjct  486  QDGHAFSACTDTGEVQCQCPPGFKGDGVKSCEDVDECKEKKACQCPECSCKNTWGSYDCS  545

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIR
Sbjct  546  CSGNLLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIR  605

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  606  AIMAQYMPLDSQAEVPNHVNDERA  629



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  467  RDGHVFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  526

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+RLR YMD+EIR
Sbjct  527  CSGDLLYIRDHDTCISKIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHRLRQYMDSEIR  586

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLDNQ E+PNHV+D RA
Sbjct  587  AIMAQYMPLDNQPEVPNHVNDERA  610



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  484  RDGHAFSACVDKDSVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECS  543

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  544  CSGDLLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  603

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D RA
Sbjct  604  AIMAQYMPLDSQPEVPNHVNDERA  627



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  488  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  547

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+RLR YMD+EIR
Sbjct  548  CSGDLLYIRDHDTCISKTGSQVKSAWTAVWLIVLSLGLAAGGAYLVYKHRLRQYMDSEIR  607

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLDNQ E+PNHV+D RA
Sbjct  608  AIMAQYMPLDNQPEVPNHVNDERA  631



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGF+GDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  483  RDGHAFSACVDKDSVKCECPPGFRGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYIRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRRYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q EIPNHV+D RA
Sbjct  603  AIMAQYMPLDSQPEIPNHVNDERA  626



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  488  RDGHVFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  547

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+RLR YMD+EIR
Sbjct  548  CSGDLLYIRDHDTCISKIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHRLRQYMDSEIR  607

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLDNQ E+PNHV+D RA
Sbjct  608  AIMAQYMPLDNQPEVPNHVNDERA  631



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G T+SACV  E  KC CPPGF GDG KSCEDIDECK+K ACQCPECSC N WGSY+C
Sbjct  490  TRDGKTFSACVDVENSKCQCPPGFIGDGVKSCEDIDECKEKKACQCPECSCNNIWGSYEC  549

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISKRA++ K+AW AVWVI IGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  550  TCSGELLYIRDHDTCISKRASETKTAWTAVWVIFIGLAMAAGGAYLVYKYRLRSYMDSEI  609

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+++PNH S+ RA
Sbjct  610  RAIMAQYMPLDSQTDVPNHASEDRA  634



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  484  RDGHAFSACVDKDSVKCECPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECS  543

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK   QV+SAWAA+W+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  544  CSGDLLYIRDHDTCISKTGAQVRSAWAAIWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  603

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D RA
Sbjct  604  AIMAQYMPLDSQPEVPNHVNDERA  627



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  481  RDGHAFSACVDKDSVKCECPPGFKGDGFKKCEDINECKEKKACQCPECSCKNTWGSYECS  540

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  541  CSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  600

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D RA
Sbjct  601  AIMAQYMPLDSQPEVPNHVNDERA  624



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNG  +SACV +EEGKCTCPPGFKGDG  SCEDIDECK K ACQCPECSCKNTWGSY+C
Sbjct  486  SRNGVAFSACVDNEEGKCTCPPGFKGDGVNSCEDIDECKQKKACQCPECSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TC   LLYIRDHDTCISK  T+VKSAW AVW+ILI L + AGGAY+VYK RLRSYMD+EI
Sbjct  546  TCGGDLLYIRDHDTCISK-TTEVKSAWTAVWIILIALALAAGGAYVVYKRRLRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  605  RAIMAQYMPLDSQNEVPNHVDEDRA  629



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  485  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  544

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  545  CSGDLLYMRDHDTCISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  604

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNH +D RA
Sbjct  605  AIMAQYMPLDSQPEVPNHTNDERA  628



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+GH +SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQCP CSCKNTWGSY+C
Sbjct  486  SRDGHAFSACLDVDGGKCQCPPGFKGDGVKSCVDVDECKERKACQCPACSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK  T+V+SAWAAVWVIL+GL +  GG YL+YKYRLRSYMD+EI
Sbjct  546  SCSGDLLYIRDHDTCISKSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q+E+PNHV D R
Sbjct  606  RAIMAQYMPLDSQAEVPNHVHDER  629



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            ++GH +SACV  +  KC CPPGFKGDG K CEDIDECK+K ACQCPECSCKNTWGSY+C+
Sbjct  486  KDGHAFSACVDKDSVKCECPPGFKGDGTKKCEDIDECKEKKACQCPECSCKNTWGSYECS  545

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  546  CSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  605

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D  A
Sbjct  606  AIMAQYMPLDSQPEVPNHVNDEHA  629



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  487  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  546

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +QVKSAWA VW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  547  CSGDLLYMRDHDTCISKTGSQVKSAWAGVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  606

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNH +D RA
Sbjct  607  AIMAQYMPLDSQPEVPNHTNDERA  630



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGHT+SAC      KC+CPPGFKGDG KSCEDIDEC++K ACQCPECSCKNTWGSYDC
Sbjct  487  TRNGHTFSACTDDGNVKCSCPPGFKGDGVKSCEDIDECQEKKACQCPECSCKNTWGSYDC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  547  SCSGDLLYIRDHDTCISK-ASSGRSAWTAVWVILIGLVMAAGGAYLVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PN+V+++RA
Sbjct  606  RAIMAQYMPLDSQAEVPNYVNENRA  630



>ref|XP_004159916.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 3-like 
[Cucumis sativus]
Length=631

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGHT+SAC      KC+CPPGFKGDG KSCEDIDEC++K ACQCPECSCKNTWGSYDC
Sbjct  488  TRNGHTFSACTDDGNVKCSCPPGFKGDGVKSCEDIDECQEKKACQCPECSCKNTWGSYDC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  548  SCSGDLLYIRDHDTCISK-ASSGRSAWTAVWVILIGLTMAAGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PN+V+++RA
Sbjct  607  RAIMAQYMPLDSQAEVPNYVNENRA  631



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGHT+SAC      KC+CPPGFKGDG KSCEDIDEC++K ACQCPECSCKNTWGSYDC
Sbjct  488  TRNGHTFSACTDDGNVKCSCPPGFKGDGVKSCEDIDECQEKKACQCPECSCKNTWGSYDC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  548  SCSGDLLYIRDHDTCISK-ASSGRSAWTAVWVILIGLTMAAGGAYLVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PN+V+++RA
Sbjct  607  RAIMAQYMPLDSQAEVPNYVNENRA  631



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+GHT+SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQC  CSCKNTWGSY+C
Sbjct  486  SRDGHTFSACLDVDGGKCQCPPGFKGDGVKSCVDVDECKERKACQCSACSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK  T+V+SAWAAVWVIL+GL +  GG YL+YKYRLRSYMD+EI
Sbjct  546  SCSGDLLYIRDHDTCISKSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q+E+PNHV D R
Sbjct  606  RAIMAQYMPLDSQAEVPNHVHDER  629



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  483  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D  A
Sbjct  603  AIMAQYMPLDSQPEVPNHVNDEHA  626



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  483  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYMRDHDTCISKTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D  A
Sbjct  603  AIMAQYMPLDSQPEVPNHVNDEHA  626



>ref|XP_002489188.1| hypothetical protein SORBIDRAFT_0013s004010 [Sorghum bicolor]
 gb|EES20283.1| hypothetical protein SORBIDRAFT_0013s004010 [Sorghum bicolor]
Length=165

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S +GKC CP GF+GDG K CEDIDECK++ ACQC EC+C++TWG YDC
Sbjct  20   TRNGKTFSACQESGDGKCRCPAGFRGDGVKQCEDIDECKERKACQCSECNCRDTWGGYDC  79

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIR+HDTCISK   Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EI
Sbjct  80   TCSGDLLYIREHDTCISKTTVQAKAAWAAVWGILIVVAVVAVGSYVVYKYRLRSYMDSEI  139

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLDNQ ++PNH  D
Sbjct  140  RAIMAQYMPLDNQGDVPNHTHD  161



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH +SACV  +  KC CPPGFKGDG   CEDIDECK+K ACQCPECSCKNTWGSY+C+
Sbjct  492  RNGHAFSACVGKDSAKCQCPPGFKGDGVNKCEDIDECKEKKACQCPECSCKNTWGSYECS  551

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK  +QV+SAWAAVW+IL+ L + A GAYLVYKYRLR YMD+EIR
Sbjct  552  CSGDLLYIRDHDTCISKTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYRLRQYMDSEIR  611

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NH+ D RA
Sbjct  612  AIMAQYMPLDSQPEVHNHLDDERA  635



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  483  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYMRDHDTCISKTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D  A
Sbjct  603  AIMAQYMPLDSQPEVPNHVNDEHA  626



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH +SACV  +  KC CPPGFKGDG   CEDIDECK+K ACQCPECSCKNTWGSY+C+
Sbjct  492  RNGHAFSACVGKDSAKCQCPPGFKGDGVNKCEDIDECKEKKACQCPECSCKNTWGSYECS  551

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK  +QV+SAWAAVW+IL+ L + A GAYLVYKYRLR YMD+EIR
Sbjct  552  CSGDLLYIRDHDTCISKTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYRLRQYMDSEIR  611

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NH+ D RA
Sbjct  612  AIMAQYMPLDSQPEVHNHLDDDRA  635



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            ++NG  YSAC+ + + KC CPPGFKGDG KSCEDIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  485  SQNGSAYSACLDNGDVKCQCPPGFKGDGVKSCEDIDECKEKRACQCPECSCKNTWGSYEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TC+  LLYIRDHDTCISK  T+V+SAWAA+ VILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  545  TCNGDLLYIRDHDTCISKSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKYRLRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q E+PNHVS+ RA
Sbjct  605  RAIMAQYMPLDSQGEVPNHVSNDRA  629



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            ++NG  YSAC+ + + KC CPPGFKGDG KSCEDIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  480  SQNGSAYSACLDNGDVKCQCPPGFKGDGVKSCEDIDECKEKRACQCPECSCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TC+  LLYIRDHDTCISK  T+V+SAWAA+ VILIGL +  GGAYLVYKYRLRSYMD+EI
Sbjct  540  TCNGDLLYIRDHDTCISKSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKYRLRSYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q E+PNHVS+ RA
Sbjct  600  RAIMAQYMPLDSQGEVPNHVSNDRA  624



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  488  RDGHAFSACVDKDSVKCQCPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECS  547

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  548  CSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  607

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NHV+D RA
Sbjct  608  AIMAQYMPLDSQPEVANHVNDERA  631



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+ H +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  481  RDRHAFSACVDKDSVKCECPPGFKGDGFKKCEDINECKEKKACQCPECSCKNTWGSYECS  540

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  541  CSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  600

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+PNHV+D RA
Sbjct  601  AIMAQYMPLDSQPEVPNHVNDERA  624



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  483  RDGHAFSACVDKDSVKCECPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NHV+D RA
Sbjct  603  AIMAQYMPLDSQPEVQNHVNDERA  626



>gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein, partial [Elaeis 
guineensis]
Length=243

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T NG T+SAC  + + KC CP GFKGDG K+C DIDECK+KTACQCPECSCKNTWGSY+C
Sbjct  98   THNGKTFSACQDTGDSKCKCPLGFKGDGIKTCADIDECKEKTACQCPECSCKNTWGSYEC  157

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS GLLY+R+HDTCISK A++ K+ W A+W+IL  L   A GA++VYKYRLRSYMD+EI
Sbjct  158  TCSGGLLYMREHDTCISKTASEAKATWTALWLILGLLAFAAFGAFIVYKYRLRSYMDSEI  217

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH ++
Sbjct  218  RAIMAQYMPLDSQGEVPNHANE  239



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            ++GH +SAC  + E +C CP GFKGDG KSCED+DECK+K ACQCPEC+CKNTWGSYDC+
Sbjct  486  QDGHAFSACTDNGEVQCQCPHGFKGDGVKSCEDVDECKEKKACQCPECTCKNTWGSYDCS  545

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIR
Sbjct  546  CSGNLLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIR  605

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  606  AIMAQYMPLDSQAEVPNHVNDERA  629



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            ++NG +YSAC+     KC CP GFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  500  SQNGQSYSACLDFGNSKCQCPRGFKGDGVKTCEDIDECKEKKACQCPECSCKNTWGSYEC  559

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIRDHDTCISK +T+ KSAWAAVWVI+IGL +  GG YLVYKYRLRSYMD+EI
Sbjct  560  TCSGDLLYIRDHDTCISKSSTETKSAWAAVWVIVIGLAMAGGGGYLVYKYRLRSYMDSEI  619

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV++  A
Sbjct  620  RAIMAQYMPLDSQAEVPNHVNEVHA  644



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+GHT SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQCP CSCKNTWGSY+C
Sbjct  486  SRDGHTLSACLDVDGGKCHCPPGFKGDGVKSCVDVDECKERKACQCPACSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK  T+VKSAW  VWVI IGL + AGG YLVYK++LRSYMD+EI
Sbjct  546  SCSGDLLYIRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  606  RAIMAQYMPLDSQAEVPNHVHEERA  630



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGH +SAC+ +   KC CP GF+GDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC
Sbjct  484  TRNGHAFSACLDNGGVKCQCPTGFRGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EI
Sbjct  544  SCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  604  RAIMAQYMPLDSQAEVPNHVNDQRA  628



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K C+DI+ECK+K ACQCPECSCKNTWGSY+C+
Sbjct  486  RDGHAFSACVDKDSVKCECPPGFKGDGIKKCDDINECKEKKACQCPECSCKNTWGSYECS  545

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  546  CSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  605

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NHV+D RA
Sbjct  606  AIMAQYMPLDSQPEVQNHVNDERA  629



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGH +SAC+ +   KC CP GF+GDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC
Sbjct  484  TRNGHAFSACLDNGGVKCQCPTGFRGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EI
Sbjct  544  SCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  604  RAIMAQYMPLDSQAEVPNHVNDQRA  628



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             R+GH ++AC  + E +C CPPGFKGDG KSCEDIDECK++ ACQCPECSCKNTWGSYDC
Sbjct  484  ARDGHAFTACTDNGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKNTWGSYDC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLYIRDHDTCISK +   KSAW AVWVIL+GL + AGGAYLVYKYRLRSYMD+EI
Sbjct  544  SCGGNLLYIRDHDTCISKASGGGKSAWVAVWVILLGLAMAAGGAYLVYKYRLRSYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q+E+PNHV++ R
Sbjct  604  RAIMAQYMPLDSQAEVPNHVNEER  627



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGS++C+
Sbjct  483  RDGHAFSACVDKDIVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSFECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NHV+D RA
Sbjct  603  AIMAQYMPLDSQPEVQNHVNDERA  626



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSCKNTWGS++C+
Sbjct  483  RDGHAFSACVDKDIVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSFECS  542

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIR
Sbjct  543  CSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E+ NHV+D RA
Sbjct  603  AIMAQYMPLDSQPEVQNHVNDERA  626



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K  CQCPECSCKNTWGSY+C+
Sbjct  484  RDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKTCQCPECSCKNTWGSYECS  543

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHD CISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIR
Sbjct  544  CSGDLLYMRDHDACISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIR  603

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q EIPNH +D  A
Sbjct  604  AIMAQYMPLDSQPEIPNHANDEHA  627



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             R+GH ++AC  + E +C CPPGFKGDG KSCEDIDECK++ ACQCPECSCK+TWGSY+C
Sbjct  484  ARDGHAFTACTENGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKDTWGSYEC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHDTCISK +   KSAW AVW+IL+GL + AGGAYLVYKYRLRSYMD+EI
Sbjct  544  SCSGNLLYIRDHDTCISKASGGGKSAWVAVWIILLGLAMAAGGAYLVYKYRLRSYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV++ RA
Sbjct  604  RAIMAQYMPLDSQAEVPNHVNEERA  628



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH ++AC  + E +C CPPGFKGDG KSCEDIDECK++ ACQCPECSCK+TWGSY+C+
Sbjct  485  RDGHAFTACTDNGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKDTWGSYECS  544

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIRDHDTCISK +   KSAW AVW+IL+GL + AGGAYLVYKYRLRSYMD+EIR
Sbjct  545  CSGNLLYIRDHDTCISKASGGGKSAWVAVWIILLGLAMAAGGAYLVYKYRLRSYMDSEIR  604

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV++ RA
Sbjct  605  AIMAQYMPLDSQAEVPNHVNEERA  628



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH +SAC+     KC CP GFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC+
Sbjct  479  RNGHAFSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCS  538

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYI+DHDTCISK A+Q KS WAA WVILIGLG++AGG +LVYKYR+R YMD+EIR
Sbjct  539  CSGDLLYIKDHDTCISKTASQAKSTWAAFWVILIGLGMIAGGGFLVYKYRIRQYMDSEIR  598

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+  RA
Sbjct  599  AIMAQYMPLDSQAEVPNHVNHQRA  622



>gb|EAY78120.1| hypothetical protein OsI_33166 [Oryza sativa Indica Group]
Length=215

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S  GKC CP GF+GDG K CEDI+ECK+K ACQC ECSC++TWG Y+C
Sbjct  70   TRNGKTFSACQESGNGKCQCPAGFRGDGVKKCEDINECKEKKACQCRECSCRDTWGDYEC  129

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYRLRSYMD+EI
Sbjct  130  TCSGDLLYIKEHDTCISKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEI  189

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH +D
Sbjct  190  RAIMAQYMPLDSQGEVPNHTND  211



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNGH +SAC+ +   KC CP GFKGDG K+CEDIDECK+K ACQCP+CSCKNTWGSYDC
Sbjct  482  SRNGHAFSACLDNGGVKCQCPTGFKGDGVKNCEDIDECKEKKACQCPDCSCKNTWGSYDC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EI
Sbjct  542  SCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  602  RAIMAQYMPLDSQAEVPNHVNDQRA  626



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNGH +SAC+ +   KC CP GFKGDG K+CEDIDECK+K ACQCP+CSCKNTWGSYDC
Sbjct  481  SRNGHAFSACLDNGGVKCQCPTGFKGDGVKNCEDIDECKEKKACQCPDCSCKNTWGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EI
Sbjct  541  SCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  601  RAIMAQYMPLDSQAEVPNHVNDQRA  625



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G  +SAC+ + +  C CP GF+GDG KSCEDIDECK+K ACQCPECSCK+TWG Y+C
Sbjct  467  TRKGKAFSACMETLDKGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSCKDTWGGYEC  526

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI DHDTCISK A QVK+AWAA+WVI IGL V A GAY+VYKYRL+SYMD+EI
Sbjct  527  TCSGDLLYITDHDTCISKSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYRLKSYMDSEI  586

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  587  RAIMAQYMPLDSQSEVPNHVSEERA  611



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++GHT+SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQCP CSCK+TWGSY+C
Sbjct  486  SQDGHTFSACLDVDGGKCQCPPGFKGDGVKSCLDVDECKERKACQCPACSCKDTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHDTCISK  T+VKSAW  VWVI IGL + AGG YLVYK++LRSYMD+EI
Sbjct  546  SCSGDLLYMRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  606  RAIMAQYMPLDSQAEVPNHVHEERA  630



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC
Sbjct  486  ARNGHAYSACSDDGGVKCKCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            TCS  LLYIRDHDTCISK A+Q  +SAWAA WVILIGL V A GAYLVYKYR+RSYMD+E
Sbjct  546  TCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILIGLVVAAAGAYLVYKYRIRSYMDSE  605

Query  403  IRAIMAQYMPLDNQSEIPNHVSDSRA  326
            IRAIMAQYMPLD+Q EI NHVS+ RA
Sbjct  606  IRAIMAQYMPLDSQGEIVNHVSEERA  631



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSYDCT
Sbjct  487  RNGHAYSACSDDGGVKCKCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCT  546

Query  577  CSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            CS  LLYIRDHDTCISK A+Q  +SAWAA WVILIGL V A GAYLVYKYR+RSYMD+EI
Sbjct  547  CSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILIGLVVAAAGAYLVYKYRIRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q EI NHVS+ RA
Sbjct  607  RAIMAQYMPLDSQGEIVNHVSEERA  631



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH +SACV  +  KC CPPGFKGDG K CEDIDECK+K ACQCPECSCKNTWGSY+C+
Sbjct  484  RDGHAFSACVDKDSVKCQCPPGFKGDGVKKCEDIDECKEKKACQCPECSCKNTWGSYECS  543

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK   QVKSAWAAVW+I++ LG+ AGGAYL+YK+RLR YMD+EIR
Sbjct  544  CSGDLLYMRDHDTCISKTGAQVKSAWAAVWLIMLSLGLAAGGAYLLYKHRLRQYMDSEIR  603

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+ NH +D RA
Sbjct  604  AIMAQYMPLDSQAEV-NHANDERA  626



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH YSAC+     KC CP GFKGDG K+CEDIDEC++K ACQCPECSCKNTWGSYDC
Sbjct  485  ARNGHAYSACLDDGGVKCKCPAGFKGDGVKNCEDIDECREKKACQCPECSCKNTWGSYDC  544

Query  580  TCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            TCS  LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V AGGAYLVYKYR+RSYMD+E
Sbjct  545  TCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAGGAYLVYKYRIRSYMDSE  604

Query  403  IRAIMAQYMPLDNQSEIPNHVSDSRA  326
            IRAIMAQYMPLD+QSE+ NH +D RA
Sbjct  605  IRAIMAQYMPLDSQSEVVNHANDERA  630



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH +SAC+ +   KC CP GFKGDG K+CEDIDECKDK ACQCPECSCKNTWGSY+C
Sbjct  485  ARNGHAFSACLDNGGVKCVCPAGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNC  544

Query  580  TCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CS  LLYIRDHD CISK A+Q  KSAWAA WVI+IGL + A GAYLVYKYR+RSYMD+E
Sbjct  545  SCSGDLLYIRDHDACISKTASQEGKSAWAAFWVIVIGLVLAASGAYLVYKYRIRSYMDSE  604

Query  403  IRAIMAQYMPLDNQSEIPNHVSDSRA  326
            IRAIMAQYMPLD+Q+E+ NHV+D RA
Sbjct  605  IRAIMAQYMPLDSQAEVVNHVNDERA  630



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G T+SAC  + + KCTCPPGFKGDG K+CEDIDECK+KTACQCPECSCKNTWGSY+C
Sbjct  488  TRDGKTFSACQDTGDSKCTCPPGFKGDGIKTCEDIDECKEKTACQCPECSCKNTWGSYEC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIR+HDTCISK A + K+  AAVWVIL  L   A GAY++YKYRLRSYMD+EI
Sbjct  548  TCSGDLLYIREHDTCISKSAGEAKATQAAVWVILGVLAFAAFGAYILYKYRLRSYMDSEI  607

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH  +
Sbjct  608  RAIMAQYMPLDSQGEVPNHAHE  629



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC
Sbjct  486  ARNGHAYSACSDDGGVKCQCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            TCS  LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V A GAYLVYKYR+RSYMD+E
Sbjct  546  TCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAAGAYLVYKYRIRSYMDSE  605

Query  403  IRAIMAQYMPLDNQSEIPNHVSDSRA  326
            IRAIMAQYMPLD+Q E+ NHV + RA
Sbjct  606  IRAIMAQYMPLDSQGEVVNHVHEERA  631



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC
Sbjct  486  ARNGHAYSACSDDGGVKCQCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            TCS  LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V A GAYLVYKYR+RSYMD+E
Sbjct  546  TCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAAGAYLVYKYRIRSYMDSE  605

Query  403  IRAIMAQYMPLDNQSEIPNHVSDSRA  326
            IRAIMAQYMPLD+Q E+ NHV + RA
Sbjct  606  IRAIMAQYMPLDSQGEVVNHVHEERA  631



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            +NGH +SAC+ +   KC CP GF+GDG K+C+DIDECK+K ACQCP+CSCKNTWGSYDC+
Sbjct  500  QNGHAFSACLDNGGVKCQCPTGFRGDGVKNCQDIDECKEKKACQCPDCSCKNTWGSYDCS  559

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIR
Sbjct  560  CSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIR  619

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  620  AIMAQYMPLDSQAEVPNHVNDQRA  643



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   197 bits (501),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            +NGH +SAC+ +   KC CP GF+GDG K+C+DIDECK+K ACQCP+CSCKNTWGSYDC+
Sbjct  500  QNGHAFSACLDNGGVKCQCPTGFRGDGVKNCQDIDECKEKKACQCPDCSCKNTWGSYDCS  559

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIR
Sbjct  560  CSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIR  619

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  620  AIMAQYMPLDSQAEVPNHVNDQRA  643



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH YSAC+     KC CP GFKGDG K+CEDIDECKDK ACQCPECSCKNTWGSY+C+
Sbjct  480  RNGHAYSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCS  539

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            C   LLYI+D DTCISK A+Q +S WAA WVILIGL +++GGA+LVYKYR+R YMD+EIR
Sbjct  540  CRGDLLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIR  599

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+  RA
Sbjct  600  AIMAQYMPLDSQAEVPNHVNHQRA  623



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S  GKC CP GF+GDG K CEDI+ECK+K ACQCPECSC++TWG Y+C
Sbjct  486  TRNGKTFSACQESGNGKCQCPAGFRGDGVKKCEDINECKEKKACQCPECSCRDTWGDYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYRLRSYMD+EI
Sbjct  546  TCSGDLLYIKEHDTCISKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH +D
Sbjct  606  RAIMAQYMPLDSQGEVPNHTND  627



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH YSAC+     KC CP GFKGDG K+CEDIDECKDK ACQCPECSCKNTWGSY+C+
Sbjct  511  RNGHAYSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCS  570

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            C   LLYI+D DTCISK A+Q +S WAA WVILIGL +++GGA+LVYKYR+R YMD+EIR
Sbjct  571  CRGDLLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIR  630

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV+  RA
Sbjct  631  AIMAQYMPLDSQAEVPNHVNHQRA  654



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T NG T+SAC  + + KC CP GFKGDG K+C DIDECK+KTACQCPECSCKNTWGSY+C
Sbjct  486  THNGKTFSACQDTGDSKCKCPLGFKGDGIKTCADIDECKEKTACQCPECSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS GLLY+R+HDTCISK A++ K+ W A+W+IL  L   A GA++VYKYRLRSYMD+EI
Sbjct  546  TCSGGLLYMREHDTCISKTASEAKATWTALWLILGLLAFAAFGAFIVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH ++
Sbjct  606  RAIMAQYMPLDSQGEVPNHANE  627



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G TYSAC  S +GKC CP GF+GDG K+CEDI+ECK KTACQCP+CSCK+TWGSYDC
Sbjct  488  SRDGKTYSACQESGDGKCQCPAGFEGDGVKACEDINECKKKTACQCPDCSCKDTWGSYDC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++HDTCISK+A++ K  WAAVWV+LI L V A GAY +YKYRLRSYMD+EI
Sbjct  548  TCSGDLLYIKEHDTCISKKASEAKVTWAAVWVLLIVLAVAAFGAYAIYKYRLRSYMDSEI  607

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD+Q E+PNH
Sbjct  608  RAIMAQYMPLDSQGEVPNH  626



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH +SAC  +   KC CP GFKGDG K+C DIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  455  ARNGHAFSACSDNGAVKCECPAGFKGDGVKNCADIDECKEKKACQCPECSCKNTWGSYNC  514

Query  580  TCSNGLLYIRDHDTCISKRATQV--KSAWAAVWviliglgvvaggaylvYKYRLRSYMDT  407
            +CS  LLYIRDHD CISK A+Q   KSAWAA WVI++GL + A GAYLVYKYR+RSYMD+
Sbjct  515  SCSGDLLYIRDHDACISKTASQEGGKSAWAAFWVIVVGLVLAASGAYLVYKYRIRSYMDS  574

Query  406  EIRAIMAQYMPLDNQSEIPNHVSDSRA  326
            EIRAIMAQYMPLD+QSE+ NHV+D RA
Sbjct  575  EIRAIMAQYMPLDSQSEVVNHVNDERA  601



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH +SAC+     KC CP GFKGDG K+CEDIDECKDK ACQCPECSCKNTWGSY+C+
Sbjct  480  RNGHAFSACLDDGGVKCQCPAGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCS  539

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYI+D DTCISK A+Q KS WAA WV+LI L ++AGG +LVYKYR+R YMD+EIR
Sbjct  540  CSGDLLYIKDQDTCISKTASQAKSTWAAFWVVLIALAMIAGGGFLVYKYRIRQYMDSEIR  599

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q E PNHV+  R 
Sbjct  600  AIMAQYMPLDSQEEGPNHVNHQRG  623



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNGH +SAC  +   KC CP GFKGDG K+C DIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  486  ARNGHAFSACSDNGAVKCECPAGFKGDGVKNCADIDECKEKKACQCPECSCKNTWGSYNC  545

Query  580  TCSNGLLYIRDHDTCISKRATQV--KSAWAAVWviliglgvvaggaylvYKYRLRSYMDT  407
            +CS  LLYIRDHD CISK A+Q   KSAWAA WVI++GL + A GAYLVYKYR+RSYMD+
Sbjct  546  SCSGDLLYIRDHDACISKTASQEGGKSAWAAFWVIVVGLVLAASGAYLVYKYRIRSYMDS  605

Query  406  EIRAIMAQYMPLDNQSEIPNHVSDSRA  326
            EIRAIMAQYMPLD+QSE+ NHV+D RA
Sbjct  606  EIRAIMAQYMPLDSQSEVVNHVNDERA  632



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNGH +SAC    E KC CPPGFKGDG  SC DIDECK++ ACQC ECSCKNTWGSY+C+
Sbjct  489  RNGHAFSACTDDGEVKCKCPPGFKGDGVHSCTDIDECKERKACQCSECSCKNTWGSYECS  548

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            C+  LLYIRDHDTCISK A++ +SAWA VW +++ +G+ AGGAY VYKYRLRSYMD+EIR
Sbjct  549  CNGDLLYIRDHDTCISKTASETRSAWAIVW-VILIVGMAAGGAYRVYKYRLRSYMDSEIR  607

Query  397  AIMAQYMPLDNQSEIPNHVSDSRA  326
            AIMAQYMPLD+Q+E+PNHV++  A
Sbjct  608  AIMAQYMPLDSQAEVPNHVNEEHA  631



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+GH ++AC  + + +C CPPGFKG+G KSCEDIDECKD+ ACQCPECSCKNTWGSYDC+
Sbjct  485  RDGHVFTACTDNGKVQCQCPPGFKGBGVKSCEDIDECKDRKACQCPECSCKNTWGSYDCS  544

Query  577  CSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            CS  LLYIRDHDTCI         SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EI
Sbjct  545  CSGNLLYIRDHDTCISKSSGGGKSSAWVAVWVILIGLAMAAGGAYLVYKYRLRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV++ RA
Sbjct  605  RAIMAQYMPLDSQAEVPNHVNEERA  629



>ref|XP_008779827.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Phoenix 
dactylifera]
Length=162

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G T SAC  + + KC CP GFKG+G K+CEDIDECK+KTACQC ECSCKNTWGSY+C
Sbjct  17   TREGKTISACQDAGDSKCKCPTGFKGNGTKTCEDIDECKEKTACQCLECSCKNTWGSYEC  76

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS+GLLY+R+ D CIS  A+  K+ W A WVILI     A GAY+VYKYRLRSYMD+EI
Sbjct  77   TCSDGLLYMREQDICISDSASMAKATWIAFWVILILSAFAALGAYIVYKYRLRSYMDSEI  136

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH  +
Sbjct  137  RAIMAQYMPLDSQGEVPNHTHE  158



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G T+SAC  + + KC CP GFKGDG K+CEDIDECK+KTACQCPECSCK+TWGSY+C
Sbjct  488  TRGGTTFSACQDTGDNKCVCPSGFKGDGIKTCEDIDECKEKTACQCPECSCKDTWGSYEC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIR+HD CISK A++ K+ W AVWVIL+ L   A GAY+VYKYRLRSYMD+EI
Sbjct  548  TCSRDLLYIREHDICISKSASEAKATWTAVWVILVVLIFAAFGAYIVYKYRLRSYMDSEI  607

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH  +
Sbjct  608  RAIMAQYMPLDSQGEVPNHAHE  629



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            ++GH ++AC      +C CPPGFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSYDC+
Sbjct  486  KDGHAFTACTDDGGLQCKCPPGFKGDGVKTCEDIDECKEKKACQCPECSCKNTWGSYDCS  545

Query  577  CSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            CS  LLYIRDHDTCI         SAWAAVWVILIGL + +GGAYLVYKYRLRSYMD+EI
Sbjct  546  CSANLLYIRDHDTCISKTSGGSKSSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  606  RAIMAQYMPLDSQAEVPNHVNDERA  630



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNG + SACV + E KC CPPGFKGDG K+CEDI+ECK+K ACQC ECSC NTWGSYDC
Sbjct  485  SRNGLSMSACVDNGEVKCKCPPGFKGDGVKTCEDINECKEKKACQCSECSCTNTWGSYDC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHDTCISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EI
Sbjct  545  SCSGDLLYMRDHDTCISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q E+PNHV   R
Sbjct  605  RAIMAQYMPLDSQGEVPNHVHGDR  628



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G  +SAC+ ++   C CPPGF+GDG   CEDI+ECK+K ACQC ECSCKNTWGSYDC
Sbjct  491  TQDGQMFSACLDTQTTGCKCPPGFRGDGVDKCEDINECKEKVACQCSECSCKNTWGSYDC  550

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLY+RDHDTCISK+A Q K  WAAVWV+L+GL     GAY+VYKYRLRSYMD+EI
Sbjct  551  SCKGDLLYMRDHDTCISKKAEQGKVGWAAVWVVLLGLAAAGVGAYVVYKYRLRSYMDSEI  610

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLD+Q EIPNHV+
Sbjct  611  RAIMAQYMPLDSQGEIPNHVN  631



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNG + SACV + E KC CPPGF+GDG K+CEDI+ECK++ ACQC ECSC NTWGSYDC
Sbjct  486  SRNGLSMSACVDNGEVKCKCPPGFRGDGVKTCEDINECKERKACQCSECSCTNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHD CISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EI
Sbjct  546  SCSGDLLYMRDHDICISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q E+PNHV+  R
Sbjct  606  RAIMAQYMPLDSQGEVPNHVNGDR  629



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNG + SACV + E KC CPPGF+GDG K+CEDI+ECK++ ACQC ECSC NTWGSYDC
Sbjct  485  SRNGLSMSACVDNGEVKCKCPPGFRGDGVKTCEDINECKERKACQCSECSCTNTWGSYDC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+RDHD CISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EI
Sbjct  545  SCSGDLLYMRDHDICISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSDSR  329
            RAIMAQYMPLD+Q E+PNHV+  R
Sbjct  605  RAIMAQYMPLDSQGEVPNHVNGDR  628



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 13/154 (8%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S  GKC CP GF+GDG K CEDI+ECK+K ACQCPECSC++TWG Y+C
Sbjct  486  TRNGKTFSACQESGNGKCQCPAGFRGDGVKKCEDINECKEKKACQCPECSCRDTWGDYEC  545

Query  580  TCSNGLLYIRDHDTCIS------------KRATQVKSAWAAVWviliglgvvaggaylvY  437
            TCS  LLYI++HDTCIS            K A Q K+AWAAVW ILI L VVA G+Y+VY
Sbjct  546  TCSGDLLYIKEHDTCISHLIYYLFDQSAGKTAVQGKAAWAAVWGILIVLVVVAAGSYVVY  605

Query  436  KYRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  335
            KYRLRSYMD+EIRAIMAQYMPLD+Q E+PNH +D
Sbjct  606  KYRLRSYMDSEIRAIMAQYMPLDSQGEVPNHTND  639



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC       CTCPPGFKGDG K+CED+DECK+K ACQC +C CKNTWGSY+C
Sbjct  481  TKNGKTYSACRDDHTKGCTCPPGFKGDGEKTCEDVDECKEKVACQCSQCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY+R+HD CI K A   + +W+ +WVI++ LG V  G Y VYKYR+R YMD+EI
Sbjct  541  SCGGGLLYMREHDACIGKNARNTEYSWSFIWVIILCLGAVGVGGYAVYKYRIRRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ EIPNHVS
Sbjct  601  RAIMAQYMPLDNQGEIPNHVS  621



>ref|XP_009421105.1| PREDICTED: vacuolar-sorting receptor 3-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G T SAC  S +GKC CP GF+GD  K CE+I+EC+ KTACQCPECSCK+TWGSY+C
Sbjct  488  TRDGKTVSACQESGDGKCQCPLGFEGDAVKVCENINECEKKTACQCPECSCKDTWGSYEC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++ DTCISK+A++ K+ WAA WV+L+ L + + GAY++YKYRLRSYMD+EI
Sbjct  548  TCSGDLLYIKEQDTCISKKASEAKATWAAAWVLLMVLAIASFGAYVIYKYRLRSYMDSEI  607

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD Q E+PNH
Sbjct  608  RAIMAQYMPLDGQGELPNH  626



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGKSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            TR G TYSACV  +   C CPPGFKGDG  CEDIDECK+K ACQCPECSCKNTWGSYDC+
Sbjct  485  TRGGRTYSACVDEQTHGCKCPPGFKGDGIHCEDIDECKEKLACQCPECSCKNTWGSYDCS  544

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CSNGLLY+++HDTCIS     V   WA+ ++I++ LG V  G Y  YKYR+R YMD+EIR
Sbjct  545  CSNGLLYMQEHDTCISNGGGGV--GWASAFMIILVLGAVGTGGYAFYKYRIRRYMDSEIR  602

Query  397  AIMAQYMPLDNQSEIPNHV  341
            AIMAQYMPLDNQ EI  H+
Sbjct  603  AIMAQYMPLDNQVEITTHI  621



>gb|EMS68621.1| Vacuolar-sorting receptor 4 [Triticum urartu]
Length=265

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -3

Query  751  NGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCTC  575
             G  YS+   S +  C CP GF+GDG K C+DIDECK++ ACQCPECSC++TWG YDCTC
Sbjct  120  QGAEYSSPEESGDQNCKCPAGFRGDGVKKCDDIDECKERKACQCPECSCRDTWGGYDCTC  179

Query  574  SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRA  395
            S  LLYI++HDTCISK   Q K+AWAAVW IL+ L +VA G+Y+VYKYRLRSYMD+EIRA
Sbjct  180  SGDLLYIKEHDTCISKTTVQAKAAWAAVWGILVALVIVAAGSYVVYKYRLRSYMDSEIRA  239

Query  394  IMAQYMPLDNQSEIPN  347
            IMAQYMPLD+Q E+PN
Sbjct  240  IMAQYMPLDSQGEVPN  255



>gb|ACS91931.1| vacuolar sorting receptor protein [Lilium longiflorum]
Length=567

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T  G TYSACV  +   C CPPGFKGDG  SCED+DECK+K ACQC +C CKNTWGSYDC
Sbjct  424  THQGKTYSACVDDQSKGCKCPPGFKGDGVNSCEDVDECKEKVACQCSQCKCKNTWGSYDC  483

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+++HDTCISK+ T  +  W  +W+I +GL V     Y VYKYR+RSYMD+EI
Sbjct  484  SCSGDLLYMKEHDTCISKKPT-TEVGWNFLWIIFLGLAVAGISGYAVYKYRIRSYMDSEI  542

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+PNHVS
Sbjct  543  RAIMAQYMPLDNQGEVPNHVS  563



>gb|EPS72755.1| hypothetical protein M569_02000, partial [Genlisea aurea]
Length=514

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNG  +SACV  ++GKCTCP GF GDG KSCED+DECK+K ACQCPEC+CKNTWGSY+C
Sbjct  382  NRNGIAFSACVDDDDGKCTCPEGFTGDGVKSCEDVDECKEKKACQCPECNCKNTWGSYEC  441

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIRDHD CISK + +V+SAW+  W+I++GL + A GAYLVYKYR+RSYMD+EI
Sbjct  442  SCSGDLLYIRDHDACISKSSGRVRSAWSVFWIIILGLAIAAAGAYLVYKYRIRSYMDSEI  501

Query  400  RAIMAQYMPLDNQ  362
            RAIMAQYMPLD+Q
Sbjct  502  RAIMAQYMPLDSQ  514



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 113/140 (81%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSACV   +  C CPPGFKGDG K+CEDIDECK++TACQC  C CKNTWGSYDC
Sbjct  480  TKDGKTYSACV---DDGCKCPPGFKGDGVKTCEDIDECKERTACQCSACKCKNTWGSYDC  536

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYI++HDTCISKRAT  +  W+ +WVI  GL V   GAY VYKYR+RSYMD+EI
Sbjct  537  SCSGDLLYIKEHDTCISKRAT-TEVGWSFLWVIFFGLAVAGVGAYAVYKYRIRSYMDSEI  595

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E PNH+
Sbjct  596  RAIMAQYMPLDNQGEAPNHI  615



>dbj|BAJ85815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRN  T+SAC  S E  C CP GF+GDG K C DIDECK++ ACQCPECSC++TWG YDC
Sbjct  300  TRNRKTFSACQESGERNCKCPAGFRGDGVKKCHDIDECKERKACQCPECSCRDTWGGYDC  359

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++HDTCISK A + K AWAAV  IL+ L +VA G Y+VYKYRLRSYMD+EI
Sbjct  360  TCSGDLLYIKEHDTCISKTAVKAKEAWAAVCGILVALVIVAAGGYVVYKYRLRSYMDSEI  419

Query  400  RAIMAQYMPLDNQSEIPN  347
            RAIMAQYMPLD+Q E+PN
Sbjct  420  RAIMAQYMPLDSQGEVPN  437



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S +GKC CP GF+GDG K CEDIDECK+K ACQCPEC+CK+TWG YDC
Sbjct  480  TRNGKTFSACQESGDGKCLCPAGFRGDGVKKCEDIDECKEKKACQCPECNCKDTWGGYDC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EI
Sbjct  540  TCSGDLLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYRLRSYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLDNQ E+PNH  D
Sbjct  600  RAIMAQYMPLDNQGEVPNHTHD  621



>ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays]
 gb|ACF79081.1| unknown [Zea mays]
Length=632

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S +GKC CP GF+GDG K CEDIDECK+K ACQCPEC+CK+TWG YDC
Sbjct  487  TRNGKTFSACQESGDGKCLCPAGFRGDGVKKCEDIDECKEKKACQCPECNCKDTWGGYDC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EI
Sbjct  547  TCSGDLLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYRLRSYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLDNQ E+PNH  D
Sbjct  607  RAIMAQYMPLDNQGEVPNHTHD  628



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV      C CPPGFKGDG  SCED+DECK+K+ACQCPEC CKNTWG YDC
Sbjct  481  TQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKEKSACQCPECKCKNTWGGYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS+GLLYI++HDTCISK A   +  W+ +W+I++ L       Y  YKYR+R YMD+EI
Sbjct  541  SCSSGLLYIQEHDTCISK-AANTEVGWSFIWIIILALAAAGVAGYATYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ EIP H
Sbjct  600  RAIMAQYMPLDNQGEIPVH  618



>ref|XP_003573873.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=629

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S +G+CTCP GF+GDG K C+DIDECK+K ACQC ECSC++TWG Y+C
Sbjct  485  TRNGKTFSACQESGDGECTCPAGFQGDGVKKCQDIDECKEKKACQCLECSCRDTWGGYEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++HDTCISK   Q K+AWAAV  +L+ L V+A G+YLVYKYRLRSYMD+EI
Sbjct  545  TCSQDLLYIKEHDTCISKTTVQAKAAWAAVCGVLVALVVLAVGSYLVYKYRLRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD Q+E+ N+
Sbjct  605  RAIMAQYMPLDGQAEVSNY  623



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 108/141 (77%), Gaps = 5/141 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGHTYSAC+      C CPPGFKGDG K CED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  481  TRNGHTYSACIDDHSKDCKCPPGFKGDGVKKCEDVDECKEKVACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS+GLLY+R+HDTCI K     K +W+ +W+++  L   +   Y +YKYR+RSYMD+EI
Sbjct  541  SCSSGLLYMREHDTCIGKVGA-TKLSWSMLWILIFALAAASLSGYALYKYRIRSYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLD+Q   PN  S
Sbjct  600  RAIMAQYMPLDSQ---PNTAS  617



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 109/142 (77%), Gaps = 5/142 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNGHTYSAC+      C CPPGFKGDG K CED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  481  TRNGHTYSACIDDHSKDCKCPPGFKGDGVKKCEDVDECKEKVACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CS+GLLY+R+HDTCI S +    K +W+ +W+++  L   +   Y +YKYR+RSYMD+E
Sbjct  541  SCSSGLLYMREHDTCIGSGKVGATKLSWSMLWILIFALAAASLSGYALYKYRIRSYMDSE  600

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPLD+Q   PN  S
Sbjct  601  IRAIMAQYMPLDSQ---PNTAS  619



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC       C CPPGFKGDG K+CED+DECK+K  CQC +C CKNTWGSY+C
Sbjct  481  TQNGRTYSACRDDHTNGCKCPPGFKGDGEKTCEDVDECKEKVNCQCAQCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY+R+HD CISK A+  +  W  +WVI++ LG V  G Y VYKYR+R YMD+EI
Sbjct  541  SCGGGLLYMREHDACISKNASVSEFNWGFMWVIILCLGAVGVGGYAVYKYRIRRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ EIPNHV
Sbjct  601  RAIMAQYMPLDNQGEIPNHV  620



>ref|XP_011001696.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=532

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQC EC CKNTWGSYDC
Sbjct  388  TQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECKCKNTWGSYDC  447

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS GLLY+R+HD CISK A   K +W+ VW+I++GL       Y +YKYR+R YMD+EI
Sbjct  448  SCSGGLLYMREHDACISK-AADTKYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEI  506

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD+Q++IP H
Sbjct  507  RAIMAQYMPLDSQADIPVH  525



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC+      C CPPGFKGDG  SCEDIDECK++ ACQCPEC CKNTWG YDC
Sbjct  481  TKDGRTFSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C++ LLY+ +HDTCISK   + + +W  VWVI++GL     GAY VYKYR+R YMD+EI
Sbjct  541  SCNSNLLYMHEHDTCISKD-VKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+PNHVS
Sbjct  600  RAIMAQYMPLDNQGEVPNHVS  620



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQCPEC CKNTWGSY+C
Sbjct  481  TQDGTTFSACVEDRSQGCKCPPGFKGDGVNSCEDVDECKDKVACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS GLLY+R+HDTCIS  A + + +W+ VW+I++GL       Y +YKYR+R YMD+EI
Sbjct  541  SCSGGLLYMREHDTCIS-NAARAEYSWSFVWIIILGLATAGVAGYAIYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD+Q++IP H
Sbjct  600  RAIMAQYMPLDSQADIPVH  618



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC+      C CPPGFKGDG  SCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  480  TQDGKTFSACIEDHSKGCKCPPGFKGDGVNSCEDVDECKEKLACQCPECKCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+++HDTCISK  T   S W  VWV+++ L  V    Y VYKYR+R YMD+EI
Sbjct  540  SCSGNLLYMQEHDTCISKEGTSTVS-WNFVWVMVLALAGVGVIGYGVYKYRIRRYMDSEI  598

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLD+Q E+PNH+
Sbjct  599  RAIMAQYMPLDSQGEVPNHI  618



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQC EC CKNTWGSYDC
Sbjct  481  TQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECKCKNTWGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS GLLY+R+HD CISK A   K +W+ VW+I++GL       Y +YKYR+R YMD+EI
Sbjct  541  SCSGGLLYMREHDACISK-AADTKYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD+Q++IP H
Sbjct  600  RAIMAQYMPLDSQADIPVH  618



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSAC+      C CPPGF+GDG  SCEDIDECK+  ACQCPEC CKNTWGSY+C
Sbjct  481  TKDGRTYSACIDDHTKGCKCPPGFRGDGVNSCEDIDECKENLACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS+  LYI +HDTCISK A+  + +W+ VWV+ +GL V     Y +YKYR+R YMD+EI
Sbjct  541  SCSSNALYIHEHDTCISKDAS-TEYSWSFVWVVFLGLAVAGAAGYALYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+PNH++
Sbjct  600  RAIMAQYMPLDNQGEVPNHMT  620



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSACV      C CP GFKGDG K+CED++ECKDK AC CPEC CKNTWGSY+C
Sbjct  481  TKDGSTYSACVDDNSKGCQCPQGFKGDGVKTCEDVNECKDKVACNCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+R+HD CISK   + + +W+ +WVI++GL     G Y +YKYR+R YMD+EI
Sbjct  541  SCSGNLLYMREHDACISKH-VKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ EIPNHV
Sbjct  600  RAIMAQYMPLDNQGEIPNHV  619



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSAC+  +   CTCPPGF+GDG KSCEDIDECK++ ACQCPEC CKNTWGSYDC
Sbjct  485  TKDGKTYSACIDGQTKGCTCPPGFRGDGVKSCEDIDECKERAACQCPECRCKNTWGSYDC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLY+ +HDTCISK   +   +W+ +WVI++ +  V  G Y +YKYR+R YMD+EI
Sbjct  545  SCRGNLLYMHEHDTCISKD-VKTDFSWSFIWVIILAVAAVGAGGYAMYKYRIRRYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ E+P H
Sbjct  604  RAIMAQYMPLDNQGEVPLH  622



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            RNG ++SAC+ + +GKCTCPPGFKGDG  SCEDIDEC++K  C+CPECSCK+TWGS++CT
Sbjct  460  RNGISFSACLDTVDGKCTCPPGFKGDGVNSCEDIDECEEKKVCRCPECSCKDTWGSFECT  519

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAV-WviliglgvvaggaylvYKYRLRSYMDTEI  401
            C N LLY+RD D CISK A   KS+W A+  V++      AGGAYL+YKY LRSYMD+EI
Sbjct  520  CGNDLLYMRDQDACISKGAAAGKSSWVAISIVLIALAVAAAGGAYLLYKYSLRSYMDSEI  579

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIM+QYMPL+NQSE+PNH
Sbjct  580  RAIMSQYMPLENQSEVPNH  598



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T +  TYSAC+ +E   C CPPGFKG+G  SCED+DECK+K ACQCPEC CKNT+GSY+C
Sbjct  480  THDSRTYSACIENESKGCKCPPGFKGNGVDSCEDVDECKEKLACQCPECKCKNTFGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C+  LLY+R+HDTCISK+AT  +  W  VWVI +GL     G Y +YKYR+R YMD+EI
Sbjct  540  NCNGDLLYMREHDTCISKKAT-TEVGWNFVWVIFLGLAAAGIGGYAIYKYRIRRYMDSEI  598

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ EIPNH+
Sbjct  599  RAIMAQYMPLDNQGEIPNHM  618



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG TYSAC    +G C CP GFKGDG   CED+DECK+KTACQC EC CKNTWGSY+C
Sbjct  484  TRNGRTYSACT---DGGCKCPDGFKGDGVHKCEDVDECKEKTACQCKECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C  G+LY+++HDTCISK A Q  + W  +WV L  L       Y VYKYR+RSYMD+EI
Sbjct  541  GCGGGMLYMKEHDTCISKSAGQ--AGWNFLWVTLFALATAGLAGYAVYKYRIRSYMDSEI  598

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ EIPNH
Sbjct  599  RAIMAQYMPLDNQGEIPNH  617



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC+      C CPPGFKGDG  SCEDIDECK++ ACQCPEC CKNTWG YDC
Sbjct  481  TKDGRTFSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDC  540

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C++ LLY+ +HDTCI + +  + + +W  VWVI++GL     GAY VYKYR+R YMD+E
Sbjct  541  SCNSNLLYMHEHDTCINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSE  600

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPLDNQ E+PNHVS
Sbjct  601  IRAIMAQYMPLDNQGEVPNHVS  622



>ref|XP_006374052.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
 gb|ERP51849.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
Length=551

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQC EC CKNTWGSYDC
Sbjct  407  TQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECKCKNTWGSYDC  466

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY+++HDTCISK A     +W+ VW+I++GL       Y +YKYR+R YMD+EI
Sbjct  467  SCGGGLLYMQEHDTCISK-AANTNYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEI  525

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD+Q++IP H
Sbjct  526  RAIMAQYMPLDSQADIPVH  544



>ref|XP_004983263.1| PREDICTED: vacuolar-sorting receptor 3-like [Setaria italica]
Length=631

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S +GKC CP GF+GDG K CEDI+ECK++ ACQCPEC+C++TWG YDC
Sbjct  486  TRNGKTFSACQESGDGKCQCPAGFRGDGVKKCEDINECKERKACQCPECNCRDTWGGYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EI
Sbjct  546  TCSGDLLYIREHDTCISKTAVQAKAAWAAVWGILIVIVVVAAGSYIVYKYRLRSYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLDNQ E+PNH  +
Sbjct  606  RAIMAQYMPLDNQGEVPNHTHE  627



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV      C CPPGFKGDG  SC+D+DECKDK ACQCPEC CKNTWGSY+C
Sbjct  481  TQDGTTFSACVEDHSQGCKCPPGFKGDGVNSCDDVDECKDKVACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS GLLY+R+HD CIS  A + + +W+ VW+I++GL       Y +YKYR+R YMD+EI
Sbjct  541  SCSGGLLYMREHDACIS-NAARAEYSWSFVWIIILGLATAGVAGYAIYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLD+Q++IP H
Sbjct  600  RAIMAQYMPLDSQADIPVH  618



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +++G TYSAC+   +  C CPPGF+GDG K CEDIDECK+KTACQC  CSC+NTWGSY+C
Sbjct  488  SKDGRTYSACIDDHKNGCKCPPGFRGDGVKECEDIDECKEKTACQCQHCSCRNTWGSYEC  547

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYI +HDTCISK + + + +W  +WVI++G  +     Y +YKYR+R YMD+EI
Sbjct  548  SCSGNLLYIHEHDTCISKDSNR-EVSWGIMWVIVLGFALAGVAGYAIYKYRIRRYMDSEI  606

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ ++PNH+
Sbjct  607  RAIMAQYMPLDNQGDVPNHL  626



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC+      C CP GFKGDG  SCEDIDECK++ ACQCPEC CKNTWG YDC
Sbjct  481  TKDGMTFSACIDDHTKGCKCPLGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLY+ +HDTCISK   + + +W  VWVI++GL     GAY VYKYR+R YMD+EI
Sbjct  541  SCKGNLLYMHEHDTCISKD-VKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+PNHVS
Sbjct  600  RAIMAQYMPLDNQGEVPNHVS  620



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G T++AC+  E+  C CPPGFKGDG  SCEDIDECK+K ACQC +C+CKNTWGSY+C
Sbjct  491  SRHGQTFTACMDPED-TCKCPPGFKGDGVNSCEDIDECKEKKACQCSDCNCKNTWGSYEC  549

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLY++DHDTCISK A Q KSAWAAVW+ LIGL +VA G YL YKYR+R YMD+EI
Sbjct  550  TCSGDLLYMKDHDTCISKSAAQAKSAWAAVWLSLIGLAMVAAGGYLFYKYRIRQYMDSEI  609

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLD+Q+EIPNH SD RA
Sbjct  610  RAIMAQYMPLDSQTEIPNH-SDDRA  633



>ref|XP_006661708.1| PREDICTED: vacuolar-sorting receptor 3-like [Oryza brachyantha]
Length=627

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC  S  GKC CP GF GDG K CEDIDECK + ACQCPECSC+NTWG Y+C
Sbjct  482  TRNGKTFSACQESGNGKCQCPAGFHGDGVKKCEDIDECKQRKACQCPECSCRNTWGDYEC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS  LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYRLRSYMD+EI
Sbjct  542  TCSGDLLYIKEHDTCISKTAVQAKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q E+PNH  D
Sbjct  602  RAIMAQYMPLDSQGEVPNHTQD  623



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 109/139 (78%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC   +   C CPPGF+GDG  SCEDIDECKDKTACQC +C CKNTWGSYDC
Sbjct  481  TQDGKTFSAC---DSQGCKCPPGFRGDGVNSCEDIDECKDKTACQCSDCKCKNTWGSYDC  537

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C +GLLY+R+HDTCISK A+  + +W+ +W I++GL       Y +YKYR+R YMD+EI
Sbjct  538  SCGSGLLYMREHDTCISKDAS-AEVSWSFIWTIILGLAAAGIAGYAIYKYRIRRYMDSEI  596

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ EIP H
Sbjct  597  RAIMAQYMPLDNQGEIPVH  615



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +RNG TYSAC+      C CP GF+GDG  SC+D+DECK+K ACQCPEC CK+ WGSY+C
Sbjct  487  SRNGKTYSACIDDHTKGCKCPHGFRGDGVNSCDDVDECKEKLACQCPECKCKDVWGSYEC  546

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS GLLY+++HD CI+K  T+ + +W  +W I++GL       Y VYKYR+R YMD+EI
Sbjct  547  SCSGGLLYMQEHDMCINKN-TRTEYSWGFIWTIILGLAAAGVAGYAVYKYRIRRYMDSEI  605

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLDNQ EIP+H   SR 
Sbjct  606  RAIMAQYMPLDNQGEIPSHTHASRG  630



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC+      C CP GFKGDG  SCEDIDECK++ ACQCPEC CKNTWG YDC
Sbjct  481  TKDGMTFSACIDDHTKGCKCPLGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDC  540

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C   LLY+ +HDTCI + +  + + +W  VWVI++GL     GAY VYKYR+R YMD+E
Sbjct  541  SCKGNLLYMHEHDTCINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSE  600

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPLDNQ E+PNHVS
Sbjct  601  IRAIMAQYMPLDNQGEVPNHVS  622



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSAC+      C CPPGFKGDG + CEDIDECK++ ACQCP+C CKNTWG Y C
Sbjct  481  TKDGRTYSACIDDHTKGCKCPPGFKGDGVNLCEDIDECKERLACQCPDCKCKNTWGGYQC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+++HDTCI        S W  VWVI++GL V   GAY VYKYR+R YMD+EI
Sbjct  541  SCSGNLLYMQEHDTCIGNDGKAAFS-WGLVWVIILGLAVAGAGAYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+PNH+S
Sbjct  600  RAIMAQYMPLDNQGEVPNHIS  620



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC+      C CP GFKGDG  SCEDIDECK+KTACQC +C CKNTWGSY+C
Sbjct  481  TQGGRTYSACIDDHTKGCKCPAGFKGDGTNSCEDIDECKEKTACQCSDCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C    LYI +HDTCISK  +  + +W+ VWV+++GL V     Y +YKYR+R YMD+EI
Sbjct  541  SCGGNSLYIHEHDTCISKD-SNTEYSWSFVWVVILGLAVSGVAGYALYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVSDSRA  326
            RAIMAQYMPLDNQ E+P+H+S  R 
Sbjct  600  RAIMAQYMPLDNQGEVPDHMSHGRV  624



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSAC       C CPPGFKGDG + CED+DECK+K ACQCPEC C+NTWGSYDC
Sbjct  481  TQDGRTYSACSDDHTKGCKCPPGFKGDGVRKCEDVDECKEKLACQCPECKCRNTWGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C NGLLY+ +HDTCI    + V S W+ V + ++ L +     + VYKYR+R YMD+EI
Sbjct  541  SCRNGLLYMHEHDTCIGNIGSTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E  NHV+
Sbjct  600  RAIMAQYMPLDNQGETSNHVA  620



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G TYSAC       C+CPPGFKGDG K+CED+DECK+KTACQC +C CKNTWGSY+C
Sbjct  481  TRSGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY+R++D CI K  +   S+W  +WVI++ LG V  G + VYKYR+R YMD+EI
Sbjct  541  SCGGGLLYMRENDACIGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+P+HV+
Sbjct  601  RAIMAQYMPLDNQGEVPSHVA  621



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G TYSAC       C+CPPGFKGDG K+CED+DECK+KTACQC  C CKNTWGSYDC
Sbjct  482  TRTGSTYSACRDDLTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCAHCKCKNTWGSYDC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY+R +D CI K A+   S+   +W+I++ LG V  G Y+VYKYR+R YMD+EI
Sbjct  542  SCGGGLLYMRGYDACIGKNASGSGSSRGLIWIIILCLGAVGVGGYIVYKYRIRRYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDN+  +P HVS
Sbjct  602  RAIMAQYMPLDNEGAVPGHVS  622



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 110/140 (79%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSACV   +  C CPPGFKGDG K+CED+DECK+K ACQC  C CKNTWG YDC
Sbjct  480  TKDGKTYSACV---DDGCKCPPGFKGDGVKTCEDVDECKEKIACQCSACKCKNTWGGYDC  536

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+++HD CISK+AT  +  W+ +WVI  GL V   GAY+VYKYR+RSYMD+EI
Sbjct  537  SCSGDLLYMQEHDACISKKAT-TEVGWSFLWVIFFGLAVAGIGAYVVYKYRIRSYMDSEI  595

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E  NHV
Sbjct  596  RAIMAQYMPLDNQGEAANHV  615



>gb|KGN58685.1| hypothetical protein Csa_3G728020 [Cucumis sativus]
Length=161

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = -3

Query  706  CTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCTCSNGLLYIRDHDTCIS  530
            C CPPGFKGDG + CED+DECK+K ACQCPEC C+NTWGSYDC+C NGLLY+ +HDTCI 
Sbjct  35   CKCPPGFKGDGVRKCEDVDECKEKLACQCPECKCRNTWGSYDCSCRNGLLYMHEHDTCIG  94

Query  529  KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIP  350
               + V S W+ V + ++ L +     + VYKYR+R YMD+EIRAIMAQYMPLDNQ E  
Sbjct  95   NIGSTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIMAQYMPLDNQGETS  153

Query  349  NHVS  338
            NHV+
Sbjct  154  NHVA  157



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSAC+      C CPPGFKGDG + CEDIDECK++ ACQCP+C CKNTWG Y C
Sbjct  481  TKDGRTYSACIDDHTKGCKCPPGFKGDGVNLCEDIDECKERLACQCPDCKCKNTWGGYQC  540

Query  580  TCSNGLLYIRDHDTCISK-RATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CS  LLY+++HDTCI+     +   +W  VWVI++GL V   GAY VYKYR+R YMD+E
Sbjct  541  SCSGNLLYMQEHDTCIAAGNDGKAAFSWGLVWVIILGLAVAGAGAYAVYKYRIRRYMDSE  600

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPLDNQ E+PNH+S
Sbjct  601  IRAIMAQYMPLDNQGEVPNHIS  622



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC+      C CPPGFKGDG + C+DIDECK++ ACQCP+C CKNTWG Y C
Sbjct  481  TKDGRTFSACIDDHTKGCKCPPGFKGDGVNVCDDIDECKERLACQCPDCKCKNTWGGYQC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+++HDTCI        S W  VWVI++GL V   GAY VYKYR+R YMD+EI
Sbjct  541  SCSGNLLYMQEHDTCIGNDGKAAFS-WGLVWVIILGLAVAGVGAYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E+PNH+S
Sbjct  600  RAIMAQYMPLDNQGEVPNHIS  620



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C+CPPGFKGDG K+CED+DECK+KT CQC  C CKNTWGSYDC
Sbjct  481  TQLGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTVCQCAHCKCKNTWGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY++ +D CISK A+   S+W  +W+I++ LG V  G Y VYKYR+R YMD+EI
Sbjct  541  SCGGGLLYMQAYDACISKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYRIRRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPL N+ E P HVS
Sbjct  601  RAIMAQYMPLGNEGEAPGHVS  621



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 111/140 (79%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SACV   +  C CPPGFKGDG  +CEDIDECK++ ACQC  C CKNTWGS++C
Sbjct  484  TKDGKTFSACV---DDGCKCPPGFKGDGVNTCEDIDECKERIACQCSACKCKNTWGSFEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYI++HDTCISK+A   +  W+ +WVI  GL V   GAY+VYKYR+RSYMD+EI
Sbjct  541  SCSGDLLYIKEHDTCISKKAA-AEIGWSFLWVIFFGLAVAGVGAYMVYKYRIRSYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E PNH+
Sbjct  600  RAIMAQYMPLDNQGEAPNHI  619



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T++AC   +   C CP GFKGDG  +CEDIDEC+++ ACQCP+C+CKNT+GSYDC
Sbjct  481  TRNGVTHTACSDRQLKGCQCPAGFKGDGFNTCEDIDECRERVACQCPDCTCKNTYGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+R+HDTCISK+ +  K  W  ++ +L GL   A   Y+VYKYRLRSYMD+EI
Sbjct  541  SCSGDLLYMREHDTCISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKYRLRSYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q+++ +H+ +
Sbjct  601  RAIMAQYMPLDSQNDVHHHLQE  622



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T++AC   +   C CP GFKGDG  +CEDIDEC+++ ACQCP+C+CKNT+GSYDC
Sbjct  481  TRNGVTHTACSDRQLKGCQCPSGFKGDGFNTCEDIDECRERVACQCPDCTCKNTYGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+R+HDTCISK+ +  K  W  ++ +L GL   A   Y+VYKYRLRSYMD+EI
Sbjct  541  SCSGDLLYMREHDTCISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKYRLRSYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q+++ +H+ +
Sbjct  601  RAIMAQYMPLDSQNDVHHHLQE  622



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSACV   +  C CPPGFKGDG  +CEDIDECK+K ACQC  C CKNTWGSYDC
Sbjct  480  TKDGKTYSACV---DDGCKCPPGFKGDGVNTCEDIDECKEKIACQCSACKCKNTWGSYDC  536

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS   LYI++HDTCISK  T  +  W+ +WVI  GL V   GAY VYKYR+RSYMD+EI
Sbjct  537  SCSGDRLYIKEHDTCISKEGT-TEVGWSFLWVIFFGLAVAGMGAYAVYKYRIRSYMDSEI  595

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E  NH+
Sbjct  596  RAIMAQYMPLDNQGEASNHI  615



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC    +G C CP GFKGDG   CED+DECK++TACQC EC C NTWGSY+C
Sbjct  478  TRNGRTHSACT---DGGCKCPDGFKGDGVHKCEDVDECKERTACQCKECKCNNTWGSYEC  534

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C  G LY+++HDTCISK A   +  W  +W +L GL  V    Y VYKYR+RSYMD+EI
Sbjct  535  GCGGGFLYMKEHDTCISKDAG-ARVGWNFLWFLLFGLAAVGIAGYAVYKYRIRSYMDSEI  593

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ EIPNH
Sbjct  594  RAIMAQYMPLDNQGEIPNH  612



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSACV      C CPPGFKGDG  SCEDI+ECK+K ACQC +C CKNTWGSYDC
Sbjct  483  TQNGKTYSACVDDHTKGCNCPPGFKGDGVNSCEDINECKEKVACQCSDCKCKNTWGSYDC  542

Query  580  TCSNGLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C+ G +Y+++HDTCIS    + V+ +   ++ I++ L  V   AY VYKYR+R YMD+E
Sbjct  543  SCNGGSIYMQEHDTCISATVESSVRLSMGGIFFIILCLAAVGVCAYAVYKYRIRRYMDSE  602

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPLDNQ EIP HVS
Sbjct  603  IRAIMAQYMPLDNQGEIPTHVS  624



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC  +++G C CP GFKGDGK  CEDIDECK+KTACQC EC CKNTWGSY+C
Sbjct  487  TKNGRTYSAC--TDDG-CKCPDGFKGDGKHKCEDIDECKEKTACQCKECKCKNTWGSYEC  543

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+R+HDTCISK     ++ W  +WV+  GL       Y VYKYR+R YMD+EI
Sbjct  544  GCSGGLLYMREHDTCISKNGGS-EAGWGFLWVVFFGLVAAGIAGYAVYKYRIRRYMDSEI  602

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++ +H
Sbjct  603  RAIMAQYMPLDNQGDVQSH  621



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 103/140 (74%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSACV      C CPPGFKGDG  SCED+DECK+K ACQC EC CKNTWGSY+C
Sbjct  481  TQDGRTYSACVDDHSHGCKCPPGFKGDGVNSCEDVDECKEKLACQCRECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS G LY+R+HDTCI K A+  K +W  VW I+ GL       Y  YKYR+R YMD+EI
Sbjct  541  SCSGGSLYMREHDTCIGKEAS-TKVSWGYVWAIIFGLVAAGAAGYAFYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ   PN+V
Sbjct  600  RAIMAQYMPLDNQ---PNNV  616



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED+DECK+KT CQCPEC CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSNGCKCPVGFKGDGVKSCEDVDECKEKTVCQCPECKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  542  SCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQSEI--PNHV  341
            IR IMAQYMPL++Q     P+H+
Sbjct  602  IRGIMAQYMPLESQPNPSGPHHM  624



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R G TYSACV      C CP GFKGDG KSCED+DECK+KT CQCPEC CKNTWGSY+C
Sbjct  479  SRGGFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CSNGLLY+R+HDTCI S +    K +W+ +W ++IG+GV     Y VYKYR+RSYMD E
Sbjct  539  SCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWFLIIGVGVAGLSGYAVYKYRIRSYMDAE  598

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  599  IRGIMAQYMPLESQ  612



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG TYSAC  +++G C CP GFKGDGK  CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  484  TRNGRTYSAC--TDDG-CKCPDGFKGDGKHKCEDIDECKERTACQCKECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK     ++ W  +WVI +GL       Y VYKYR+R YMD+EI
Sbjct  541  GCSGGLLYMKEHDTCISKNGA-TETGWGFLWVIFLGLVAAGIAGYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++ +H
Sbjct  600  RAIMAQYMPLDNQGDVQSH  618



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG TYSAC  +++G C CP GFKGDGK  CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  484  TRNGRTYSAC--TDDG-CKCPDGFKGDGKHKCEDIDECKERTACQCKECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKYR+R YMD+EI
Sbjct  541  GCSGGLLYMKEHDTCISKNGA-TETGWGFLWVIFFGLVAAGIAGYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++ +H
Sbjct  600  RAIMAQYMPLDNQGDVQSH  618



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G TYSAC+      C CP GF+GDG KSCED+DECK+K ACQCP C CKNTWGSY+C
Sbjct  481  TREGRTYSACIDDHSHGCKCPYGFRGDGVKSCEDVDECKEKLACQCPGCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS G LY+R+HDTCISK   + + +W +VWVI++GL     G Y +YKYR+R YMD+EI
Sbjct  541  SCSGGSLYMREHDTCISKN-VKTEVSWGSVWVIILGLVAAGAGGYAIYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ   PN+V
Sbjct  600  RAIMAQYMPLDNQ---PNNV  616



>gb|ACN25155.1| unknown [Zea mays]
Length=310

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC  +++G C CP GFKGDGK  CED+DECK++T CQC EC CKNTWGSY+C
Sbjct  170  TKNGRTYSAC--TDDG-CRCPDGFKGDGKHKCEDVDECKERTVCQCEECRCKNTWGSYEC  226

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK     ++ W  +WV++ GL       Y VYKYR+R YMD+EI
Sbjct  227  GCSGGLLYMKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEI  285

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLD+Q ++ +H 
Sbjct  286  RAIMAQYMPLDSQGDVQSHA  305



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T +G TYSAC       C CPPGFKGDG  +CED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  481  THDGKTYSACSDDHTKGCKCPPGFKGDGVHTCEDVDECKEKLACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C NGLLY+ +HDTCI    + V S W+ V ++++ L +     Y +YKYR+R YMD+EI
Sbjct  541  SCRNGLLYMHEHDTCIGNIGSTVTS-WSVVKIVILVLAITGIAGYAIYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLDNQ E  +HV+
Sbjct  600  RAIMAQYMPLDNQGETGSHVA  620



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G TYSAC       C+CPPGFKGDG K+CED+DECK+KTACQC +C CKNTWGSY+C
Sbjct  481  TRSGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  GLLY+R++D CI+ K  +   S+W  +WVI++ LG V  G + VYKYR+R YMD+E
Sbjct  541  SCGGGLLYMRENDACIAGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSE  600

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPLDNQ E+P+HV+
Sbjct  601  IRAIMAQYMPLDNQGEVPSHVA  622



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R G TYSACV      C CP GFKGDG K+CED+DECK+KT CQCPEC CKNTWGSY+C
Sbjct  479  SRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  539  SCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAE  598

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  599  IRGIMAQYMPLESQ  612



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R G TYSACV      C CP GFKGDG K+CED+DECK+KT CQCPEC CKNTWGSY+C
Sbjct  479  SRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  539  SCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAE  598

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  599  IRGIMAQYMPLESQ  612



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  451  SRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYEC  507

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EI
Sbjct  508  GCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEI  566

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++PNH
Sbjct  567  RAIMAQYMPLDNQGDVPNH  585



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 105/140 (75%), Gaps = 4/140 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC       C CPPGFKGDG K+CED+DECK+K  CQC +C CKNTWGSY+C
Sbjct  481  TQNGRTYSACRDDHTNGCKCPPGFKGDGEKTCEDVDECKEKVNCQCAQCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GLLY+R+HD CISK A+  +  W  +WVI++ LG V  G Y V  Y +R YMD+EI
Sbjct  541  SCGGGLLYMREHDACISKNASVSEFNWGFMWVIILCLGAVGVGGYAV--YNIR-YMDSEI  597

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ EIPNHV
Sbjct  598  RAIMAQYMPLDNQGEIPNHV  617



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R G TYSACV      C CP GFKGDG K+CED+DECK+KT CQCPEC CKNTWGSY+C
Sbjct  479  SRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  539  SCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAE  598

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  599  IRGIMAQYMPLESQ  612



>gb|AAB72113.1| vacuolar sorting receptor homolog [Zea mays]
Length=152

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 99/140 (71%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G T SAC       C CP GFKGDG KSCEDIDEC++K  CQC  CSCKNTWGSY+C
Sbjct  5    TRPGKTISACSNEISEGCKCPVGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYEC  64

Query  580  TCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  + +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  65   SCGDDNMLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  124

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ     H
Sbjct  125  IRAIMAQYMPLDNQVGANQH  144



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  486  SRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYEC  542

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EI
Sbjct  543  GCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++PNH
Sbjct  602  RAIMAQYMPLDNQGDVPNH  620



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  486  SRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYEC  542

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EI
Sbjct  543  GCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++PNH
Sbjct  602  RAIMAQYMPLDNQGDVPNH  620



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  486  SRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYEC  542

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EI
Sbjct  543  GCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEI  601

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++PNH
Sbjct  602  RAIMAQYMPLDNQGDVPNH  620



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G  YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQCPEC CKNTWGS+DC
Sbjct  481  TQDGRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCPECKCKNTWGSFDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C + LLY+ +HDTCISK  ++ + +W  VW I++GL V A  A+ VYKYR+R YMD+EI
Sbjct  541  SCGSNLLYMHEHDTCISKD-SKSEFSWGLVWTIILGLAVAAVVAFAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLD Q E  NHVS
Sbjct  600  RAIMAQYMPLD-QGEGANHVS  619



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G T+SACV      C CPPGF GDG  SCED+DECK+K  CQCPEC CK+TWGS++C
Sbjct  485  TRGGRTFSACVDDSSTGCKCPPGFTGDGVNSCEDVDECKEKKVCQCPECKCKDTWGSFEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS GLLY++++DTCIS      KS     W++++GL     GAY+VYKYR+RSYMD+EI
Sbjct  545  TCSGGLLYMQEYDTCISTHPV-TKSFGVFFWIVILGLTAAGVGAYMVYKYRIRSYMDSEI  603

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            R+IMAQYMPLD Q+E+P+H S
Sbjct  604  RSIMAQYMPLDGQAEVPSHGS  624



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 104/139 (75%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC    +G C CP GFKGDG   C D+DECK++TACQC +C CKNTWGSY+C
Sbjct  555  TRNGRTHSACT---DGGCKCPDGFKGDGVHKCIDVDECKERTACQCKDCKCKNTWGSYEC  611

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C  GLLY+++HDTCISK A   +  W  +WV+L GL       Y VYKYR+RSYMD+EI
Sbjct  612  GCGGGLLYMKEHDTCISKDAG-ARVGWNFLWVVLFGLAAAGIAVYAVYKYRIRSYMDSEI  670

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ EIP+H
Sbjct  671  RAIMAQYMPLDNQGEIPSH  689



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 106/142 (75%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C+CPPGFKGDG K+CED+DECK+KT CQC  C CKNTWGSYDC
Sbjct  481  TQLGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTVCQCAHCKCKNTWGSYDC  540

Query  580  TCSNGLLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  GLLY++ +D CI+ K A+   S+W  +W+I++ LG V  G Y VYKYR+R YMD+E
Sbjct  541  SCGGGLLYMQAYDACITGKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYRIRRYMDSE  600

Query  403  IRAIMAQYMPLDNQSEIPNHVS  338
            IRAIMAQYMPL N+ E P HVS
Sbjct  601  IRAIMAQYMPLGNEGEAPGHVS  622



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 105/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             R+G TYSAC  + +G C CP GFKGDG   CEDIDECK+++ACQC EC CKNTWGSY+C
Sbjct  513  ARHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERSACQCKECKCKNTWGSYEC  569

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y +YKYR+R YMD+EI
Sbjct  570  GCSGGLLYMKEHDTCISKSAA-TEVGWNFLWVIFFGLVVAGIAGYALYKYRIRRYMDSEI  628

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ E+PNH
Sbjct  629  RAIMAQYMPLDNQGEVPNH  647



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T NG TYSAC       C CP GFKGDG   CEDIDECK++TACQC EC+CKNTWGSY+C
Sbjct  785  TMNGRTYSACTAD---GCKCPDGFKGDGIHKCEDIDECKERTACQCKECNCKNTWGSYEC  841

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WV+  GL  V    Y VYKYR+R YMD+EI
Sbjct  842  GCSGGLLYMKEHDTCISKSAA-AQVGWNFLWVVFFGLAAVGIAGYAVYKYRIRRYMDSEI  900

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPL+NQ EIP+H
Sbjct  901  RAIMAQYMPLENQGEIPSH  919



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC CKNTWGSY+C
Sbjct  588  SRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYEC  644

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EI
Sbjct  645  GCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEI  703

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++PNH
Sbjct  704  RAIMAQYMPLDNQGDVPNH  722



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 105/138 (76%), Gaps = 5/138 (4%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R+G TYSAC  + +G C CP GFKGDG   CEDIDECK+++ACQC EC CKNTWGSY+C 
Sbjct  559  RHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERSACQCKECKCKNTWGSYECG  615

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y +YKYR+R YMD+EIR
Sbjct  616  CSGGLLYMKEHDTCISKSAA-TEVGWNFLWVIFFGLVVAGIAGYALYKYRIRRYMDSEIR  674

Query  397  AIMAQYMPLDNQSEIPNH  344
            AIMAQYMPLDNQ E+PNH
Sbjct  675  AIMAQYMPLDNQGEVPNH  692



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC+      C CP GF+GDG KSCED+DECK+K ACQCP C C+NTWGSY+C
Sbjct  481  TQEGRTYSACIDDHSHGCKCPYGFRGDGVKSCEDVDECKEKLACQCPGCKCRNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS G LY+R+HDTCISK   + + +W +VWVI++GL     G Y +YKYR+R YMD+EI
Sbjct  541  SCSGGSLYMREHDTCISKN-VKTEVSWGSVWVIILGLVAAGAGGYAIYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ   PN+V
Sbjct  600  RAIMAQYMPLDNQ---PNNV  616



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G TYSACV      C CP GFKGDG KSCED+DECK+K  CQCP+C CKNTWGSY+C
Sbjct  482  TRGGFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKKVCQCPDCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C+NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  542  SCNNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>gb|EMS63262.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=864

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 104/152 (68%), Gaps = 17/152 (11%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T+SAC    +G C CP GFKGDG   CED+DECK++TACQC EC CKNTWGSY+C
Sbjct  421  TRNGLTHSACT---DGGCKCPVGFKGDGVHKCEDVDECKERTACQCKECKCKNTWGSYEC  477

Query  580  TCSNGLLYIRDHDTCI-------------SKRATQVKSAWAAVWviliglgvvaggaylv  440
             C  GLLY+++HDTCI             S +    +  W  +W +L GL  V    Y V
Sbjct  478  GCGGGLLYMKEHDTCINYLLKAYKVNTFYSGKDAGARVGWNFLWFLLFGLAAVGIAGYAV  537

Query  439  YKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  344
            YKYR+RSYMD+EIRAIMAQYMPLDNQ EIPNH
Sbjct  538  YKYRIRSYMDSEIRAIMAQYMPLDNQGEIPNH  569



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSAC+      C CPPGFKGDG +SCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  481  TRGVYTYSACLDDHSSGCKCPPGFKGDGVESCEDVDECKEKVACQCPECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GL Y+R+HDTCI K    +K +W+ +W++L+         Y +YKYR+RSYMD+EI
Sbjct  541  SCGKGLFYLREHDTCIGKFGA-MKLSWSFLWILLLASAAATLTGYAIYKYRIRSYMDSEI  599

Query  400  RAIMAQYMPLDNQ  362
            R IMAQYMPLD+Q
Sbjct  600  RTIMAQYMPLDSQ  612



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED+DECK+KT CQCPEC CKNTWGSY+C
Sbjct  482  TRGIYTYSACVDDHSNGCKCPHGFKGDGVKSCEDVDECKEKTVCQCPECKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C+NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y +YKYR+R+YMD E
Sbjct  542  SCNNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGISGYAIYKYRIRTYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -3

Query  706  CTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCTCSNGLLYIRDHDTCIS  530
            C CP GFKGDG K+CED++ECKDK AC CPEC CKNTWGSY+C+CS  LLY+R+HD CIS
Sbjct  499  CQCPQGFKGDGVKTCEDVNECKDKVACNCPECKCKNTWGSYECSCSGNLLYMREHDACIS  558

Query  529  KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIP  350
            K   + + +W+ +WVI++GL     G Y +YKYR+R YMD+EIRAIMAQYMPLDNQ EIP
Sbjct  559  KH-VKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGEIP  617

Query  349  NHV  341
            NHV
Sbjct  618  NHV  620



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G  YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQCP C CKNTWGS+DC
Sbjct  481  TQDGRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCPACKCKNTWGSFDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLY+ +HDTCISK  ++ + +W  VW I++GL V     Y VYKYR+R YMD+EI
Sbjct  541  SCGGNLLYMHEHDTCISKD-SKSEFSWGLVWTIILGLAVAVVVGYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVS  338
            RAIMAQYMPLD Q E  NHVS
Sbjct  600  RAIMAQYMPLD-QGEGANHVS  619



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   164 bits (414),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 104/139 (75%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T NG TYSAC       C CP GFKGDG   CEDIDECK++TACQC EC+CKNTWGSY+C
Sbjct  485  TMNGRTYSACTAD---GCKCPDGFKGDGIHKCEDIDECKERTACQCKECNCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK A   +  W  +WV+  GL  V   AY VYKYR+R YMD+EI
Sbjct  542  GCSGGLLYMKEHDTCISKSAA-AQVGWNFLWVVFFGLAAVGIAAYAVYKYRIRRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPL+NQ EIP++
Sbjct  601  RAIMAQYMPLENQGEIPSN  619



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   163 bits (413),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 105/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC  +++G C CP GFKGDG+  CEDIDECK++T CQC EC CKNTWGSY+C
Sbjct  484  TKNGRTYSAC--NDDG-CKCPDGFKGDGRHKCEDIDECKERTVCQCKECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKYR+R YMD+EI
Sbjct  541  GCSGGLLYMKEHDTCISKSGAS-EAGWGFLWVIFFGLVAAGVAGYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++ +H
Sbjct  600  RAIMAQYMPLDNQGDVQSH  618



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 105/139 (76%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC  +++G C CP GFKGDG+  CEDIDECK++T CQC EC CKNTWGSY+C
Sbjct  484  TKNGRTYSAC--NDDG-CKCPDGFKGDGRHKCEDIDECKERTVCQCKECKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKYR+R YMD+EI
Sbjct  541  GCSGGLLYMKEHDTCISKSGAS-EAGWGFLWVIFFGLVAAGVAGYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPLDNQ ++ +H
Sbjct  600  RAIMAQYMPLDNQGDVQSH  618



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G TYSAC       C CPPGFKGDG + CED+DECK+K ACQCPEC C+NTWGSYDC
Sbjct  481  TQDGRTYSACSDDHTEGCKCPPGFKGDGIRKCEDVDECKEKLACQCPECKCQNTWGSYDC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C NGLLY+ +HDTCI      V S W+ V + ++ L +     + VYKYR+R YMD+EI
Sbjct  541  SCRNGLLYMHEHDTCIGNIGNTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSE  356
            RAIMAQYMPLDNQ E
Sbjct  600  RAIMAQYMPLDNQGE  614



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC+      C CPPGFKGDG  SCED+DECKDK ACQCP C CKNTWGSY+C
Sbjct  481  TQEGKTYSACLDDHSHGCECPPGFKGDGVNSCEDVDECKDKLACQCPGCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +CS+G LY+R+HD CISK   T+V S +  +W I++GL V     Y +YKYR+R YMD+E
Sbjct  541  SCSDGSLYMREHDMCISKNGKTEVSSGF--IWAIILGLVVAGAVGYAIYKYRIRRYMDSE  598

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ    +H
Sbjct  599  IRAIMAQYMPLDNQPSNIHH  618



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED++ECK+KT CQCP+C CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSSDCKCPLGFKGDGVKSCEDVNECKEKTGCQCPDCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKYR+RSYMD E
Sbjct  542  SCKNGLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR   TYSACV      C CP GFKGDG KSCED+DECK+KT CQCP+C CKNTWGSY+C
Sbjct  482  TRGIFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPDCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +WV++IG+ V     Y VYKYR+RSYMD E
Sbjct  542  SCKNGLLYMREHDTCIGSGKVGTTKLSWSFLWVLIIGVAVAGLSGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED+DECK+K  CQCPEC CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +W ++I +GV     Y  YKYR+R YMD E
Sbjct  542  SCKNGLLYMREHDTCIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKYRIRRYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR   TYSACV      C CP GFKGDG KSCED+DECK+KT CQCP+C CKNTWGSY+C
Sbjct  482  TRGLFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPDCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  542  SCKNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED+DECK+K  CQCPEC CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +W ++I +GV     Y  YKYR+R YMD E
Sbjct  542  SCKNGLLYMREHDTCIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKYRIRRYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED+DECK+K  CQCPEC CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +W ++I +GV     Y  YKYR+R YMD E
Sbjct  542  SCKNGLLYMREHDTCIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKYRIRRYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG T SAC   E   C CPPGFKGDG KSCEDIDECKDK  CQC +CSC+NTWGSY+C
Sbjct  480  TKNGKTVSACSNEESKGCKCPPGFKGDGIKSCEDIDECKDKLFCQCKDCSCENTWGSYEC  539

Query  580  TC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  + +LY+R+HDTCISK A+     W  +WVI  GL +   GAY VYKYRLRSYMD+E
Sbjct  540  SCGGSNMLYMREHDTCISKVASS-SVGWGFLWVIFFGLALAGIGAYAVYKYRLRSYMDSE  598

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPL+NQ E PN 
Sbjct  599  IRAIMAQYMPLENQ-ETPNQ  617



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG T SAC   E   C CPPGFKGDG KSCEDIDECKDK  CQC +CSC+NTWGSY+C
Sbjct  480  TKNGKTVSACSNEESKGCKCPPGFKGDGIKSCEDIDECKDKLFCQCKDCSCENTWGSYEC  539

Query  580  TC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  + +LY+R+HDTCISK A+     W  +WVI  GL +   GAY VYKYRLRSYMD+E
Sbjct  540  SCGGSNMLYMREHDTCISKVASS-SVGWGFLWVIFFGLALAGIGAYAVYKYRLRSYMDSE  598

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPL+NQ E PN 
Sbjct  599  IRAIMAQYMPLENQ-ETPNQ  617



>gb|ACR34782.1| unknown [Zea mays]
Length=317

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T SAC       C CP GFKGDG KSCEDIDEC++K  CQC  CSCKNTWGSY+C
Sbjct  170  TKDGKTISACSNEISEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYEC  229

Query  580  TCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  + +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  230  SCGDDNMLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  289

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ     H
Sbjct  290  IRAIMAQYMPLDNQEGANQH  309



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG TYSAC  +++G C CP GFKGDGK  CED+DECK++T CQC EC CKNTWGSY+C
Sbjct  483  TKNGRTYSAC--TDDG-CRCPDGFKGDGKHKCEDVDECKERTVCQCEECRCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCISK     ++ W  +WV++ GL       Y VYKYR+R YMD+EI
Sbjct  540  GCSGGLLYMKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEI  598

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLD+Q ++ +H 
Sbjct  599  RAIMAQYMPLDSQGDVQSHA  618



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR   TYSACV      C CP GFKGDG K+CED+DECK+KT CQCP+C CKNTWGSY+C
Sbjct  482  TRGVFTYSACVDDHSKDCKCPHGFKGDGVKNCEDVDECKEKTVCQCPDCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C+NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD E
Sbjct  542  SCNNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGIGVAGLSGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             ++G ++SACV +    C CPPGF+GDG  +CED+DEC++K ACQCPEC CK+TWGSY+C
Sbjct  481  IQDGKSFSACVENSLHGCKCPPGFRGDGVNNCEDVDECEEKLACQCPECKCKDTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C +GLLY+++HDTCISK   + +++W  VW++++GL       Y  YKYR+R YMD+EI
Sbjct  541  SCGSGLLYMQEHDTCISKD-VRSEASWGFVWMVILGLAATGVAGYAFYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEI  353
            RAIMAQYMPLD+Q+E+
Sbjct  600  RAIMAQYMPLDSQAEV  615



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 4/140 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            ++ G TYSAC       C CP GF+GDG   CEDI+EC +K ACQCP+CSCKNTWGSY+C
Sbjct  485  SQYGRTYSACTDDYRNGCKCPAGFRGDGVNGCEDINECAEKLACQCPDCSCKNTWGSYEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLYI +HDTCISK A   + +W  +WVI++GL V     Y +YKYR+R YMD+EI
Sbjct  545  SCGGQLLYIHEHDTCISKDAANSEVSWGVMWVIILGLTVAGVAGYALYKYRIRRYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ   PNH+
Sbjct  605  RAIMAQYMPLDNQ---PNHM  621



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T SAC       C CPPGFKGDG KSCEDIDECK+K  CQC  CSC+NTWGSY+C
Sbjct  481  TRNGKTISACSNEVSEGCKCPPGFKGDGIKSCEDIDECKEKLYCQCKGCSCENTWGSYEC  540

Query  580  TC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  N +LY+R+HDTC+SK AT     W+ +WVI  GL +   GAY VYKYRLRSYMD+E
Sbjct  541  SCGGNNMLYMREHDTCLSKEATSA-VGWSFLWVIFFGLVLAGVGAYAVYKYRLRSYMDSE  599

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ     H
Sbjct  600  IRAIMAQYMPLDNQEAANQH  619



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             RNG T SAC       C CPPGF+GDG KSCEDIDECKDK  CQC  CSC+NTWGSY+C
Sbjct  483  ARNGKTISACSNEVSEGCKCPPGFRGDGIKSCEDIDECKDKLYCQCKGCSCENTWGSYEC  542

Query  580  TC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  N +LY+R+HDTC+SK AT     W+ +WVI  GL +   GAY VYKYRLRSYMD+E
Sbjct  543  SCGGNNMLYMREHDTCLSKEATST-VGWSFLWVIFFGLALAGVGAYAVYKYRLRSYMDSE  601

Query  403  IRAIMAQYMPLDNQSEIPN--HVSDS  332
            IRAIMAQYMPLDNQ E PN  HV+ +
Sbjct  602  IRAIMAQYMPLDNQ-EAPNQHHVAHA  626



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG  YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQC EC CKNTWGSYDC
Sbjct  479  TQNGRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCAECKCKNTWGSYDC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C+  LLY+ +HDTCISK A + + +W  VW I++GL V    AY VYKYR+R YMD+EI
Sbjct  539  SCNANLLYMHEHDTCISKDA-KSEFSWGLVWTIILGLAVAGVSAYAVYKYRIRRYMDSEI  597

Query  400  RAIMAQYMPLD  368
            RAIMAQYMPLD
Sbjct  598  RAIMAQYMPLD  608



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 107/143 (75%), Gaps = 6/143 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T  G TYSACV   E  C CPPGFKGDG   CED+DECK+KTACQC  C CKNTWGSY+C
Sbjct  482  THEGKTYSACV---EDGCKCPPGFKGDGINKCEDVDECKEKTACQCSGCKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C   LLY+++HDTCISK+A+  +  W+ +WVIL GL +   G Y VYKYR+RSYMD+EI
Sbjct  539  SCGGDLLYMKEHDTCISKKAS-TEVGWSFLWVILFGLVIAGIGGYAVYKYRIRSYMDSEI  597

Query  400  RAIMAQYMPLDNQ-SEIPNHVSD  335
            RAIMAQYMPLDNQ  +I  H  D
Sbjct  598  RAIMAQYMPLDNQEGQIHVHHGD  620



>ref|XP_010252052.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=495

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC   +   C CPPGFKGDG  +CED++ECK+K ACQCPEC CKNTWGSY+C
Sbjct  352  TQDGKTFSACTEGQSKGCKCPPGFKGDGVNTCEDVNECKEKLACQCPECICKNTWGSYEC  411

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+R+HDTCISK+ T     W  V VI++ L  +  G Y VYKYR+R YMD+EI
Sbjct  412  SCSGNLLYMREHDTCISKQGTST-MGWNIVGVIVLALAAIGVGGYAVYKYRIRRYMDSEI  470

Query  400  RAIMAQYMPLDNQSEIPNHVSDS  332
            RAIMAQYMPLD+Q +  + V+ +
Sbjct  471  RAIMAQYMPLDSQGDNFSRVTHA  493



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR   +YSAC+      C CPPGF+GDG  SCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  480  TRGSRSYSACIDGHTKGCKCPPGFRGDGANSCEDVDECKEKLACQCPECQCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS+GL Y R++D CI K A  +      VW++++ LG+   G Y  YKYR++ YMD+EI
Sbjct  540  SCSDGLFYARENDMCIGKYAASMAGG-GIVWLVILVLGIAGTGVYAFYKYRIQRYMDSEI  598

Query  400  RAIMAQYMPLDNQSEIPNHVSDS  332
            RAIMAQYMPLDNQ EI +   + 
Sbjct  599  RAIMAQYMPLDNQPEISSQAHEG  621



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR   +YSAC+      C CPPGF+GDG  SCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  482  TRGSRSYSACIDGHTKGCKCPPGFRGDGANSCEDVDECKEKLACQCPECQCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS+GL Y R++D CI K A  +      VW++++ LG+   G Y  YKYR++ YMD+EI
Sbjct  542  SCSDGLFYARENDMCIGKYAASMAGG-GIVWLVILVLGIAGTGVYAFYKYRIQRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVSDS  332
            RAIMAQYMPLDNQ EI +   + 
Sbjct  601  RAIMAQYMPLDNQPEISSQAHEG  623



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T+SAC   +   C CPPGFKGDG  +CED++ECK+K ACQCPEC CKNTWGSY+C
Sbjct  481  TQDGKTFSACTEGQSKGCKCPPGFKGDGVNTCEDVNECKEKLACQCPECICKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+R+HDTCISK+ T     W  V VI++ L  +  G Y VYKYR+R YMD+EI
Sbjct  541  SCSGNLLYMREHDTCISKQGTST-MGWNIVGVIVLALAAIGVGGYAVYKYRIRRYMDSEI  599

Query  400  RAIMAQYMPLDNQSEIPNHVSDS  332
            RAIMAQYMPLD+Q +  + V+ +
Sbjct  600  RAIMAQYMPLDSQGDNFSRVTHA  622



>ref|XP_001777810.1| predicted protein [Physcomitrella patens]
 gb|EDQ57348.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R   T+SAC  S+   C CP GF+GDG K C DIDECK+K+ CQCPEC C N WG YDC 
Sbjct  484  RGDITFSACHESQSKGCQCPRGFRGDGIKECIDIDECKEKSKCQCPECMCTNKWGDYDCG  543

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            CS  LLYIR+HDTCISK++   K  WA   ++ +G+  +    Y+VYKYRLRSYMD+EIR
Sbjct  544  CSKDLLYIREHDTCISKKSQSSKLGWAVSLIVFLGVASLGVVGYVVYKYRLRSYMDSEIR  603

Query  397  AIMAQYMPLDNQSEIPNHVSD  335
            AIMAQYMPLD+ SE+ +H+++
Sbjct  604  AIMAQYMPLDSSSEVNHHLTE  624



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED++ECK+K  CQCP+C CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSSDCKCPLGFKGDGVKSCEDVNECKEKKVCQCPDCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKYR+R+YMD E
Sbjct  542  SCKNGLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRTYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR  +TYSACV      C CP GFKGDG KSCED++ECK+KT CQC +C CKNTWGSY+C
Sbjct  482  TRGSYTYSACVDDHSSDCKCPLGFKGDGVKSCEDVNECKEKTVCQCADCKCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C NGLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKYR+RSYMD E
Sbjct  542  SCKNGLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRSYMDAE  601

Query  403  IRAIMAQYMPLDNQ  362
            IR IMAQYMPL++Q
Sbjct  602  IRGIMAQYMPLESQ  615



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 100/139 (72%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G+TYSAC       C CPPGFKGDG KSCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  479  TRGGYTYSACTDDHSSVCKCPPGFKGDGVKSCEDVDECKEKLACQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TC  GL Y+R+ DTCI      VK  W+ V ++L+ L       Y +YKYR+R YMD+EI
Sbjct  539  TCRKGLFYLRELDTCIGAFGA-VKLGWSFVLILLLALTAATLSGYAIYKYRIRHYMDSEI  597

Query  400  RAIMAQYMPLDNQSEIPNH  344
            R+IMAQYMPLD+Q   PN+
Sbjct  598  RSIMAQYMPLDSQ---PNN  613



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T SAC       C CP GFKGDG KSCEDIDECKDK  CQC  CSCKNTWGSY+C
Sbjct  482  TKDGKTISACSNEVSEGCKCPVGFKGDGEKSCEDIDECKDKLYCQCKGCSCKNTWGSYEC  541

Query  580  TCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  + +LY+R+HDTCISK+ T     W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  542  SCGDDNMLYMREHDTCISKKGTTSTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  601

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ     H
Sbjct  602  IRAIMAQYMPLDNQEGANQH  621



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 100/139 (72%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G+TYSAC       C CPPGFKGDG KSCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  479  TRGGYTYSACTDDHSSVCKCPPGFKGDGVKSCEDVDECKEKLACQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TC  GL Y+R+ DTCI      VK  W+ V ++L+ L       Y +YKYR+R YMD+EI
Sbjct  539  TCRKGLFYLRELDTCIGAFGA-VKLGWSFVLILLLALTAATLSGYAIYKYRIRHYMDSEI  597

Query  400  RAIMAQYMPLDNQSEIPNH  344
            R+IMAQYMPLD+Q   PN+
Sbjct  598  RSIMAQYMPLDSQ---PNN  613



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 101/140 (72%), Gaps = 3/140 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TRNG T SAC   E   C CPPGFKGDG  SCEDIDECKDK  CQC +C+C NTWGSY+C
Sbjct  484  TRNGKTVSACSNEESKGCKCPPGFKGDGINSCEDIDECKDKLFCQCKDCTCDNTWGSYEC  543

Query  580  TC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  N +LY+R+HDTCISK  +     W  +WVI  GL +   GAY VYKYRLRSYMD+E
Sbjct  544  SCGGNNMLYMREHDTCISKVGSS-SVGWGFLWVIFFGLALAGVGAYAVYKYRLRSYMDSE  602

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPL+NQ     H
Sbjct  603  IRAIMAQYMPLENQETQNQH  622



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T NG TYSAC       C CP GFKGDG   CEDIDECK++TACQC EC+CKNTWGSY+C
Sbjct  502  TMNGRTYSACTAD---GCKCPDGFKGDGIHKCEDIDECKERTACQCKECNCKNTWGSYEC  558

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             CS GLLY+++HDTCIS+ A   +  W  +WVI  GL       Y VYKYR+R YMD+EI
Sbjct  559  GCSGGLLYMKEHDTCISESAA-AQVGWNFLWVIFFGLAAAGIAGYAVYKYRIRRYMDSEI  617

Query  400  RAIMAQYMPLDNQSEIPNH  344
            RAIMAQYMPL+NQ +I +H
Sbjct  618  RAIMAQYMPLENQGDIHSH  636



>ref|XP_004172174.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Cucumis 
sativus]
Length=114

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  658  IDECKDKTACQCPECSCKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWvil  479
            I+ECK+K ACQC ECSC NTWGSYDC+CS  LLY+RDHDTCISK A+  KS+W+  WVIL
Sbjct  1    INECKEKKACQCSECSCTNTWGSYDCSCSGDLLYMRDHDTCISKNASAAKSSWSFFWVIL  60

Query  478  iglgvvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  329
            IGL + AGGAY+VYKYRLR+YMD+EIRAIMAQYMPLD+Q E+PNHV   R
Sbjct  61   IGLAIAAGGAYMVYKYRLRAYMDSEIRAIMAQYMPLDSQGEVPNHVHGDR  110



>emb|CDY38158.1| BnaA07g02250D [Brassica napus]
Length=302

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFK DG K+CED++EC++KTACQC  C CKNTWGSY+C
Sbjct  160  TQMGRTYSACRDDHSKGCKCPPGFKRDGLKNCEDVNECEEKTACQCRGCKCKNTWGSYEC  219

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR+R+YMD+EI
Sbjct  220  SCSGSLLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEI  278

Query  400  RAIMAQYMPLDNQ  362
            RAIMAQYMPLDN 
Sbjct  279  RAIMAQYMPLDNH  291



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T SAC   E   C CP GFKGDG KSCEDIDECK+K  CQC  CSCKNTWGSY+C
Sbjct  507  TKDGKTISACSNEEPDGCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCSCKNTWGSYEC  566

Query  580  TCSNG-LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C +  +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  567  SCGDDKMLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  626

Query  403  IRAIMAQYMPLDNQ  362
            IRAIMAQYMPLDNQ
Sbjct  627  IRAIMAQYMPLDNQ  640



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T SAC   E   C CP GFKGDG KSCEDIDECK+K  CQC  CSCKNTWGSY+C
Sbjct  481  TKDGKTISACSNEEPDGCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCSCKNTWGSYEC  540

Query  580  TCSNG-LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C +  +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  541  SCGDDKMLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  600

Query  403  IRAIMAQYMPLDNQ  362
            IRAIMAQYMPLDNQ
Sbjct  601  IRAIMAQYMPLDNQ  614



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = -3

Query  754  RNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            R G  YSAC+      C CPPGF+GDG  SC+D+DECK+K ACQCPEC+CKNTWGSY+C 
Sbjct  484  RGGRAYSACIDDRTKGCKCPPGFRGDGVHSCKDVDECKEKLACQCPECNCKNTWGSYECR  543

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            C+NGL Y+R+ D CI K +  V S    +W++++ LG      Y+ YKYR++ YMD EIR
Sbjct  544  CNNGLFYVRESDMCIGKYSASVSSG-GFIWLVILLLGTCGAVGYVFYKYRIQRYMDDEIR  602

Query  397  AIMAQYMPLDNQSEIPNHV  341
            AIMAQYMPLDNQ E  N V
Sbjct  603  AIMAQYMPLDNQPEHTNQV  621



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 104/140 (74%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            ++ G  Y+AC+      CTCPPGF+GDG KSCEDIDEC++KTACQCP C CKNTWGSY+C
Sbjct  480  SQGGKAYTACLDDYRKGCTCPPGFRGDGVKSCEDIDECQEKTACQCPSCKCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C +GL Y R++DTC+   +    ++  ++W+I++ + V   G Y  YKYR++ YMD+EI
Sbjct  540  KCGSGLFYSRENDTCLGAYS----ASGVSIWMIMLIVVVAVSGGYAFYKYRIQRYMDSEI  595

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ ++PN V
Sbjct  596  RAIMAQYMPLDNQPDVPNQV  615



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G  +SAC  +    C CP GF+GDG   CED+DECK K ACQC EC CKNTWGSYDC
Sbjct  486  TRDGVRHSACQETHTKGCECPAGFRGDGVNQCEDVDECKSKLACQCKECHCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C   LLYI++HDTCISK +   +  W+A + IL GL VV    Y++YKYR+RSYMD+EI
Sbjct  546  QCDGNLLYIKEHDTCISKISV-TRVGWSATFFILAGLAVVGAVGYVIYKYRIRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q+E+  H+ +
Sbjct  605  RAIMAQYMPLDSQNEVHRHLEE  626



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR+G  +SAC  +    C CP GF+GDG   CED+DECK K ACQC EC CKNTWGSYDC
Sbjct  486  TRDGVRHSACQETHTKGCECPAGFRGDGVNQCEDVDECKSKLACQCKECHCKNTWGSYDC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C   LLYI++HDTCISK +   +  W+A + IL GL VV    Y++YKYR+RSYMD+EI
Sbjct  546  QCDGNLLYIKEHDTCISKISV-TRVGWSATFFILAGLAVVGAVGYVIYKYRIRSYMDSEI  604

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLD+Q+E+  H+ +
Sbjct  605  RAIMAQYMPLDSQNEVHRHLEE  626



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 6/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            +  G TYSACV  +EG C CP GFKGDG   CED+DECK+KTACQC  C CKNTWGSY+C
Sbjct  483  SHEGKTYSACV--DEG-CKCPLGFKGDGVDKCEDVDECKEKTACQCSGCKCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C + LLYI++HDTCISK+ +  +  W+ +WVI  GL +   GAY +YKYR+RSYMD+EI
Sbjct  540  SCGDDLLYIKEHDTCISKKPS-TEVGWSFLWVIFFGLVIAGVGAYAIYKYRIRSYMDSEI  598

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E  NH+
Sbjct  599  RAIMAQYMPLDNQ-EAQNHI  617



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 5/139 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            TR G+TYSAC       C CPPGF+GDG KSCED+DECK+K ACQCPEC CKNTWGSY+C
Sbjct  479  TRGGYTYSACTDDHSSVCKCPPGFRGDGVKSCEDVDECKEKLACQCPECKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +C  GL Y+R+ DTCI      VK  W+ V ++L+ L       Y +YKYR+R YMD+EI
Sbjct  539  SCRKGLFYLRELDTCIGAFGA-VKLGWSFVLILLLALIAATLSGYAIYKYRIRHYMDSEI  597

Query  400  RAIMAQYMPLDNQSEIPNH  344
            R+IMAQYMPLD+Q   PN+
Sbjct  598  RSIMAQYMPLDSQ---PNN  613



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 4/140 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC+      C CPPGFKGDG   CED+DECK+K ACQCP C CKNTWGSY+C
Sbjct  481  TQEGKTYSACLDDHSHGCKCPPGFKGDGVNGCEDVDECKEKLACQCPGCKCKNTWGSYEC  540

Query  580  TCSNGLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C +G LY+R+HD CISK   T+V S +  +W I++GL V     Y +YKYR+R YMD+E
Sbjct  541  SCCDGSLYMREHDMCISKNGKTEVSSGF--IWAIILGLVVAGAVGYAIYKYRIRRYMDSE  598

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ    +H
Sbjct  599  IRAIMAQYMPLDNQPSNIHH  618



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+N   YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQC EC CKNTWGSYDC
Sbjct  479  TQNSRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCAECKCKNTWGSYDC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLY+ +HDTCISK A + + +W  VW I++GL V    AY VYKYR+R YMD+EI
Sbjct  539  SCSANLLYMHEHDTCISKDA-KSEFSWGLVWTIILGLAVAGVSAYAVYKYRIRRYMDSEI  597

Query  400  RAIMAQYMPL  371
            RAIMAQYMPL
Sbjct  598  RAIMAQYMPL  607



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFKGDG K+CED++EC++KTACQC  C CKNTWGSY+C
Sbjct  493  TQMGRTYSACRDDHSKGCKCPPGFKGDGLKNCEDVNECEEKTACQCRGCKCKNTWGSYEC  552

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR+R+YMD+EI
Sbjct  553  SCSGSLLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEI  611

Query  400  RAIMAQYMPLDNQ  362
            RAIMAQYMPLDN 
Sbjct  612  RAIMAQYMPLDNH  624



>emb|CDY62642.1| BnaCnng40690D [Brassica napus]
Length=140

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = -3

Query  748  GHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCTCS  572
            G TYSAC       C CPPGF GDG K+C D++EC++KT CQC  C CKNTWGSY+C+C+
Sbjct  2    GRTYSACRNDHLKGCKCPPGFSGDGFKNCTDVNECEEKTVCQCRGCKCKNTWGSYECSCN  61

Query  571  NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  392
              LLYIR+HD CISK A +  ++W  +W+I++GLG  A GAY VYKYR+R+YMD+EIRAI
Sbjct  62   GSLLYIREHDICISKDA-RGDASWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAI  120

Query  391  MAQYMPLDNQ  362
            MAQYMPLDN 
Sbjct  121  MAQYMPLDNH  130



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             R+GH YSAC+    GKC CPPGFKGDG K+CEDIDECK+K ACQCPECSCKNTWGSY+C
Sbjct  486  ARDGHAYSACLDDGNGKCQCPPGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYEC  545

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLR  422
            TCS  LLYIRDHDTCISK  T+V+S+WAAVWVILIGL + +GGAYL+YKYRLR
Sbjct  546  TCSGDLLYIRDHDTCISKSGTEVRSSWAAVWVILIGLAMASGGAYLIYKYRLR  598



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFKGDG K+CED++EC++KTACQC  C CKNTWGSY+C
Sbjct  485  TQMGRTYSACRDDHSKGCKCPPGFKGDGLKNCEDVNECEEKTACQCRGCKCKNTWGSYEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CISK A +   +W  +W+I++GLG  A GAY VYKYR+R+YMD+EI
Sbjct  545  SCSGSLLYIREHDICISKDA-RGDVSWGVIWIIVMGLGAAALGAYTVYKYRIRTYMDSEI  603

Query  400  RAIMAQYMPLDNQ  362
            RAIMAQYMPLDN 
Sbjct  604  RAIMAQYMPLDNH  616



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 23/161 (14%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSACV  +   C CPPGFKGDG  +C+DIDECK+K+ACQC EC+CKNT+GSY+C
Sbjct  476  TKGGRTYSACVNDQTKGCYCPPGFKGDGVNTCDDIDECKEKSACQCSECNCKNTYGSYEC  535

Query  580  TCSNGLLYIRDHDTCISKRATQVKS----------------------AWAAVWviliglg  467
            +CS  LLY+ + DTCISK    + S                      +W+  WV+++ + 
Sbjct  536  SCSKNLLYLHEQDTCISKHKKVIVSLSFIIHILTTVVCIAGKAGSGPSWSVAWVVILAMA  595

Query  466  vvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  344
             V    Y VYKYR+R YMD+EIRAIMAQYMPLDN+ E+ NH
Sbjct  596  AVGLAGYTVYKYRIRRYMDSEIRAIMAQYMPLDNEGEMRNH  636



>ref|XP_008660179.1| PREDICTED: vacuolar-sorting receptor 1 [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T++G T SAC       C CP GFKGDG KSCEDIDEC++K  CQC  CSCKNTWGSY+C
Sbjct  482  TKDGKTISACSNEISEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYEC  541

Query  580  TCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  + +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  542  SCGDDNMLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  601

Query  403  IRAIMAQYMPLDNQSEIPNH  344
            IRAIMAQYMPLDNQ     H
Sbjct  602  IRAIMAQYMPLDNQEGANQH  621



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+   +YSAC+      C CPPGF+GDG  SCED+DECK+K  CQCPEC CKNTWGSY+C
Sbjct  482  TQGSRSYSACIDDHTKGCKCPPGFRGDGVHSCEDVDECKEKLVCQCPECQCKNTWGSYEC  541

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            TCS+ L Y R++D CI K A  V      VW++++ LG+     Y  YKYR++ YMD+EI
Sbjct  542  TCSDDLFYTRENDMCIGKYAASVAGG-GIVWMVILVLGIAGTSGYAFYKYRIQRYMDSEI  600

Query  400  RAIMAQYMPLDNQSEIPNHVSD  335
            RAIMAQYMPLDNQ EI +   +
Sbjct  601  RAIMAQYMPLDNQPEISSQAHE  622



>ref|XP_010228654.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=627

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG T SAC   E   C CP GFKGDG KSCEDIDECK KTACQC  CSC+NTWGSY+C
Sbjct  479  TKNGKTISACSHEESNGCKCPEGFKGDGIKSCEDIDECKMKTACQCTGCSCENTWGSYEC  538

Query  580  TCSNG--LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDT  407
            +C+ G  +LY+R+ DTCISK+A      W+ +WVI  GL     GAY VYKYRLRSYMD+
Sbjct  539  SCAGGDSMLYMREQDTCISKQAVS-SVGWSFMWVIFFGLVFAGVGAYAVYKYRLRSYMDS  597

Query  406  EIRAIMAQYMPLDNQ  362
            EIRAIMAQYMPLD+Q
Sbjct  598  EIRAIMAQYMPLDSQ  612



>ref|XP_010260770.1| PREDICTED: vacuolar-sorting receptor 7 [Nelumbo nucifera]
 ref|XP_010260771.1| PREDICTED: vacuolar-sorting receptor 7 [Nelumbo nucifera]
Length=623

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDGKSCEDIDECKDKTACQCPECSCKNTWGSYDCT  578
            TRNG T+SAC  SE   C CPPGF+GDG +CEDI+ECK+  ACQC  C+CKNTWGSYDC 
Sbjct  481  TRNGKTFSACSESEVKGCHCPPGFQGDGHTCEDINECKEGLACQCDGCTCKNTWGSYDCK  540

Query  577  CSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIR  398
            C   LLYI D DTCI++ ++  K AW   +++L  +       Y+ YKYRLRSYMD+EI 
Sbjct  541  CKGDLLYIMDQDTCIARNSS--KYAWFLTFLVLACIAGAGLAGYIFYKYRLRSYMDSEIM  598

Query  397  AIMAQYMPLDNQ  362
            AIM+QYMPLDNQ
Sbjct  599  AIMSQYMPLDNQ  610



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             + G  YSAC+      CTCPPGF+GDG +SCEDIDECK+KTACQCP C CKNTWGSY+C
Sbjct  480  VQGGRAYSACLDDYRKGCTCPPGFRGDGVQSCEDIDECKEKTACQCPGCKCKNTWGSYEC  539

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C +GL Y R++DTC  + +  V +    +WVI++ L V   G Y  YKYR++ YMD+EI
Sbjct  540  KCKSGLFYSRENDTCFGEYSASVLN----IWVIILVLVVAVAGGYAFYKYRIQRYMDSEI  595

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E+ N V
Sbjct  596  RAIMAQYMPLDNQPEVSNQV  615



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 5/140 (4%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
             + G  YSAC+      CTCPPGF+GDG +SCEDIDECK+KTACQCP C CKNTWGSY+C
Sbjct  479  VQGGRAYSACLDDYRKGCTCPPGFRGDGVQSCEDIDECKEKTACQCPGCKCKNTWGSYEC  538

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
             C +GL Y R++DTC  + +  V +    +WVI++ L V   G Y  YKYR++ YMD+EI
Sbjct  539  KCKSGLFYSRENDTCFGEYSASVLN----IWVIILVLVVAVAGGYAFYKYRIQRYMDSEI  594

Query  400  RAIMAQYMPLDNQSEIPNHV  341
            RAIMAQYMPLDNQ E+ N V
Sbjct  595  RAIMAQYMPLDNQPEVSNQV  614



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFKGDG K C+D++EC++KTACQC +C CKNTWGSY+C
Sbjct  483  TQMGKTYSACRDDHSKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKCKNTWGSYEC  542

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CI+K A +   +W  +W+I +GL   A GAY +YKYR+R+YMD+EI
Sbjct  543  SCSGSLLYIREHDICINKDA-RGDVSWGVIWIIFMGLSAAALGAYTIYKYRIRTYMDSEI  601

Query  400  RAIMAQYMPLDN  365
            RAIMAQYMPLDN
Sbjct  602  RAIMAQYMPLDN  613



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFKGDG K C+D++EC++KTACQC +C CKNTWGSY+C
Sbjct  483  TQMGKTYSACRDDHSKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKCKNTWGSYEC  542

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CI+K A +   +W  +W+I +GL   A GAY +YKYR+R+YMD+EI
Sbjct  543  SCSGSLLYIREHDICINKDA-RGDVSWGVIWIIFMGLSAAALGAYTIYKYRIRTYMDSEI  601

Query  400  RAIMAQYMPLDN  365
            RAIMAQYMPLDN
Sbjct  602  RAIMAQYMPLDN  613



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 2/132 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFKGDG K C+D++EC++KTACQC +C CKNTWGSY+C
Sbjct  483  TQMGKTYSACRDDHSKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKCKNTWGSYEC  542

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CI+K A +   +W  +W+I +GLG  A GAY +YKYR+R+YMD+EI
Sbjct  543  SCSGSLLYIREHDICINKDA-RGDVSWGVIWIIFMGLGAAALGAYTIYKYRIRTYMDSEI  601

Query  400  RAIMAQYMPLDN  365
            RAIMAQYMPLDN
Sbjct  602  RAIMAQYMPLDN  613



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+ G TYSAC       C CPPGFKGDG K+C D++EC++KTACQC  C CKNTWGSY+C
Sbjct  485  TQMGRTYSACRDDHSKGCKCPPGFKGDGLKNCTDVNECEEKTACQCRGCKCKNTWGSYEC  544

Query  580  TCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEI  401
            +CS  LLYIR+HD CISK A +   +W  +W+I++GLG  A GAY VYKYR+R+YMD+EI
Sbjct  545  SCSGNLLYIREHDICISKDA-RGDVSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEI  603

Query  400  RAIMAQYMPLDNQ  362
            RAIMAQYMPLDN 
Sbjct  604  RAIMAQYMPLDNH  616



>gb|AAF80450.1|AF161719_1 vacuolar targeting receptor bp-80 [Triticum aestivum]
Length=624

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  757  TRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDC  581
            T+NG T SAC   E   C CP GFKGDG KSCEDIDECK K+ACQC  CSC+NTWGSY+C
Sbjct  477  TKNGKTISACSHEESEGCKCPQGFKGDGVKSCEDIDECKAKSACQCNGCSCENTWGSYEC  536

Query  580  TC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTE  404
            +C  N +LY+R+ DTCISK+A      W+ +WVI  GL     GAY VYKYRLRSYMD+E
Sbjct  537  SCGGNNMLYMREQDTCISKQAAS-SVGWSFMWVIFFGLVFAGVGAYAVYKYRLRSYMDSE  595

Query  403  IRAIMAQYMPLDNQ  362
            IRAIMAQYMPLD+Q
Sbjct  596  IRAIMAQYMPLDSQ  609



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890