BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036H02

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595430.1|  PREDICTED: uncharacterized protein LOC104091732    188   6e-52   Nicotiana tomentosiformis
ref|XP_009769069.1|  PREDICTED: uncharacterized protein LOC104219993    187   2e-51   Nicotiana sylvestris
ref|XP_011084036.1|  PREDICTED: uncharacterized protein LOC105166393    184   1e-50   Sesamum indicum [beniseed]
emb|CDP10517.1|  unnamed protein product                                177   3e-48   Coffea canephora [robusta coffee]
ref|XP_010323258.1|  PREDICTED: uncharacterized protein LOC101249097    177   9e-48   Solanum lycopersicum
ref|XP_006359539.1|  PREDICTED: uncharacterized protein LOC102594159    169   7e-45   Solanum tuberosum [potatoes]
ref|XP_003549703.1|  PREDICTED: uncharacterized protein LOC100781443    157   6e-41   Glycine max [soybeans]
ref|XP_003542623.1|  PREDICTED: uncharacterized protein LOC100802615    156   2e-40   Glycine max [soybeans]
gb|EEC83275.1|  hypothetical protein OsI_28629                          150   6e-39   Oryza sativa Indica Group [Indian rice]
gb|EEE68404.1|  hypothetical protein OsJ_26758                          149   2e-38   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ84968.1|  predicted protein                                      143   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006660014.1|  PREDICTED: uncharacterized protein LOC102712285    149   3e-38   Oryza brachyantha
ref|XP_010542083.1|  PREDICTED: uncharacterized protein LOC104815398    150   4e-38   Tarenaya hassleriana [spider flower]
ref|NP_001061456.1|  Os08g0288500                                       149   7e-38   
ref|XP_004973180.1|  PREDICTED: uncharacterized protein LOC101758421    146   7e-37   Setaria italica
gb|EYU25294.1|  hypothetical protein MIMGU_mgv1a003157mg                143   3e-36   Erythranthe guttata [common monkey flower]
ref|XP_009358504.1|  PREDICTED: uncharacterized protein LOC103949129    142   6e-36   
ref|XP_006381899.1|  hypothetical protein POPTR_0006s20370g             136   3e-35   
ref|XP_011017950.1|  PREDICTED: uncharacterized protein LOC105121122    141   3e-35   Populus euphratica
ref|XP_007013705.1|  Zinc finger protein, putative isoform 2            140   3e-35   
ref|XP_009338424.1|  PREDICTED: uncharacterized protein LOC103930775    141   5e-35   
ref|XP_002325162.2|  D111/G-patch domain-containing family protein      140   7e-35   Populus trichocarpa [western balsam poplar]
ref|XP_007013704.1|  Zinc finger protein, putative isoform 1            140   8e-35   
ref|XP_008801999.1|  PREDICTED: uncharacterized protein LOC103715...    140   1e-34   
gb|EMT16376.1|  Tuftelin-interacting protein 11                         140   1e-34   
ref|XP_011033482.1|  PREDICTED: uncharacterized protein LOC105131955    140   1e-34   Populus euphratica
gb|KEH32162.1|  D111/G-patch domain protein                             140   1e-34   Medicago truncatula
ref|NP_001152479.1|  LOC100286119                                       140   1e-34   Zea mays [maize]
ref|XP_008801998.1|  PREDICTED: uncharacterized protein LOC103715...    140   1e-34   Phoenix dactylifera
gb|KJB64581.1|  hypothetical protein B456_010G054900                    138   6e-34   Gossypium raimondii
ref|XP_003573663.1|  PREDICTED: uncharacterized protein LOC100845409    138   7e-34   Brachypodium distachyon [annual false brome]
ref|XP_010109666.1|  Zinc finger CCCH-type with G patch domain-co...    138   7e-34   
ref|XP_010913384.1|  PREDICTED: uncharacterized protein LOC105039...    135   4e-33   Elaeis guineensis
ref|XP_010913385.1|  PREDICTED: uncharacterized protein LOC105039...    135   5e-33   Elaeis guineensis
gb|AES91716.2|  D111/G-patch domain protein                             134   2e-32   Medicago truncatula
ref|XP_003609519.1|  Zinc finger CCCH-type with G patch domain-co...    134   2e-32   
ref|XP_002523543.1|  zinc finger protein, putative                      133   3e-32   Ricinus communis
ref|XP_009387541.1|  PREDICTED: uncharacterized protein LOC103974...    131   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387542.1|  PREDICTED: uncharacterized protein LOC103974...    131   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687767.1|  PREDICTED: uncharacterized protein LOC104901840    132   1e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW82693.1|  hypothetical protein EUGRSUZ_C04073                     125   6e-31   Eucalyptus grandis [rose gum]
ref|XP_010042746.1|  PREDICTED: septin and tuftelin-interacting p...    124   7e-31   
ref|XP_009341804.1|  PREDICTED: uncharacterized protein LOC103933838    129   8e-31   Pyrus x bretschneideri [bai li]
ref|XP_009366281.1|  PREDICTED: uncharacterized protein LOC103956064    129   8e-31   
ref|XP_009341849.1|  PREDICTED: uncharacterized protein LOC103933875    129   9e-31   Pyrus x bretschneideri [bai li]
ref|XP_004508396.1|  PREDICTED: uncharacterized protein LOC101505169    129   1e-30   
ref|XP_006407631.1|  hypothetical protein EUTSA_v10020109mg             128   2e-30   Eutrema salsugineum [saltwater cress]
gb|KDP38622.1|  hypothetical protein JCGZ_03975                         126   7e-30   Jatropha curcas
gb|KFK38375.1|  hypothetical protein AALP_AA3G105800                    126   9e-30   Arabis alpina [alpine rockcress]
ref|XP_008443896.1|  PREDICTED: uncharacterized protein LOC103487...    125   1e-29   Cucumis melo [Oriental melon]
ref|XP_008336930.1|  PREDICTED: uncharacterized protein LOC103400027    125   2e-29   
ref|XP_008443898.1|  PREDICTED: uncharacterized protein LOC103487...    125   2e-29   Cucumis melo [Oriental melon]
ref|XP_007155121.1|  hypothetical protein PHAVU_003G175300g             125   3e-29   Phaseolus vulgaris [French bean]
ref|XP_010041360.1|  PREDICTED: zinc finger CCCH-type with G patc...    120   3e-29   
gb|KCW44417.1|  hypothetical protein EUGRSUZ_L02096                     120   4e-29   Eucalyptus grandis [rose gum]
ref|XP_004146703.1|  PREDICTED: uncharacterized protein LOC101215133    124   6e-29   Cucumis sativus [cucumbers]
gb|KGN65218.1|  hypothetical protein Csa_1G266150                       124   6e-29   Cucumis sativus [cucumbers]
ref|XP_004162452.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    123   1e-28   
ref|XP_007203786.1|  hypothetical protein PRUPE_ppa001771mg             123   1e-28   Prunus persica
ref|XP_006453696.1|  hypothetical protein CICLE_v10007567mg             123   1e-28   Citrus clementina [clementine]
tpg|DAA46961.1|  TPA: hypothetical protein ZEAMMB73_831663              114   2e-28   
ref|XP_008242893.1|  PREDICTED: uncharacterized protein LOC103341193    122   3e-28   Prunus mume [ume]
ref|XP_002884758.1|  hypothetical protein ARALYDRAFT_478310             122   3e-28   Arabidopsis lyrata subsp. lyrata
emb|CDY41580.1|  BnaC05g43170D                                          122   3e-28   Brassica napus [oilseed rape]
ref|XP_010464642.1|  PREDICTED: uncharacterized protein LOC104745...    121   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010464640.1|  PREDICTED: uncharacterized protein LOC104745...    121   4e-28   
ref|XP_010486561.1|  PREDICTED: dentin sialophosphoprotein-like i...    120   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010486559.1|  PREDICTED: dentin sialophosphoprotein-like i...    120   9e-28   Camelina sativa [gold-of-pleasure]
emb|CDY54616.1|  BnaA05g28700D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_004287228.1|  PREDICTED: uncharacterized protein LOC101294206    119   2e-27   Fragaria vesca subsp. vesca
ref|XP_010040586.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-27   
ref|XP_006299668.1|  hypothetical protein CARUB_v10015856mg             119   4e-27   Capsella rubella
ref|XP_010477969.1|  PREDICTED: uncharacterized protein LOC104756959    119   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009146893.1|  PREDICTED: uncharacterized protein LOC103870513    118   5e-27   Brassica rapa
ref|XP_010265699.1|  PREDICTED: uncharacterized protein LOC104603377    118   6e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010244790.1|  PREDICTED: uncharacterized protein LOC104588524    117   1e-26   Nelumbo nucifera [Indian lotus]
ref|NP_566359.1|  D111/G-patch domain-containing protein                113   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KCW82695.1|  hypothetical protein EUGRSUZ_C04076                     103   3e-24   Eucalyptus grandis [rose gum]
gb|EPS60366.1|  hypothetical protein M569_14436                       81.3    1e-16   Genlisea aurea
emb|CBI25601.3|  unnamed protein product                              79.0    2e-13   Vitis vinifera
ref|XP_002265219.2|  PREDICTED: uncharacterized protein LOC100260114  79.0    2e-13   Vitis vinifera
ref|XP_001776479.1|  predicted protein                                78.6    3e-13   
ref|XP_002163283.2|  PREDICTED: tuftelin-interacting protein 11-like  72.8    2e-11   
ref|XP_001418877.1|  predicted protein                                67.4    3e-11   Ostreococcus lucimarinus CCE9901
ref|XP_004164520.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  72.0    4e-11   
ref|XP_004151854.1|  PREDICTED: tuftelin-interacting protein 11-like  72.0    4e-11   
ref|XP_008462814.1|  PREDICTED: tuftelin-interacting protein 11       71.6    5e-11   Cucumis melo [Oriental melon]
gb|KII63443.1|  Tuftelin-interacting protein 11                       70.9    8e-11   Thelohanellus kitauei
ref|XP_004300043.1|  PREDICTED: septin and tuftelin-interacting p...  70.5    1e-10   Fragaria vesca subsp. vesca
ref|XP_010065638.1|  PREDICTED: septin and tuftelin-interacting p...  70.1    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010553814.1|  PREDICTED: septin and tuftelin-interacting p...  70.1    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_005645320.1|  hypothetical protein COCSUDRAFT_57335            69.3    2e-10   Coccomyxa subellipsoidea C-169
ref|XP_010906679.1|  PREDICTED: septin and tuftelin-interacting p...  69.7    2e-10   Elaeis guineensis
ref|XP_006679437.1|  hypothetical protein BATDEDRAFT_25372            69.7    2e-10   Batrachochytrium dendrobatidis JAM81
gb|KJB44347.1|  hypothetical protein B456_007G247300                  69.3    3e-10   Gossypium raimondii
gb|KHG03685.1|  Tuftelin-interacting 11                               69.3    3e-10   Gossypium arboreum [tree cotton]
gb|KJB73095.1|  hypothetical protein B456_011G214400                  68.9    3e-10   Gossypium raimondii
ref|XP_003080235.1|  Tuftelin-interacting protein TIP39, contains...  66.2    4e-10   
emb|CDQ06825.1|  Protein Bm9097, isoform a                            67.8    5e-10   
ref|XP_008804692.1|  PREDICTED: septin and tuftelin-interacting p...  67.8    8e-10   Phoenix dactylifera
emb|CEF98642.1|  G-patch domain                                       66.6    1e-09   Ostreococcus tauri
gb|KDP39564.1|  hypothetical protein JCGZ_02584                       67.4    1e-09   Jatropha curcas
ref|XP_009397719.1|  PREDICTED: septin and tuftelin-interacting p...  67.0    2e-09   
ref|XP_005850261.1|  hypothetical protein CHLNCDRAFT_50559            67.0    2e-09   Chlorella variabilis
ref|XP_010256250.1|  PREDICTED: septin and tuftelin-interacting p...  67.0    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002325453.2|  D111/G-patch domain-containing family protein    66.6    2e-09   
sp|Q0IIX9.2|TFP11_XENTR  RecName: Full=Tuftelin-interacting prote...  66.6    2e-09   Xenopus tropicalis [western clawed frog]
ref|NP_001090845.1|  tuftelin-interacting protein 11                  66.6    2e-09   Xenopus tropicalis [western clawed frog]
ref|XP_010459271.1|  PREDICTED: septin and tuftelin-interacting p...  66.6    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002501462.1|  predicted protein                                66.6    2e-09   Micromonas commoda
gb|KFK43898.1|  hypothetical protein AALP_AA1G188300                  66.2    2e-09   Arabis alpina [alpine rockcress]
ref|XP_001773432.1|  predicted protein                                66.2    3e-09   
ref|XP_011098023.1|  PREDICTED: septin and tuftelin-interacting p...  66.2    3e-09   Sesamum indicum [beniseed]
ref|XP_005649692.1|  TFP11-domain-containing protein                  66.2    3e-09   Coccomyxa subellipsoidea C-169
ref|XP_010670678.1|  PREDICTED: septin and tuftelin-interacting p...  66.2    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002524028.1|  tuftelin interacting protein, putative           66.2    3e-09   Ricinus communis
ref|XP_009399051.1|  PREDICTED: septin and tuftelin-interacting p...  65.9    3e-09   
ref|XP_007029764.1|  GC-rich sequence DNA-binding factor-like pro...  65.9    3e-09   
ref|XP_008339239.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  65.9    4e-09   
emb|CDP06007.1|  unnamed protein product                              65.9    4e-09   Coffea canephora [robusta coffee]
ref|XP_009861899.1|  PREDICTED: sip1/TFIP11 interacting protein i...  65.5    4e-09   Ciona intestinalis [sea vase]
ref|NP_001091088.1|  Sip1/TFIP11 interacting protein                  65.5    4e-09   Ciona intestinalis [sea vase]
ref|XP_002949572.1|  hypothetical protein VOLCADRAFT_89953            65.5    5e-09   Volvox carteri f. nagariensis
emb|CDY21767.1|  BnaA09g45180D                                        65.5    5e-09   Brassica napus [oilseed rape]
emb|CBI26422.3|  unnamed protein product                              65.1    5e-09   Vitis vinifera
ref|XP_010094613.1|  Tuftelin-interacting protein 11                  65.5    5e-09   
ref|XP_010498050.1|  PREDICTED: septin and tuftelin-interacting p...  65.1    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009117727.1|  PREDICTED: septin and tuftelin-interacting p...  65.1    6e-09   Brassica rapa
ref|XP_002506795.1|  hypothetical protein MICPUN_113307               65.1    6e-09   Micromonas commoda
ref|XP_007058458.1|  PREDICTED: tuftelin-interacting protein 11       64.7    8e-09   Chelonia mydas [green seaturtle]
ref|XP_005298544.1|  PREDICTED: tuftelin-interacting protein 11       64.7    8e-09   Chrysemys picta bellii
ref|XP_006137534.1|  PREDICTED: tuftelin-interacting protein 11       64.7    8e-09   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_009801630.1|  PREDICTED: septin and tuftelin-interacting p...  64.7    8e-09   Nicotiana sylvestris
ref|XP_009616302.1|  PREDICTED: septin and tuftelin-interacting p...  64.7    8e-09   Nicotiana tomentosiformis
ref|XP_009616253.1|  PREDICTED: septin and tuftelin-interacting p...  64.7    8e-09   Nicotiana tomentosiformis
ref|XP_009603610.1|  PREDICTED: septin and tuftelin-interacting p...  64.7    8e-09   Nicotiana tomentosiformis
gb|EMP37184.1|  Tuftelin-interacting protein 11                       64.7    9e-09   Chelonia mydas [green seaturtle]
ref|XP_010528677.1|  PREDICTED: septin and tuftelin-interacting p...  64.7    9e-09   Tarenaya hassleriana [spider flower]
ref|XP_001781004.1|  predicted protein                                64.7    9e-09   
ref|XP_003080850.1|  Tuftelin-interacting protein TIP39, contains...  63.5    9e-09   Ostreococcus tauri
ref|XP_006836389.1|  hypothetical protein AMTR_s00092p00133670        64.3    1e-08   Amborella trichopoda
gb|ABC69931.1|  STIP                                                  64.3    1e-08   Ciona savignyi [transparent tunicate]
ref|XP_001968838.1|  GG25092                                          64.3    1e-08   Drosophila erecta
ref|XP_007443812.1|  PREDICTED: tuftelin-interacting protein 11       64.3    1e-08   Python bivittatus
ref|XP_002037985.1|  Sip1-TFIP11 interacting protein                  64.3    1e-08   Drosophila sechellia
ref|XP_006261823.1|  PREDICTED: tuftelin-interacting protein 11       64.3    1e-08   Alligator mississippiensis
gb|EPS61679.1|  hypothetical protein M569_13115                       64.3    1e-08   Genlisea aurea
ref|XP_006015340.1|  PREDICTED: tuftelin-interacting protein 11       64.3    1e-08   
ref|XP_006352537.1|  PREDICTED: tuftelin-interacting protein 11-like  64.3    1e-08   Solanum tuberosum [potatoes]
emb|CDX81801.1|  BnaC08g38000D                                        63.9    1e-08   
gb|EHB00444.1|  G patch domain-containing protein 2                   63.9    1e-08   Heterocephalus glaber [naked mole rat]
ref|XP_004880608.1|  PREDICTED: G patch domain-containing protein...  63.5    1e-08   
ref|XP_008140712.1|  PREDICTED: tuftelin-interacting protein 11       63.9    1e-08   Eptesicus fuscus
ref|XP_006102063.1|  PREDICTED: tuftelin-interacting protein 11       63.9    1e-08   Myotis lucifugus
ref|XP_005869775.1|  PREDICTED: tuftelin-interacting protein 11       63.9    1e-08   Myotis brandtii
ref|XP_006762106.1|  PREDICTED: tuftelin-interacting protein 11       63.9    1e-08   Myotis davidii
ref|XP_004248294.1|  PREDICTED: septin and tuftelin-interacting p...  63.9    1e-08   Solanum lycopersicum
gb|ABC69949.1|  STIP                                                  63.9    1e-08   Chlamydomonas reinhardtii
ref|XP_006306528.1|  hypothetical protein CARUB_v10012542mg           63.9    1e-08   Capsella rubella
ref|XP_010662048.1|  PREDICTED: septin and tuftelin-interacting p...  63.9    1e-08   Vitis vinifera
ref|XP_007151865.1|  hypothetical protein PHAVU_004G082100g           63.9    2e-08   Phaseolus vulgaris [French bean]
ref|XP_002089187.1|  Sip1-TFIP11 interacting protein                  63.9    2e-08   Drosophila yakuba
gb|EOB05036.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Anas platyrhynchos [duck]
ref|XP_004615574.1|  PREDICTED: tuftelin-interacting protein 11       63.9    2e-08   Sorex araneus [Eurasian shrew]
ref|XP_001702893.1|  predicted protein                                63.5    2e-08   Chlamydomonas reinhardtii
ref|XP_005014621.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   
ref|XP_010081004.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Pterocles gutturalis
ref|XP_002078265.1|  GD23359                                          63.5    2e-08   
ref|XP_003761206.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Sarcophilus harrisii
gb|KFV01223.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Pterocles gutturalis
gb|AAF26743.1|AF221101_1  septin interacting protein                  63.5    2e-08   Drosophila melanogaster
ref|XP_010208491.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Colius striatus
gb|KFP23981.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Colius striatus
ref|NP_524725.2|  septin interacting protein 1, isoform A             63.5    2e-08   Drosophila melanogaster
ref|XP_004479136.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Dasypus novemcinctus
ref|NP_001087642.1|  tuftelin-interacting protein 11                  63.5    2e-08   
ref|NP_001091078.1|  tuftelin-interacting protein 11                  63.5    2e-08   Monodelphis domestica
gb|KFQ79462.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Phoenicopterus ruber ruber
ref|XP_009490572.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Pelecanus crispus
gb|KFV72048.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Struthio camelus australis
ref|XP_010131846.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Buceros rhinoceros silvestris
gb|KGL96598.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Charadrius vociferus
gb|KGL84782.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Tinamus guttatus
ref|XP_010176320.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Antrostomus carolinensis
ref|XP_009511274.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Phalacrocorax carbo [common cormorant]
gb|KFW62564.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Pygoscelis adeliae
ref|XP_009571985.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Fulmarus glacialis
ref|XP_009965680.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Tyto alba [Schleiereule]
ref|XP_009809419.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Gavia stellata
gb|KFR13925.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Opisthocomus hoazin [hoatzin]
gb|KFR00697.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Nipponia nippon
ref|XP_010294372.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Phaethon lepturus
gb|KFQ48373.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Pelecanus crispus
gb|KFQ43028.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Nestor notabilis
gb|KFP95623.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Haliaeetus albicilla
ref|XP_009707726.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Cariama cristata
gb|KFP35899.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Chlamydotis macqueenii
gb|KFP12550.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Egretta garzetta
ref|XP_010306276.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Balearica regulorum gibbericeps
gb|KFM09886.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Aptenodytes forsteri
ref|XP_009936877.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Opisthocomus hoazin [hoatzin]
gb|KFW83342.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Manacus vitellinus
ref|XP_008925041.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   
ref|XP_010016065.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Nestor notabilis
ref|XP_009281103.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Aptenodytes forsteri
ref|XP_009983332.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Tauraco erythrolophus
ref|XP_009332696.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Pygoscelis adeliae
ref|XP_010117527.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Chlamydotis macqueenii
ref|XP_009633041.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Egretta garzetta
ref|XP_009927441.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Haliaeetus albicilla
gb|KFO88150.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Buceros rhinoceros silvestris
ref|XP_009676417.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Struthio camelus australis
gb|KFQ39573.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Mesitornis unicolor
gb|KIZ04951.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Monoraphidium neglectum
ref|XP_005336129.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   
ref|XP_006869252.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Chrysochloris asiatica
ref|XP_009466848.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Nipponia nippon
ref|XP_010373885.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Rhinopithecus roxellana
ref|XP_010602003.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Fukomys damarensis [Damara mole rat]
ref|XP_008050251.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Carlito syrichta
ref|XP_009006562.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Callithrix jacchus [common marmoset]
ref|XP_006904928.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Pteropus alecto
ref|NP_036275.1|  tuftelin-interacting protein 11                     63.5    2e-08   Homo sapiens [man]
ref|XP_006213616.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Vicugna pacos
ref|XP_005396205.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Chinchilla lanigera
ref|XP_006185809.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Camelus ferus
ref|NP_001126744.1|  tuftelin-interacting protein 11                  63.5    2e-08   Pongo abelii [orang utan]
ref|XP_010347495.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Saimiri boliviensis boliviensis
ref|XP_003789889.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   
ref|XP_004893175.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.5    2e-08   
ref|XP_003277776.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.5    2e-08   Nomascus leucogenys [White-cheeked Gibbon]
sp|A1XD95.1|TFP11_MACFA  RecName: Full=Tuftelin-interacting prote...  63.5    2e-08   Macaca fascicularis [crab eating macaque]
emb|CAL37965.1|  hypothetical protein                                 63.5    2e-08   synthetic construct
ref|NP_001073621.1|  tuftelin-interacting protein 11                  63.5    2e-08   Pan troglodytes
ref|NP_001073589.1|  tuftelin-interacting protein 11                  63.5    2e-08   Macaca mulatta [rhesus macaque]
ref|NP_001073577.1|  tuftelin-interacting protein 11                  63.5    2e-08   Canis lupus familiaris [dogs]
gb|AAH33080.1|  Tuftelin interacting protein 11                       63.5    2e-08   Homo sapiens [man]
ref|XP_008576508.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005144938.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.5    2e-08   Melopsittacus undulatus
ref|XP_010718697.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Meleagris gallopavo [common turkey]
ref|XP_004766607.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.5    2e-08   Mustela putorius furo [black ferret]
ref|XP_004429903.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ELK18625.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Pteropus alecto
ref|XP_004628080.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Octodon degus
ref|XP_002922821.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   
ref|XP_006738156.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Leptonychotes weddellii
ref|XP_001988208.1|  GH10693                                          63.5    2e-08   Drosophila grimshawi
ref|XP_004412506.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Odobenus rosmarus divergens
gb|KFZ55957.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Podiceps cristatus
ref|XP_006890530.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004715371.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Echinops telfairi [lesser hedgehog tenrec]
gb|KFO95848.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Calypte anna
ref|NP_001070682.1|  tuftelin-interacting protein 11                  63.5    2e-08   Sus scrofa [pigs]
ref|XP_010188640.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Mesitornis unicolor
ref|NP_001008292.1|  tuftelin-interacting protein 11                  63.5    2e-08   Rattus norvegicus [brown rat]
ref|XP_004893177.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.5    2e-08   
ref|XP_005230545.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   
ref|NP_001025836.1|  tuftelin-interacting protein 11                  63.5    2e-08   Gallus gallus [bantam]
ref|XP_008684908.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.5    2e-08   Ursus maritimus [white bear]
ref|XP_004690914.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Condylura cristata
ref|XP_004387681.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Trichechus manatus latirostris
ref|XP_003478401.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.5    2e-08   Cavia porcellus [guinea pig]
ref|NP_001093435.1|  tuftelin-interacting protein 11                  63.5    2e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_009082323.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Acanthisitta chloris
ref|XP_003506733.1|  PREDICTED: tuftelin-interacting protein 11       63.5    2e-08   Cricetulus griseus [Chinese hamsters]
gb|EKC18985.1|  Tuftelin-interacting protein 11                       63.5    2e-08   Crassostrea gigas
ref|XP_008847245.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   Nannospalax galili
ref|XP_008272828.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    2e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_010580348.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   Haliaeetus leucocephalus
ref|XP_009558777.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   Cuculus canorus
ref|XP_007627359.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   
ref|XP_005078969.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   Mesocricetus auratus [Syrian golden hamster]
ref|XP_009350135.1|  PREDICTED: septin and tuftelin-interacting p...  63.2    2e-08   
ref|XP_011449175.1|  PREDICTED: tuftelin-interacting protein 11-like  63.2    2e-08   Crassostrea gigas
ref|XP_007082567.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    2e-08   Panthera tigris altaica
ref|XP_003994807.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    2e-08   Felis catus [cat]
ref|XP_009957952.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.2    2e-08   Leptosomus discolor
gb|KFQ35436.1|  Tuftelin-interacting protein 11                       63.2    2e-08   Merops nubicus
ref|XP_008944614.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   Merops nubicus
ref|XP_009887465.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   
ref|XP_005498249.1|  PREDICTED: tuftelin-interacting protein 11       63.2    2e-08   
ref|XP_001499556.2|  PREDICTED: tuftelin-interacting protein 11-like  63.2    2e-08   
ref|NP_001039495.2|  tuftelin-interacting protein 11                  63.2    2e-08   
gb|ABC69921.1|  STIP                                                  63.2    2e-08   
dbj|BAE28260.1|  unnamed protein product                              63.2    2e-08   
gb|ELK08915.1|  G patch domain-containing protein 2                   58.9    2e-08   
ref|XP_001499886.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    3e-08   
ref|XP_010223913.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_010396785.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_009908031.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_005489007.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
gb|KFV77367.1|  Tuftelin-interacting protein 11                       63.2    3e-08   
sp|Q29RR5.2|TFP11_BOVIN  RecName: Full=Tuftelin-interacting prote...  63.2    3e-08   
ref|XP_006984175.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|NP_061253.2|  tuftelin-interacting protein 11                     63.2    3e-08   
gb|AAH17682.1|  Tuftelin interacting protein 11                       63.2    3e-08   
ref|XP_006147932.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.2    3e-08   
ref|XP_008492988.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_009090637.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_008632303.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_005421487.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_007946133.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
gb|AAI14059.1|  Tuftelin interacting protein 11                       63.2    3e-08   
ref|XP_005344283.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    3e-08   
ref|XP_002890202.1|  D111/G-patch domain-containing protein           63.2    3e-08   
ref|XP_005524389.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_009350134.1|  PREDICTED: septin and tuftelin-interacting p...  63.2    3e-08   
ref|XP_006055630.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    3e-08   
ref|XP_007181010.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_002197903.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_004592001.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_004283827.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_005055056.1|  PREDICTED: tuftelin-interacting protein 11       63.2    3e-08   
ref|XP_002319771.1|  D111/G-patch domain-containing family protein    63.2    3e-08   
ref|XP_002002759.1|  GI11229                                          62.8    3e-08   
gb|KFO59493.1|  Tuftelin-interacting protein 11                       62.8    3e-08   
ref|XP_005889904.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  62.8    3e-08   
ref|NP_173150.1|  GC-rich sequence DNA-binding factor-like protei...  62.8    3e-08   
ref|XP_007461197.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    3e-08   
ref|XP_007101983.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    3e-08   
ref|XP_008608077.1|  hypothetical protein SDRG_04193                  62.8    3e-08   
gb|KFU89033.1|  Tuftelin-interacting protein 11                       62.8    3e-08   
ref|XP_011044415.1|  PREDICTED: septin and tuftelin-interacting p...  62.8    3e-08   
ref|XP_002051429.1|  GJ12292                                          62.8    3e-08   
ref|XP_006938603.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    4e-08   
ref|XP_006938601.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    4e-08   
ref|XP_002955122.1|  hypothetical protein VOLCADRAFT_65509            62.8    4e-08   
ref|XP_007082564.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    4e-08   
ref|XP_007082566.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    4e-08   
ref|XP_011014808.1|  PREDICTED: septin and tuftelin-interacting p...  62.8    4e-08   
ref|XP_009825943.1|  hypothetical protein H257_03510                  62.8    4e-08   
gb|KDO27238.1|  hypothetical protein SPRG_07487                       62.8    4e-08   
ref|XP_010827007.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  62.4    4e-08   
ref|XP_008378967.1|  PREDICTED: tuftelin-interacting protein 11-like  62.4    4e-08   
ref|NP_594091.1|  RNA-binding splicing factor (predicted)             62.4    4e-08   
ref|XP_007525292.1|  PREDICTED: tuftelin-interacting protein 11       62.4    4e-08   
ref|XP_004330837.1|  PREDICTED: tuftelin-interacting protein 11-like  62.4    5e-08   
ref|XP_011399724.1|  hypothetical protein F751_0708                   62.4    5e-08   
ref|XP_010476842.1|  PREDICTED: septin and tuftelin-interacting p...  62.4    5e-08   
gb|ELR60645.1|  Tuftelin-interacting protein 11                       62.4    5e-08   
ref|XP_010270966.1|  PREDICTED: septin and tuftelin-interacting p...  62.4    5e-08   
ref|XP_005691760.1|  PREDICTED: tuftelin-interacting protein 11       62.0    5e-08   
ref|XP_008218613.1|  PREDICTED: tuftelin-interacting protein 11-like  62.0    5e-08   
ref|XP_009995165.1|  PREDICTED: tuftelin-interacting protein 11       62.0    5e-08   
ref|XP_009355402.1|  PREDICTED: septin and tuftelin-interacting p...  62.0    6e-08   
ref|XP_004671000.1|  PREDICTED: tuftelin-interacting protein 11       62.0    6e-08   
ref|XP_010597714.1|  PREDICTED: G patch domain-containing protein...  61.6    6e-08   
ref|XP_005874655.1|  PREDICTED: tuftelin-interacting protein 11-like  62.0    6e-08   
ref|XP_006890634.1|  PREDICTED: G patch domain-containing protein...  61.6    6e-08   
ref|XP_006848800.1|  hypothetical protein AMTR_s00026p00123370        61.6    7e-08   
emb|CDS30657.1|  tuftelin interacting protein 11                      61.6    7e-08   
ref|XP_004510195.1|  PREDICTED: tuftelin-interacting protein 11-like  61.6    7e-08   
ref|XP_003577528.1|  PREDICTED: septin and tuftelin-interacting p...  61.6    8e-08   
ref|XP_008516973.1|  PREDICTED: tuftelin-interacting protein 11 i...  61.6    8e-08   
gb|EPB85923.1|  hypothetical protein HMPREF1544_07255                 61.6    8e-08   
dbj|GAN05273.1|  TFP11-domain-containing protein                      61.6    8e-08   
ref|XP_006416746.1|  hypothetical protein EUTSA_v10006789mg           61.6    8e-08   
emb|CBK20550.2|  unnamed protein product                              57.4    8e-08   
ref|XP_004017498.1|  PREDICTED: tuftelin-interacting protein 11       61.2    9e-08   
ref|XP_001962686.1|  GF14307                                          61.2    1e-07   
ref|XP_004751526.1|  PREDICTED: G patch domain-containing protein 2   60.8    1e-07   
ref|XP_003380487.1|  tuftelin-interacting protein 11                  61.2    1e-07   
ref|XP_007225316.1|  hypothetical protein PRUPE_ppa001171mg           61.2    1e-07   
ref|XP_007211094.1|  hypothetical protein PRUPE_ppa001175mg           61.2    1e-07   
gb|EHH50537.1|  hypothetical protein EGM_01387                        60.8    1e-07   
ref|XP_009877288.1|  PREDICTED: tuftelin-interacting protein 11       60.8    1e-07   
gb|EHH15544.1|  hypothetical protein EGK_01651                        60.8    1e-07   
ref|XP_002065393.1|  GK15423                                          60.8    1e-07   
gb|ETE71201.1|  Tuftelin-interacting protein 11                       60.8    1e-07   
ref|XP_005879952.1|  PREDICTED: G patch domain-containing protein...  60.8    1e-07   
gb|EPQ16193.1|  G patch domain-containing protein 2                   60.8    1e-07   
ref|XP_005540923.1|  PREDICTED: G patch domain-containing protein...  60.5    1e-07   
gb|ELK32169.1|  G patch domain-containing protein 2                   60.5    1e-07   
ref|XP_005885804.1|  PREDICTED: tuftelin-interacting protein 11-like  60.8    1e-07   
ref|XP_007986612.1|  PREDICTED: G patch domain-containing protein...  60.8    1e-07   
ref|XP_007908724.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.8    1e-07   
ref|XP_007908723.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.8    1e-07   
gb|EXX77934.1|  Spp382p                                               60.8    1e-07   
ref|XP_005540922.1|  PREDICTED: G patch domain-containing protein...  60.5    1e-07   
ref|XP_007986613.1|  PREDICTED: G patch domain-containing protein...  60.5    1e-07   
ref|XP_005540921.1|  PREDICTED: G patch domain-containing protein...  60.5    1e-07   
emb|CDI97359.1|  tuftelin interacting protein 11                      60.8    1e-07   
ref|XP_010361517.1|  PREDICTED: G patch domain-containing protein...  60.5    1e-07   
ref|XP_003893154.1|  PREDICTED: G patch domain-containing protein...  60.5    1e-07   
ref|XP_006761403.1|  PREDICTED: G patch domain-containing protein 2   60.5    1e-07   
ref|XP_007514715.1|  predicted protein                                60.8    1e-07   
ref|XP_004415667.1|  PREDICTED: G patch domain-containing protein 2   60.5    2e-07   
gb|EUB61106.1|  Tuftelin-interacting protein                          60.8    2e-07   
ref|XP_005104240.1|  PREDICTED: tuftelin-interacting protein 11-like  60.8    2e-07   
ref|XP_008192741.1|  PREDICTED: sip1/TFIP11 interacting protein i...  60.8    2e-07   
ref|NP_001073624.1|  Sip1/TFIP11 interacting protein                  60.8    2e-07   
ref|XP_008548434.1|  PREDICTED: tuftelin-interacting protein 11       60.5    2e-07   
ref|XP_005540924.1|  PREDICTED: G patch domain-containing protein...  60.5    2e-07   
ref|XP_011232417.1|  PREDICTED: G patch domain-containing protein...  60.5    2e-07   
ref|XP_002926699.1|  PREDICTED: G patch domain-containing protein...  60.5    2e-07   
ref|XP_008683891.1|  PREDICTED: G patch domain-containing protein...  60.5    2e-07   
ref|XP_008148048.1|  PREDICTED: G patch domain-containing protein 2   60.5    2e-07   
ref|XP_008683889.1|  PREDICTED: G patch domain-containing protein...  60.5    2e-07   
emb|CDS21638.1|  tuftelin interacting protein 11                      60.5    2e-07   
ref|XP_004685296.1|  PREDICTED: G patch domain-containing protein 2   60.1    2e-07   
gb|KDR14564.1|  Tuftelin-interacting protein 11                       60.5    2e-07   
ref|XP_006203714.1|  PREDICTED: G patch domain-containing protein 2   60.1    2e-07   
gb|ELW55478.1|  G patch domain-containing protein 2                   56.6    2e-07   
ref|XP_006188221.1|  PREDICTED: G patch domain-containing protein 2   60.1    2e-07   
ref|XP_010972318.1|  PREDICTED: G patch domain-containing protein...  60.1    2e-07   
gb|EXX77932.1|  Spp382p                                               60.5    2e-07   
ref|XP_008965018.1|  PREDICTED: G patch domain-containing protein...  60.1    2e-07   
ref|XP_001600459.1|  PREDICTED: tuftelin-interacting protein 11       60.5    2e-07   
gb|KHN32772.1|  Tuftelin-interacting protein 11                       60.5    2e-07   
ref|XP_003548069.1|  PREDICTED: tuftelin-interacting protein 11-l...  60.5    2e-07   
ref|XP_001172096.1|  PREDICTED: G patch domain-containing protein...  60.1    2e-07   
ref|XP_005959627.1|  PREDICTED: tuftelin-interacting protein 11-l...  59.3    2e-07   
gb|EXX77931.1|  Spp382p                                               60.5    2e-07   
gb|KEH18055.1|  tuftelin-interacting protein                          60.1    2e-07   
ref|XP_008220637.1|  PREDICTED: zinc finger CCCH domain-containin...  60.1    2e-07   
emb|CEP17389.1|  hypothetical protein                                 60.5    2e-07   
ref|XP_009439775.1|  PREDICTED: G patch domain-containing protein...  60.1    2e-07   
ref|NP_060510.1|  G patch domain-containing protein 2 isoform 1       60.1    2e-07   
ref|XP_003265143.1|  PREDICTED: G patch domain-containing protein 2   60.1    2e-07   
ref|XP_001419174.1|  predicted protein                                58.9    2e-07   
ref|XP_011237225.1|  PREDICTED: G patch domain-containing protein...  59.3    2e-07   
ref|XP_007227462.1|  hypothetical protein PRUPE_ppa004892mg           59.7    2e-07   
dbj|BAC38928.1|  unnamed protein product                              59.3    2e-07   
gb|ESA16281.1|  hypothetical protein GLOINDRAFT_22971                 60.1    3e-07   
ref|XP_011188833.1|  PREDICTED: septin-interacting protein 1          60.1    3e-07   
ref|XP_011197264.1|  PREDICTED: septin-interacting protein 1          60.1    3e-07   
ref|XP_002021678.1|  Sip1-TFIP11 interacting protein                  60.1    3e-07   
ref|XP_001356074.2|  STIP                                             60.1    3e-07   
ref|XP_003930395.1|  PREDICTED: G patch domain-containing protein...  59.7    3e-07   
gb|EMS50756.1|  Tuftelin-interacting protein 11                       59.7    3e-07   
dbj|BAK01621.1|  predicted protein                                    59.7    3e-07   
dbj|BAC26744.1|  unnamed protein product                              59.7    3e-07   
ref|XP_010692950.1|  PREDICTED: zinc finger CCCH domain-containin...  59.7    3e-07   
ref|XP_006497258.1|  PREDICTED: G patch domain-containing protein...  59.7    3e-07   
ref|XP_004291980.1|  PREDICTED: zinc finger CCCH domain-containin...  59.3    3e-07   
gb|EMT28946.1|  Tuftelin-interacting protein 11                       59.7    3e-07   
ref|XP_006916287.1|  PREDICTED: G patch domain-containing protein...  59.7    3e-07   
ref|XP_006943032.1|  PREDICTED: G patch domain-containing protein...  59.7    3e-07   
emb|CCI48000.1|  unnamed protein product                              59.7    3e-07   
ref|XP_003623392.1|  Tuftelin-interacting-like protein                59.7    3e-07   
ref|XP_008863635.1|  hypothetical protein H310_02034                  59.7    3e-07   
gb|ELW66488.1|  Tuftelin-interacting protein 11                       59.3    3e-07   
ref|NP_080643.4|  G patch domain-containing protein 2                 59.3    3e-07   
gb|EDL13047.1|  G patch domain containing 2, isoform CRA_c            59.3    3e-07   
gb|AAH54810.1|  G patch domain containing 2                           59.3    4e-07   
emb|CDM81682.1|  unnamed protein product                              59.7    4e-07   
ref|XP_006007268.1|  PREDICTED: tuftelin-interacting protein 11       59.7    4e-07   
ref|XP_006497260.1|  PREDICTED: G patch domain-containing protein...  59.3    4e-07   
ref|XP_004533235.1|  PREDICTED: septin-interacting protein 1-like...  59.7    4e-07   
ref|XP_006094376.1|  PREDICTED: G patch domain-containing protein 2   56.6    4e-07   
ref|NP_001091840.1|  septin and tuftelin interacting protein          59.3    4e-07   
dbj|BAC35520.1|  unnamed protein product                              59.3    4e-07   
gb|KHN00685.1|  Tuftelin-interacting protein 11                       59.3    4e-07   
ref|XP_001757427.1|  predicted protein                                59.3    4e-07   
ref|XP_004613109.1|  PREDICTED: G patch domain-containing protein 2   59.3    4e-07   
gb|EHJ75286.1|  septin and tuftelin interacting protein               59.3    4e-07   
ref|XP_007471923.1|  PREDICTED: G patch domain-containing protein 2   59.3    4e-07   
ref|XP_009063581.1|  hypothetical protein LOTGIDRAFT_221309           59.3    4e-07   
ref|XP_008334938.1|  PREDICTED: tuftelin-interacting protein 11 i...  59.3    4e-07   
ref|XP_007442990.1|  PREDICTED: zinc finger CCCH-type with G patc...  57.8    4e-07   
ref|XP_001659237.1|  AAEL008437-PA                                    59.3    5e-07   
ref|XP_008334939.1|  PREDICTED: tuftelin-interacting protein 11 i...  59.3    5e-07   
ref|XP_009359084.1|  PREDICTED: zinc finger CCCH domain-containin...  58.9    5e-07   
ref|XP_001421215.1|  predicted protein                                59.3    5e-07   
ref|XP_009359150.1|  PREDICTED: zinc finger CCCH domain-containin...  58.9    5e-07   
gb|ACR37118.1|  unknown                                               54.3    5e-07   
gb|KDO59352.1|  hypothetical protein CISIN_1g043289mg                 58.9    5e-07   
ref|XP_005374769.1|  PREDICTED: G patch domain-containing protein...  58.9    5e-07   
emb|CAG08558.1|  unnamed protein product                              58.9    6e-07   
gb|ABC69939.1|  STIP                                                  58.9    6e-07   
ref|XP_001952828.1|  PREDICTED: zinc finger CCCH-type with G patc...  58.5    6e-07   
ref|XP_005374768.1|  PREDICTED: G patch domain-containing protein...  58.5    6e-07   
gb|KFH45698.1|  G-patch domain-containing protein -like protein       58.9    6e-07   
gb|ERL85681.1|  hypothetical protein D910_03097                       58.9    7e-07   
gb|EAZ21226.1|  hypothetical protein OsJ_36879                        58.9    7e-07   
ref|XP_011051117.1|  PREDICTED: tuftelin-interacting protein 11       58.9    7e-07   
gb|ABC69927.1|  STIP                                                  58.9    7e-07   
ref|NP_001067277.1|  Os12g0615800                                     58.5    7e-07   
ref|XP_008377483.1|  PREDICTED: zinc finger CCCH domain-containin...  58.5    7e-07   
dbj|BAE37777.1|  unnamed protein product                              56.6    7e-07   
ref|XP_003705694.1|  PREDICTED: tuftelin-interacting protein 11-like  58.5    7e-07   
ref|XP_002491597.1|  hypothetical protein                             58.5    7e-07   
emb|CEP61645.1|  LALA0S03e07558g1_1                                   58.5    7e-07   
ref|XP_007126186.1|  PREDICTED: G patch domain-containing protein...  58.5    8e-07   
ref|XP_007126185.1|  PREDICTED: G patch domain-containing protein...  58.5    8e-07   
ref|XP_011364424.1|  PREDICTED: G patch domain-containing protein...  58.2    8e-07   
ref|XP_007173585.1|  PREDICTED: G patch domain-containing protein 2   58.2    8e-07   
ref|XP_007950687.1|  PREDICTED: G patch domain-containing protein 2   58.2    8e-07   
gb|ERE73020.1|  G patch domain-containing protein 2                   58.2    8e-07   
ref|NP_001091095.1|  tuftelin interacting protein 11                  58.5    8e-07   
ref|XP_007250033.1|  PREDICTED: tuftelin-interacting protein 11-like  58.5    8e-07   
ref|XP_011364422.1|  PREDICTED: G patch domain-containing protein...  58.2    8e-07   
ref|XP_011364423.1|  PREDICTED: G patch domain-containing protein...  58.2    8e-07   
gb|EAY83899.1|  hypothetical protein OsI_39121                        58.5    8e-07   
ref|XP_007641342.1|  PREDICTED: G patch domain-containing protein...  58.2    8e-07   
gb|EGV92551.1|  G patch domain-containing protein 2                   58.2    9e-07   
ref|XP_005804061.1|  PREDICTED: tuftelin-interacting protein 11-like  58.5    9e-07   
ref|XP_011140063.1|  PREDICTED: tuftelin-interacting protein 11       58.5    9e-07   
ref|XP_008117816.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  58.2    9e-07   
emb|CBN76810.1|  conserved unknown protein                            57.8    9e-07   



>ref|XP_009595430.1| PREDICTED: uncharacterized protein LOC104091732 [Nicotiana tomentosiformis]
Length=786

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGL  428
            HE K V++S  YGAFE+HTTGFGSKMM KMG+  G GLGKDGQGI+EPI+  QRPKALGL
Sbjct  631  HETKVVTNSIEYGAFEMHTTGFGSKMMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGL  690

Query  427  GADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
            GA++PETS+ +  K   PKS     ++ +RS KS +K S          GF  FE HTKG
Sbjct  691  GAEIPETSSGSAKKDFLPKSAVRSAEVVSRSGKSSRKESSI--------GFAGFEMHTKG  742

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGSKMMAKMGFVEGTGLGK+SQGI  P++A RRPKSQGLGAK
Sbjct  743  FGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAK  784


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV  416
            SS  +  FE+HT GFGSKMM KMGF  G GLGK+ QGI  P+   +RPK+ GLGA V
Sbjct  729  SSIGFAGFEMHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAKV  785



>ref|XP_009769069.1| PREDICTED: uncharacterized protein LOC104219993 [Nicotiana sylvestris]
Length=787

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGL  428
            HE K V++S  YGAFE+HTTGFGSKMM KMG+  G GLGKDGQGI+EPI+  QRPKALGL
Sbjct  632  HEMKVVTNSIEYGAFEMHTTGFGSKMMAKMGYEEGRGLGKDGQGISEPIEARQRPKALGL  691

Query  427  GADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
            GA++PETS+ +  K   PKS     ++  RS KS +K S          GF  FE HTKG
Sbjct  692  GAEIPETSSGSAKKDFLPKSAVRSAEVVGRSAKSSRKESSI--------GFAGFEMHTKG  743

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGSKMMAKMGFVEGTGLGK+SQGI  P++A RRPKSQGLGAK
Sbjct  744  FGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAK  785


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  416
            SS  +  FE+HT GFGSKMM KMGF  G GLGK+ QGI  P+   +RPK+ GLGA V
Sbjct  730  SSIGFAGFEMHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAKV  786



>ref|XP_011084036.1| PREDICTED: uncharacterized protein LOC105166393 [Sesamum indicum]
Length=762

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 115/162 (71%), Gaps = 10/162 (6%)
 Frame = -3

Query  607  CHEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALG  431
            CHE K VS S  Y AFE+HTTGFGSKMM KMG+  G GLGKDGQG+A+PI+VSQRPK+LG
Sbjct  608  CHESKLVSHSIEYKAFEIHTTGFGSKMMAKMGYIEGTGLGKDGQGMAQPIEVSQRPKSLG  667

Query  430  LGADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTK  251
            LGA+VPE S  +      P S G         R +   G+  + A+  +  FGSFE HTK
Sbjct  668  LGAEVPEASGKSSITQSRPNSTG---------RSAKSSGTNVKSAKSDNHKFGSFEKHTK  718

Query  250  GFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GFGSKMMAKMGFVEG GLGKDSQGI  P+LA RRPKS GLGA
Sbjct  719  GFGSKMMAKMGFVEGMGLGKDSQGIVNPLLAVRRPKSMGLGA  760


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            + +FE HT GFGSKMMAKMG++EGTGLGKD QG+  PI  ++RPKS GLGA+
Sbjct  620  YKAFEIHTTGFGSKMMAKMGYIEGTGLGKDGQGMAQPIEVSQRPKSLGLGAE  671



>emb|CDP10517.1| unnamed protein product [Coffea canephora]
Length=770

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 115/163 (71%), Gaps = 12/163 (7%)
 Frame = -3

Query  607  CHEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALG  431
            C EKK  SSS  YGAFELHT GFGSKMM +MG+  G GLGKDGQG+AEPI+V QRPK+LG
Sbjct  616  CEEKKHASSSIKYGAFELHTRGFGSKMMARMGYVEGCGLGKDGQGMAEPIEVLQRPKSLG  675

Query  430  LGADVPETSTANETKTPTPKSVGFGEDLP-TRsrksgkkgsqgqkaqygSPGFGSFENHT  254
            LGA++ ETS     K   P   G   +LP TR++   K+ +Q          F SFE HT
Sbjct  676  LGAEIAETSDKLAKKECRPTVSGLSSELPGTRNKLGKKESAQ----------FASFERHT  725

Query  253  KGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            KGFGSK+MAKMGFVEG GLGKDSQG+  P++  RRPKS+GLGA
Sbjct  726  KGFGSKVMAKMGFVEGMGLGKDSQGMIRPLVVARRPKSRGLGA  768


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            +G+FE HT+GFGSKMMA+MG+VEG GLGKD QG+  PI   +RPKS GLGA+
Sbjct  628  YGAFELHTRGFGSKMMARMGYVEGCGLGKDGQGMAEPIEVLQRPKSLGLGAE  679



>ref|XP_010323258.1| PREDICTED: uncharacterized protein LOC101249097 [Solanum lycopersicum]
Length=789

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 116/164 (71%), Gaps = 10/164 (6%)
 Frame = -3

Query  607  CHEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALG  431
             HE K V++S  YGAFE+HTTG GSK+M KMG+  G GLGKDGQGI+EPI+  QRPKALG
Sbjct  633  VHETKVVTNSVEYGAFEMHTTGIGSKLMAKMGYQEGRGLGKDGQGISEPIEARQRPKALG  692

Query  430  LGADVPETSTANE-TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHT  254
            LGA++PETS  +   K   PKS G G ++          GS     +  S GF  FE HT
Sbjct  693  LGAEIPETSIRSSGKKDSLPKSSGRGAEV--------VGGSGKSIRKESSVGFAGFERHT  744

Query  253  KGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KGFGSK+MAKMGFVEG GLG+ SQGIT P++A RRPKSQGLGAK
Sbjct  745  KGFGSKIMAKMGFVEGMGLGRSSQGITNPLVAVRRPKSQGLGAK  788



>ref|XP_006359539.1| PREDICTED: uncharacterized protein LOC102594159 [Solanum tuberosum]
Length=790

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 114/160 (71%), Gaps = 10/160 (6%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V++S  YGAFE+HTTG GSK+M KMG+  G GLGKDGQGI+EPI+  QRPKALGLGA+
Sbjct  638  KVVTNSVEYGAFEMHTTGIGSKLMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAE  697

Query  418  VPETSTANETKTPT-PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            + ETS+ +  K  + PKS   G ++          GS     +  S GF  FE HTKGFG
Sbjct  698  ILETSSRSSAKKDSLPKSSVRGAEV--------VGGSGKSIRKESSVGFAGFERHTKGFG  749

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            SKMMAKMGFVEG GLG+ SQGIT P++A RRPKSQGLGAK
Sbjct  750  SKMMAKMGFVEGMGLGRSSQGITNPLVAVRRPKSQGLGAK  789



>ref|XP_003549703.1| PREDICTED: uncharacterized protein LOC100781443 [Glycine max]
 gb|KHN18591.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=767

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 110/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            +K V+SS N G+FE HTTGFGSKMM KMG+T G GLGK+GQG+A+PI+V QRPK+LGLG 
Sbjct  613  RKGVTSSANIGSFEEHTTGFGSKMMAKMGYTEGAGLGKNGQGMAQPIEVIQRPKSLGLGV  672

Query  421  DVPETSTA---NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTK  251
            +    S     N++     KS+G G +      +  +  S            GSFE HTK
Sbjct  673  EFYNNSAEPARNKSSRVGAKSLGLGVEFSNSPAEPARNKSSK---------VGSFEKHTK  723

Query  250  GFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GFGSKMMAKMGFVEG GLG++SQGIT P+ A R PKS+GLGAK
Sbjct  724  GFGSKMMAKMGFVEGNGLGRESQGITTPLSAVRLPKSRGLGAK  766



>ref|XP_003542623.1| PREDICTED: uncharacterized protein LOC100802615 [Glycine max]
 gb|KHN22105.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=762

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 110/160 (69%), Gaps = 13/160 (8%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            V+SS N G+FE HTTGFGSKMM KMG+T G GLGK+GQG+A+PI+V QRPK+LGLG +  
Sbjct  611  VTSSANIGSFEEHTTGFGSKMMAKMGYTEGAGLGKNGQGMAQPIEVIQRPKSLGLGVEFS  670

Query  412  ETSTA---NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
              S     N++     KS+G G +            S  + A   S   G+FE HTKGFG
Sbjct  671  NNSAEPARNKSSRVGAKSLGVGVEFSN---------SPAKPAPNKSSNVGAFEKHTKGFG  721

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            SKMMAKMGFVEGTGLG++SQGIT P+ A R PKS+GLGAK
Sbjct  722  SKMMAKMGFVEGTGLGRESQGITTPLSAVRLPKSRGLGAK  761



>gb|EEC83275.1| hypothetical protein OsI_28629 [Oryza sativa Indica Group]
Length=519

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 102/161 (63%), Gaps = 15/161 (9%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            EK   S S   G FE+HT GFGSKMM KMGF  G GLGKDGQG+ +PIQ  QRPK+LGLG
Sbjct  370  EKIVESDSVKLGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLG  429

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             +    + A + ++  P         P R+ +  + G           G GSFE HTKGF
Sbjct  430  VEFDSEAEAIKARSEPPTK---ARSEPWRNLRKVEIG-----------GVGSFERHTKGF  475

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSKMMA+MGFVEG+GLGKD QGI  P+ A RRPKS GLGAK
Sbjct  476  GSKMMARMGFVEGSGLGKDGQGIVNPLTAVRRPKSMGLGAK  516



>gb|EEE68404.1| hypothetical protein OsJ_26758 [Oryza sativa Japonica Group]
Length=640

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 102/161 (63%), Gaps = 15/161 (9%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  425
            EK   S S   G FE+HT GFGSKMM KMGF  G GLGKDGQG+ +PIQ  QRPK+LGLG
Sbjct  491  EKIVESDSVKLGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLG  550

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             +    + A + ++  P         P R+ +  + G           G GSFE HTKGF
Sbjct  551  VEFDSEAEAIKARSEPPTK---ARSEPWRNLRKVEIG-----------GVGSFERHTKGF  596

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSKMMA+MGFVEG+GLGKD QGI  P+ A RRPKS GLGAK
Sbjct  597  GSKMMARMGFVEGSGLGKDGQGIVNPLTAVRRPKSMGLGAK  637



>dbj|BAJ84968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 97/159 (61%), Gaps = 8/159 (5%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            +K V S    G FE HT GFGSKMM KMGF  G GLGKDGQGI +P+Q  QRPK+LGLG 
Sbjct  73   EKVVGSDSKLGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGV  132

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            +      A ++++  P +       P R     +   +           G+FE HTKGFG
Sbjct  133  EFDSELEAAKSRSEPPAN-------PRRELGRSRSEPRRNTRPPEMYDCGTFERHTKGFG  185

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            SKMM KMGFV G+GLGKD QGI  P+ A RRPKS+GLGA
Sbjct  186  SKMMVKMGFVPGSGLGKDGQGIVNPLTAVRRPKSRGLGA  224


 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  P+ A +RPKS GLG +
Sbjct  82   LGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVE  133



>ref|XP_006660014.1| PREDICTED: uncharacterized protein LOC102712285, partial [Oryza 
brachyantha]
Length=678

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 103/162 (64%), Gaps = 17/162 (10%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            EK   S+S   G FE+HT GFGSKMM KMGF  G GLGKDGQG+ +PI+  QRPK+LGLG
Sbjct  529  EKIVESNSVKLGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIETVQRPKSLGLG  588

Query  424  ADVPETSTANETKT-PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
                  + A + ++ PT K+       P R  +  +             G GSFE HTKG
Sbjct  589  VVFDSEAEAIKARSEPTAKA----RSEPKRFSRKVEMS-----------GVGSFERHTKG  633

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGSKMMA+MGFVEG+GLGKD QGI  P+ A RRPKS GLGAK
Sbjct  634  FGSKMMARMGFVEGSGLGKDGQGIVTPLTAVRRPKSMGLGAK  675



>ref|XP_010542083.1| PREDICTED: uncharacterized protein LOC104815398 [Tarenaya hassleriana]
Length=798

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 7/161 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD--  419
             SS+ N+GAFE+HT GFGSKMM KMG+  G GLGKDG+G+A+PI+V QRPK+LGLG D  
Sbjct  628  ASSAANFGAFEVHTKGFGSKMMAKMGYIEGAGLGKDGKGLAQPIEVVQRPKSLGLGLDFS  687

Query  418  --VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
              V E   ++ + +   K    G+D   +  K     S+      G  GFG+FE HTKGF
Sbjct  688  PSVEENQPSSSSGSGRRKGNSSGKD--PKHEKGVSGSSRSGGGGGGGKGFGAFEQHTKGF  745

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GS+MMAKMGFVEGTGLG+DSQG+T P+ A RRPK++GLGA+
Sbjct  746  GSRMMAKMGFVEGTGLGRDSQGMTNPLFAVRRPKARGLGAE  786



>ref|NP_001061456.1| Os08g0288500 [Oryza sativa Japonica Group]
 dbj|BAD01347.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD01361.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23370.1| Os08g0288500 [Oryza sativa Japonica Group]
Length=742

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 102/161 (63%), Gaps = 15/161 (9%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            EK   S S   G FE+HT GFGSKMM KMGF  G GLGKDGQG+ +PIQ  QRPK+LGLG
Sbjct  593  EKIVESDSVKLGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLG  652

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             +    + A + ++  P         P R+ +  + G           G GSFE HTKGF
Sbjct  653  VEFDSEAEAIKARSEPPTK---ARSEPWRNLRKVEIG-----------GVGSFERHTKGF  698

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSKMMA+MGFVEG+GLGKD QGI  P+ A RRPKS GLGAK
Sbjct  699  GSKMMARMGFVEGSGLGKDGQGIVNPLTAVRRPKSMGLGAK  739



>ref|XP_004973180.1| PREDICTED: uncharacterized protein LOC101758421 [Setaria italica]
Length=756

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 105/160 (66%), Gaps = 9/160 (6%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            K   S++   G+FE+HT GFGSKMM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG 
Sbjct  602  KAAESNTTELGSFEVHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGV  661

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            +    + A + +T   K+       P++ R   ++  +  +      G GSFE HTKGFG
Sbjct  662  EFNSEAEAIKARTEPMKA----RSEPSKVRPELRRNVRALETS----GVGSFERHTKGFG  713

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            SKMMAKMGFV G+GLG+D QGI  P+ A RRPKSQGLGAK
Sbjct  714  SKMMAKMGFVPGSGLGRDGQGIPTPLTAVRRPKSQGLGAK  753



>gb|EYU25294.1| hypothetical protein MIMGU_mgv1a003157mg [Erythranthe guttata]
Length=604

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 117/162 (72%), Gaps = 15/162 (9%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            +K  ++S  YGAFE+HTTGFGSKM+ KMG+  GGGLGKDGQG+A+PI+V QRPK+LGLGA
Sbjct  448  EKQTAASLEYGAFEMHTTGFGSKMLAKMGYVEGGGLGKDGQGVAKPIEVFQRPKSLGLGA  507

Query  421  DVPETSTANETKTPT---PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTK  251
              PE S++ +  T     PKSV           +S   G++ + A+  +  FGSFE HTK
Sbjct  508  VAPEASSSKQPTTNVKAQPKSV-----------RSKSCGTKAKPAKIENNNFGSFEKHTK  556

Query  250  GFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GFGSKMMAKMGFVEG GLGKD+QGI  P++A RRPKS GLGA
Sbjct  557  GFGSKMMAKMGFVEGAGLGKDAQGIINPLVAVRRPKSVGLGA  598


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            + N+G+FE HT GFGSKMM KMGF  G GLGKD QGI  P+   +RPK++GLGA+
Sbjct  545  NNNFGSFEKHTKGFGSKMMAKMGFVEGAGLGKDAQGIINPLVAVRRPKSVGLGAN  599



>ref|XP_009358504.1| PREDICTED: uncharacterized protein LOC103949129 [Pyrus x bretschneideri]
 ref|XP_009358505.1| PREDICTED: uncharacterized protein LOC103949129 [Pyrus x bretschneideri]
Length=640

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 96/152 (63%), Gaps = 12/152 (8%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST  401
            S  Y +FELHT GFGSKM+ KMG+  GGLGKDGQG+A PI+V QRPK+LGLG +    + 
Sbjct  499  STEYRSFELHTKGFGSKMLAKMGYIEGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSTPAE  558

Query  400  ANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKM  221
                KTP         ++P + R   +      +        G FE HTKGFGSKMMAKM
Sbjct  559  IPVGKTPP------ANNIPVKRRSQAQSSQTQSER------VGYFEKHTKGFGSKMMAKM  606

Query  220  GFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GFV G GLGKDSQGI  P+ A R PKS+GLGA
Sbjct  607  GFVGGMGLGKDSQGIVNPLAAVRLPKSRGLGA  638


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  502  YRSFELHTKGFGSKMLAKMGYIEG-GLGKDGQGMAAPIEVIQRPKSLGLGVE  552



>ref|XP_006381899.1| hypothetical protein POPTR_0006s20370g, partial [Populus trichocarpa]
 gb|ERP59696.1| hypothetical protein POPTR_0006s20370g, partial [Populus trichocarpa]
Length=275

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 103/161 (64%), Gaps = 15/161 (9%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E K  +SS  YGAFE+HT GFGSKMM KMGF  GGGLGKDGQG+A+PI+V QRPK+LGLG
Sbjct  128  ENKDATSSSKYGAFEVHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEVIQRPKSLGLG  187

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             D    S  +    P     G                +        +P FG+FE HTKGF
Sbjct  188  VDFSNISGDSVKNKPQSLETG--------------TATGKSGKHSKTPSFGAFEKHTKGF  233

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSKMM +MGFVEG GLGKDSQGI  P++A RR K++GLGAK
Sbjct  234  GSKMMTRMGFVEGKGLGKDSQGIVNPLVAVRRRKARGLGAK  274



>ref|XP_011017950.1| PREDICTED: uncharacterized protein LOC105121122 [Populus euphratica]
Length=737

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 103/160 (64%), Gaps = 19/160 (12%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            K   SSS  +GAFE+HT GFGSKMM KMGF  GGGLGKDGQG+A+PI+V+QRPK+LGLG 
Sbjct  595  KDATSSSSKFGAFEVHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEVTQRPKSLGLGV  654

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            D  + S  +    P     G                         +   G+FE HTKGFG
Sbjct  655  DFSDISVDSVKNKPQSSRTG------------------TSIKHSKTENLGAFEMHTKGFG  696

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            SKMMAKMGFVEG GLGKDSQGI  PI+A RRPK++GLGAK
Sbjct  697  SKMMAKMGFVEGMGLGKDSQGIVNPIVAVRRPKARGLGAK  736



>ref|XP_007013705.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013706.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013707.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31324.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31325.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31326.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
Length=650

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 102/167 (61%), Gaps = 24/167 (14%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG  425
            E K + SS  +GAFE+HT GFGSKMM KMGF  GG        +A PI+V QRPK+LGLG
Sbjct  500  EHKGIVSSAQFGAFEVHTKGFGSKMMAKMGFVDGGGLGKDGQGMARPIEVIQRPKSLGLG  559

Query  424  ADVPETSTANE------TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFE  263
             D P  S+ ++      +     ++ GFG                   A+    GFG+FE
Sbjct  560  VDFPSASSDSDMVQNISSGASERRTKGFGN-----------------SARGQHKGFGAFE  602

Query  262  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             HTKGFGSKMMAKMGFVEG GLGKDSQG+  P++A R PKS+GLGAK
Sbjct  603  KHTKGFGSKMMAKMGFVEGMGLGKDSQGMVNPLVAARLPKSRGLGAK  649



>ref|XP_009338424.1| PREDICTED: uncharacterized protein LOC103930775 [Pyrus x bretschneideri]
Length=762

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 99/157 (63%), Gaps = 13/157 (8%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADV  416
            K  + S  Y +FELHT GFGSKM+ KMG+  GGLGKDGQG+A PI+V QRPK+LGLG + 
Sbjct  617  KVAAESTEYRSFELHTKGFGSKMLAKMGYVEGGLGKDGQGMAAPIEVIQRPKSLGLGVEF  676

Query  415  PETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSK  236
                        TP  +  G+  P  +    +  +Q  + Q    G+  FE HTKGFG K
Sbjct  677  -----------STPVEIPVGKTPPANNIPVKRSQAQSSQTQSERVGY--FEKHTKGFGLK  723

Query  235  MMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            MMAKMGFV G GLGKDSQGI  P+ + R PKS+GLGA
Sbjct  724  MMAKMGFVGGMGLGKDSQGIVNPLASVRLPKSRGLGA  760


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 71/138 (51%), Gaps = 21/138 (15%)
 Frame = -3

Query  475  IAEPIQVSQRPKALGLGAD--VPETSTANETKTP-TPKSVGFGE-----DLPT-------  341
            + EP +   RP+ +G G D   PE+  ++E KTP T    G G      + P        
Sbjct  539  VVEPGRDKNRPRKIGKGIDFKTPESKQSSERKTPKTSAKRGSGNMDSYANTPVSFVSSGV  598

Query  340  -----RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGI  176
                  S       +   K    S  + SFE HTKGFGSKM+AKMG+VEG GLGKD QG+
Sbjct  599  MQSAAESLTVDSIEASKNKVAAESTEYRSFELHTKGFGSKMLAKMGYVEG-GLGKDGQGM  657

Query  175  TAPILATRRPKSQGLGAK  122
             API   +RPKS GLG +
Sbjct  658  AAPIEVIQRPKSLGLGVE  675



>ref|XP_002325162.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
 gb|EEF03727.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
Length=737

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 106/161 (66%), Gaps = 19/161 (12%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            EKK  +SS  +GAFE+HT GFGSKMM KMGF  GGGLGKDGQG+A+P++V+QRPK+LGLG
Sbjct  594  EKKDATSSSKFGAFEVHTKGFGSKMMAKMGFIEGGGLGKDGQGMAQPVEVTQRPKSLGLG  653

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             D  + S  +    P     G                      Q  +   G+FE HTKGF
Sbjct  654  VDFSDISVDSVKNKPQSSRTG------------------TSGKQSKTENLGAFEKHTKGF  695

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSK+MAKMGFVEG GLGKDSQGI  PI+A +RPK++GLGAK
Sbjct  696  GSKIMAKMGFVEGMGLGKDSQGIVNPIVAVKRPKARGLGAK  736



>ref|XP_007013704.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31323.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=765

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 102/167 (61%), Gaps = 24/167 (14%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG  425
            E K + SS  +GAFE+HT GFGSKMM KMGF  GG        +A PI+V QRPK+LGLG
Sbjct  615  EHKGIVSSAQFGAFEVHTKGFGSKMMAKMGFVDGGGLGKDGQGMARPIEVIQRPKSLGLG  674

Query  424  ADVPETSTANE------TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFE  263
             D P  S+ ++      +     ++ GFG                   A+    GFG+FE
Sbjct  675  VDFPSASSDSDMVQNISSGASERRTKGFGN-----------------SARGQHKGFGAFE  717

Query  262  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             HTKGFGSKMMAKMGFVEG GLGKDSQG+  P++A R PKS+GLGAK
Sbjct  718  KHTKGFGSKMMAKMGFVEGMGLGKDSQGMVNPLVAARLPKSRGLGAK  764



>ref|XP_008801999.1| PREDICTED: uncharacterized protein LOC103715973 isoform X2 [Phoenix 
dactylifera]
Length=786

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 98/162 (60%), Gaps = 36/162 (22%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            +K   S S   GAFE+HTTGFGSKMM KMGF  G GLGKDGQG+ +PI+V +RPK+LGLG
Sbjct  658  DKTAKSRSSKLGAFEVHTTGFGSKMMAKMGFVEGTGLGKDGQGMVQPIEVIKRPKSLGLG  717

Query  424  AD-VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
                P+TS         P+S                              FG+FE HT G
Sbjct  718  VQFTPDTSDVR----IKPES------------------------------FGAFEKHTTG  743

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGS+MMAKMGFV GTGLGKDSQGI  P+ A + PKS+GLGAK
Sbjct  744  FGSRMMAKMGFVPGTGLGKDSQGIINPLTAVKLPKSRGLGAK  785



>gb|EMT16376.1| Tuftelin-interacting protein 11 [Aegilops tauschii]
Length=779

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 94/160 (59%), Gaps = 2/160 (1%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            +K V S    G FE HT GFGSKMM KMGF  G GLGKDGQGI +P+Q  QRPK+LGLG 
Sbjct  616  EKVVGSDSKLGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGV  675

Query  421  DVP-ETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
            +   E   A     P  K+         R     +   +           G+FE HTKGF
Sbjct  676  EFDSELEAAKARSEPPAKARPEPAANARRELSRSRSEPRRNTRPPEMYDCGTFERHTKGF  735

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GSKMM KMGFV G+GLGKD QGI  P+ A RRPKS+GLGA
Sbjct  736  GSKMMVKMGFVPGSGLGKDGQGIVNPLTAVRRPKSRGLGA  775


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  P+ A +RPKS GLG +
Sbjct  625  LGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVE  676



>ref|XP_011033482.1| PREDICTED: uncharacterized protein LOC105131955 [Populus euphratica]
Length=724

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E K  +SS  YGAFE+HT GFGSKMM KMGF  GGGLGKDGQG+A+PI+  QRPK+LGLG
Sbjct  579  ENKDATSSSKYGAFEVHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEAIQRPKSLGLG  638

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             D    S  +  K P     G G+                 +    +P FG+FE HTKGF
Sbjct  639  VDFSNISGDSVKKKPQILETGTGK----------------FEKHSKTPSFGAFEKHTKGF  682

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSKMM +MGFVEG GLGKDSQGI +P++A  RPK++GLGAK
Sbjct  683  GSKMMTRMGFVEGKGLGKDSQGIVSPLVAVTRPKARGLGAK  723



>gb|KEH32162.1| D111/G-patch domain protein [Medicago truncatula]
Length=783

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 111/166 (67%), Gaps = 7/166 (4%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            KK  +SS N G+FE+HTTGFGSKMM KMG+T GGGLGK+GQG+A+PI+V QRPK+LGLG 
Sbjct  617  KKGATSSANVGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGV  676

Query  421  ------DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFEN  260
                  D P   +   +K  T  S   G         S     +       + G GSFE 
Sbjct  677  EFSSNVDDPTRDSIGTSKKHTKSSSRVGSSEKRTKGSSSIGSFEKHTKGSSTSGIGSFEK  736

Query  259  HTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            HTKGFGSKMMAKMGFVEG+GLG++SQGITAP+ A R PKS+GLGAK
Sbjct  737  HTKGFGSKMMAKMGFVEGSGLGRESQGITAPLGAVRLPKSRGLGAK  782



>ref|NP_001152479.1| LOC100286119 [Zea mays]
 gb|ACG47812.1| G-patch domain containing protein [Zea mays]
 tpg|DAA46960.1| TPA: g-patch domain containing protein [Zea mays]
Length=733

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 97/162 (60%), Gaps = 20/162 (12%)
 Frame = -3

Query  592  CV----SSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGL  428
            CV    S+S + G+FE+HT GFGSKMM KMGF  G GLGKDGQGI +PIQ   RPK+LGL
Sbjct  584  CVKPVESNSTHLGSFEVHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAVHRPKSLGL  643

Query  427  GADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
            G +    + A + +    K +                  +       + G GSFE HTKG
Sbjct  644  GVEFDSVAEAIKARAEPIKLI---------------SELRRNVWAPETSGVGSFEKHTKG  688

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGSKMM  MGFV G+GLGKD QGI  P+   RRPKS+GLGA+
Sbjct  689  FGSKMMVNMGFVPGSGLGKDGQGIATPLTGVRRPKSRGLGAE  730



>ref|XP_008801998.1| PREDICTED: uncharacterized protein LOC103715973 isoform X1 [Phoenix 
dactylifera]
Length=794

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 98/162 (60%), Gaps = 36/162 (22%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            +K   S S   GAFE+HTTGFGSKMM KMGF  G GLGKDGQG+ +PI+V +RPK+LGLG
Sbjct  666  DKTAKSRSSKLGAFEVHTTGFGSKMMAKMGFVEGTGLGKDGQGMVQPIEVIKRPKSLGLG  725

Query  424  AD-VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
                P+TS         P+S                              FG+FE HT G
Sbjct  726  VQFTPDTSDVR----IKPES------------------------------FGAFEKHTTG  751

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGS+MMAKMGFV GTGLGKDSQGI  P+ A + PKS+GLGAK
Sbjct  752  FGSRMMAKMGFVPGTGLGKDSQGIINPLTAVKLPKSRGLGAK  793



>gb|KJB64581.1| hypothetical protein B456_010G054900 [Gossypium raimondii]
Length=786

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 110/162 (68%), Gaps = 13/162 (8%)
 Frame = -3

Query  607  CHEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALG  431
             +E K +  S  +GAFE+HT GFGSKMM KMGF  GGGLGKDGQG+A+PI+V QRPK+LG
Sbjct  635  SYEHKGIIRSAQFGAFEVHTKGFGSKMMAKMGFVEGGGLGKDGQGMAQPIEVVQRPKSLG  694

Query  430  LGADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTK  251
            LG +   TS+ ++      KS G  E+   R   S K              FG+FE HTK
Sbjct  695  LGVNFTSTSSDSDR---VHKSGGASENHSKRFGDSSKDQH---------KSFGAFEKHTK  742

Query  250  GFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GFGSKMMAKMGFVEG GLGKDSQGI  P++A+R PKS+GLGA
Sbjct  743  GFGSKMMAKMGFVEGMGLGKDSQGIVNPLVASRLPKSRGLGA  784


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -3

Query  604  HEKKCVSSSXN----YGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPK  440
            H K+   SS +    +GAFE HT GFGSKMM KMGF  G GLGKD QGI  P+  S+ PK
Sbjct  719  HSKRFGDSSKDQHKSFGAFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLVASRLPK  778

Query  439  ALGLGAD  419
            + GLGA+
Sbjct  779  SRGLGAN  785



>ref|XP_003573663.1| PREDICTED: uncharacterized protein LOC100845409 [Brachypodium 
distachyon]
Length=751

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 99/166 (60%), Gaps = 14/166 (8%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  425
            E    S S   G FE+HT GFGSKMM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG
Sbjct  589  ENVVESDSAKLGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLG  648

Query  424  ADVPETSTANETKT------PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFE  263
             +    + A + ++      P P         P+++R   ++  +           G+FE
Sbjct  649  VEFDSEAEAMKARSELANARPEPSKA---RSEPSKARSEQRRNIRPADMNS----LGTFE  701

Query  262  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
             HTKGFGSKMM KMGFV G GLGKD QGI  P+ A RRP+S+GLGA
Sbjct  702  RHTKGFGSKMMVKMGFVPGYGLGKDGQGIVNPLTAVRRPRSRGLGA  747


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  98
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  PI A  RPKS GLG +  F     
Sbjct  599  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGVE--FDSEAE  656

Query  97   SLSSREKL  74
            ++ +R +L
Sbjct  657  AMKARSEL  664



>ref|XP_010109666.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
 gb|EXC23988.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
Length=804

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 96/156 (62%), Gaps = 26/156 (17%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPE  410
            S S   GAFE HT GFGSKMM KMGF  G GLGKD QGI  PI+   RPK+LGLG +   
Sbjct  673  SKSQKLGAFEKHTKGFGSKMMAKMGFVEGKGLGKDSQGIVNPIK---RPKSLGLGVEF--  727

Query  409  TSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMM  230
            +   ++T +  P S       P +S+                   G+FE HTKGFGSKMM
Sbjct  728  SHIVDDTASSDPAS-----SRPLKSKSQK---------------LGAFEKHTKGFGSKMM  767

Query  229  AKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            AKMGFVEG GLGKDSQGI  P+LA R PKS+GLGAK
Sbjct  768  AKMGFVEGKGLGKDSQGIVNPLLAVRLPKSRGLGAK  803


 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 103/159 (65%), Gaps = 26/159 (16%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V+ S N+GAFE HT GFGSKMM KMGF  GGGLGK+G+GIAEPI+V +RPK+LGLG +
Sbjct  593  KEVAGSANFGAFEEHTKGFGSKMMAKMGFIEGGGLGKEGKGIAEPIEVIKRPKSLGLGVE  652

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
               +   ++T +  P S       P +S+                   G+FE HTKGFGS
Sbjct  653  F--SHIVDDTASNDPAS-----SRPLKSKSQK---------------LGAFEKHTKGFGS  690

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMMAKMGFVEG GLGKDSQGI  PI   +RPKS GLG +
Sbjct  691  KMMAKMGFVEGKGLGKDSQGIVNPI---KRPKSLGLGVE  726



>ref|XP_010913384.1| PREDICTED: uncharacterized protein LOC105039084 isoform X1 [Elaeis 
guineensis]
Length=776

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 97/162 (60%), Gaps = 36/162 (22%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            EK   S S   GAFE HT GFGSKMM KMGF  G GLGK+GQG+ +PI+V +RPK+LGLG
Sbjct  649  EKSAKSRSSKLGAFEEHTKGFGSKMMAKMGFVDGAGLGKEGQGMVQPIEVIKRPKSLGLG  708

Query  424  ADV-PETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
              + P+ S         P+S+G                              +FE HTKG
Sbjct  709  VQITPDISDVR----VKPESLG------------------------------AFEKHTKG  734

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGS+MMAKMGFV GTGLGKD+QGI  P+ A + PKS+GLGAK
Sbjct  735  FGSRMMAKMGFVPGTGLGKDAQGIINPLTAVKLPKSRGLGAK  776



>ref|XP_010913385.1| PREDICTED: uncharacterized protein LOC105039084 isoform X2 [Elaeis 
guineensis]
Length=772

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 97/162 (60%), Gaps = 36/162 (22%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            EK   S S   GAFE HT GFGSKMM KMGF  G GLGK+GQG+ +PI+V +RPK+LGLG
Sbjct  645  EKSAKSRSSKLGAFEEHTKGFGSKMMAKMGFVDGAGLGKEGQGMVQPIEVIKRPKSLGLG  704

Query  424  ADV-PETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
              + P+ S         P+S+G                              +FE HTKG
Sbjct  705  VQITPDISDVR----VKPESLG------------------------------AFEKHTKG  730

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGS+MMAKMGFV GTGLGKD+QGI  P+ A + PKS+GLGAK
Sbjct  731  FGSRMMAKMGFVPGTGLGKDAQGIINPLTAVKLPKSRGLGAK  772



>gb|AES91716.2| D111/G-patch domain protein [Medicago truncatula]
Length=798

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 117/181 (65%), Gaps = 22/181 (12%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            KK  +SS N G+FE+HTTGFGSKMM KMG+T GGGLGK+GQG+A+PI+V QRPK+LGLG 
Sbjct  617  KKGATSSANVGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGV  676

Query  421  ------DVPETST---------------ANETKTPTPKSVGFGEDLPTRsrksgkkgsqg  305
                  D P   +               ++E +T    S+G  E     S  SG    + 
Sbjct  677  EFSSNVDDPTRDSIGTSKKHTKSSSRVGSSEKRTKGSSSIGSFEKHTKGSSTSGIGSFEK  736

Query  304  qkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
                  + G GSFE HTKGFGSKMMAKMGFVEG+GLG++SQGITAP+ A R PKS+GLGA
Sbjct  737  HTKGSSTSGIGSFEKHTKGFGSKMMAKMGFVEGSGLGRESQGITAPLGAVRLPKSRGLGA  796

Query  124  K  122
            K
Sbjct  797  K  797



>ref|XP_003609519.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Medicago truncatula]
Length=809

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 117/181 (65%), Gaps = 22/181 (12%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            KK  +SS N G+FE+HTTGFGSKMM KMG+T GGGLGK+GQG+A+PI+V QRPK+LGLG 
Sbjct  628  KKGATSSANVGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGV  687

Query  421  ------DVPETST---------------ANETKTPTPKSVGFGEDLPTRsrksgkkgsqg  305
                  D P   +               ++E +T    S+G  E     S  SG    + 
Sbjct  688  EFSSNVDDPTRDSIGTSKKHTKSSSRVGSSEKRTKGSSSIGSFEKHTKGSSTSGIGSFEK  747

Query  304  qkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
                  + G GSFE HTKGFGSKMMAKMGFVEG+GLG++SQGITAP+ A R PKS+GLGA
Sbjct  748  HTKGSSTSGIGSFEKHTKGFGSKMMAKMGFVEGSGLGRESQGITAPLGAVRLPKSRGLGA  807

Query  124  K  122
            K
Sbjct  808  K  808



>ref|XP_002523543.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38882.1| zinc finger protein, putative [Ricinus communis]
Length=775

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 106/162 (65%), Gaps = 23/162 (14%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E K  +S+   GAFE+HT GFGSKMM KMGF  GGGLG+DGQGIAEPI+  QRPK+LGLG
Sbjct  634  ENKDTTSTAKVGAFEVHTKGFGSKMMAKMGFVEGGGLGRDGQGIAEPIEAIQRPKSLGLG  693

Query  424  ADVPETS-TANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
            A++P+T+    + K  +   +G    L +                      G+FE HTKG
Sbjct  694  ANIPDTNGDPMDNKLQSAGRLGKHAKLQS---------------------LGAFEKHTKG  732

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGSKMMA+MGFVEG GLGK+SQGI  P+ A R PKS+GLGAK
Sbjct  733  FGSKMMARMGFVEGMGLGKNSQGIVNPLAAVRLPKSRGLGAK  774


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  416
            GAFE HT GFGSKMM +MGF  G GLGK+ QGI  P+   + PK+ GLGA V
Sbjct  724  GAFEKHTKGFGSKMMARMGFVEGMGLGKNSQGIVNPLAAVRLPKSRGLGAKV  775



>ref|XP_009387541.1| PREDICTED: uncharacterized protein LOC103974432 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=728

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 95/159 (60%), Gaps = 36/159 (23%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV  416
              +S  + GAFE+HT GFGS++M KMGF  G GLGK GQG+ +PIQV +RPK+LGLG   
Sbjct  603  VATSHASIGAFEVHTKGFGSRLMAKMGFVEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQF  662

Query  415  -PETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
              ETS+A          +G                             G+FE HTKGFGS
Sbjct  663  EDETSSAG-------AEIGR---------------------------IGAFERHTKGFGS  688

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMM KMGFV GTGLGKDSQGI  P+ A ++PKS+GLGAK
Sbjct  689  KMMVKMGFVPGTGLGKDSQGIINPLTAVKQPKSRGLGAK  727



>ref|XP_009387542.1| PREDICTED: uncharacterized protein LOC103974432 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=712

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 95/159 (60%), Gaps = 36/159 (23%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV  416
              +S  + GAFE+HT GFGS++M KMGF  G GLGK GQG+ +PIQV +RPK+LGLG   
Sbjct  587  VATSHASIGAFEVHTKGFGSRLMAKMGFVEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQF  646

Query  415  -PETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
              ETS+A          +G                             G+FE HTKGFGS
Sbjct  647  EDETSSAG-------AEIGR---------------------------IGAFERHTKGFGS  672

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMM KMGFV GTGLGKDSQGI  P+ A ++PKS+GLGAK
Sbjct  673  KMMVKMGFVPGTGLGKDSQGIINPLTAVKQPKSRGLGAK  711



>ref|XP_010687767.1| PREDICTED: uncharacterized protein LOC104901840 [Beta vulgaris 
subsp. vulgaris]
Length=801

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 111/165 (67%), Gaps = 7/165 (4%)
 Frame = -3

Query  604  HEKKCV-SSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALG  431
             E K + +SS  + +FE+HT GFGSKMM KMG+  G GLGKDG+GI++PI+  QRPK+LG
Sbjct  636  QESKAIDNSSSTFASFEVHTKGFGSKMMAKMGYVEGDGLGKDGKGISQPIEAVQRPKSLG  695

Query  430  LGADVPETSTANETKTPTPKSVG--FGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENH  257
            LG    E+S  NET TP  K  G    +  P  +         G   +  +P  G+FE H
Sbjct  696  LGMAFVESS--NET-TPVAKRSGGSVRKSTPNTNETMPVAKRSGGSGRNSTPNIGAFEKH  752

Query  256  TKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            TKGFGSKMMA+MGFV+G GLG++SQGI  P++A RRPK++GLGA+
Sbjct  753  TKGFGSKMMARMGFVDGAGLGRNSQGIVTPLVAVRRPKARGLGAE  797



>gb|KCW82693.1| hypothetical protein EUGRSUZ_C04073 [Eucalyptus grandis]
Length=304

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 102/183 (56%), Gaps = 31/183 (17%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            +S ++GAFE+ T GFGSKM  K     G GLGK G  +AEPIQ  +RP++LGLG   PE+
Sbjct  136  TSESFGAFEVQTRGFGSKMRRKWDLIEGQGLGKGGTSLAEPIQAIKRPQSLGLGMSFPES  195

Query  406  ----STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
                    E+++ + KS   G     R                     G+FE HTKGFGS
Sbjct  196  GEEPERNKESESQSAKSKQSGRGASVRRTPQ---------------SIGAFERHTKGFGS  240

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA-----------K**FMVSFHSL  92
            ++MAKMGFVEG GLGKDSQGI  P+ A R PKS+GLGA              ++VS+ +L
Sbjct  241  RVMAKMGFVEGMGLGKDSQGIVNPLAAVRLPKSRGLGATLVRIYRSPTSASSYLVSYSTL  300

Query  91   SSR  83
             SR
Sbjct  301  QSR  303



>ref|XP_010042746.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like, partial [Eucalyptus grandis]
Length=263

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 101/165 (61%), Gaps = 20/165 (12%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGL  428
             E   + +S ++GAFE+HT GFGSKMM +MGF  G GLGK G G+AEPI+V +RPK+LGL
Sbjct  112  EEHVSLVTSESFGAFEVHTRGFGSKMMARMGFIEGQGLGKGGTGLAEPIEVIKRPKSLGL  171

Query  427  GADVPET----STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFEN  260
            G   PE+        E+++ + KS   G     R                     G+FE 
Sbjct  172  GMSFPESGEEPERNRESESQSTKSKQSGRGASVRRIPQC---------------IGAFER  216

Query  259  HTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            HTKGFGS++MAKMGFVEG GLGKDSQGI  P+ A R PKS+GL A
Sbjct  217  HTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPLAAVRLPKSRGLDA  261



>ref|XP_009341804.1| PREDICTED: uncharacterized protein LOC103933838 [Pyrus x bretschneideri]
Length=765

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 105/158 (66%), Gaps = 13/158 (8%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V+ S  Y +FE+HT GFGSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +
Sbjct  618  KAVAESTEYRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  677

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
               +     ++TP P +    +  P RSR   +               G+FE HTKGFGS
Sbjct  678  FSSSIEILVSRTP-PVNNNAVKSNPVRSRSQTQSQR-----------VGAFERHTKGFGS  725

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            KMMAKMGFVEGTGLGKDSQGI  P+ A R PKS+GLGA
Sbjct  726  KMMAKMGFVEGTGLGKDSQGIVNPLSAVRLPKSRGLGA  763


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  98
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +  F  S  
Sbjct  626  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE--FSSSIE  683

Query  97   SLSSR  83
             L SR
Sbjct  684  ILVSR  688



>ref|XP_009366281.1| PREDICTED: uncharacterized protein LOC103956064 [Pyrus x bretschneideri]
Length=758

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 105/158 (66%), Gaps = 13/158 (8%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V+ S  Y +FE+HT GFGSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +
Sbjct  611  KAVAESTEYRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  670

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
               +     ++TP P +    +  P RSR   +               G+FE HTKGFGS
Sbjct  671  FSSSIEIPVSRTP-PVNNNAVKSNPVRSRSQTQSQR-----------VGAFERHTKGFGS  718

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            KMMAKMGFVEGTGLGKDSQGI  P+ A R PKS+GLGA
Sbjct  719  KMMAKMGFVEGTGLGKDSQGIVNPLSAVRLPKSRGLGA  756


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  619  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  670



>ref|XP_009341849.1| PREDICTED: uncharacterized protein LOC103933875 [Pyrus x bretschneideri]
Length=765

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 105/158 (66%), Gaps = 13/158 (8%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V+ S  Y +FE+HT GFGSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +
Sbjct  618  KAVAESTEYRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  677

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
               +     ++TP P +    +  P RSR   +               G+FE HTKGFGS
Sbjct  678  FSSSIEILVSRTP-PVNNNAVKSNPVRSRSQTQSQR-----------VGAFERHTKGFGS  725

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            KMMAKMGFVEGTGLGKDSQGI  P+ A R PKS+GLGA
Sbjct  726  KMMAKMGFVEGTGLGKDSQGIVNPLSAVRLPKSRGLGA  763


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  98
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +  F  S  
Sbjct  626  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE--FSSSIE  683

Query  97   SLSSR  83
             L SR
Sbjct  684  ILVSR  688



>ref|XP_004508396.1| PREDICTED: uncharacterized protein LOC101505169 [Cicer arietinum]
Length=806

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 113/181 (62%), Gaps = 24/181 (13%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            KK  +SS N G+FE+HTTGFGSKMM KMG+T GGGLGK+GQG+A+PI+V +RPK+LGLG 
Sbjct  627  KKGDTSSANIGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIKRPKSLGLGV  686

Query  421  DVPETSTANETKTPTPKSVGFGEDLP---------TRsrksgkkgsqgqkaqygSPGF--  275
            +   +S  +E     P  +G  E            T+   S     +  K       F  
Sbjct  687  EF--SSNLDEPTRDNPSGIGTSEKHTKGSSSIGKHTKGSSSFVSFEKHTKGSSSFASFEK  744

Query  274  ----------GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
                      G+FE HTKGFGSKMMAKMGFVEG GLG+DSQGITAP+ A R PKS+GLGA
Sbjct  745  HTKGSSSSSIGAFEKHTKGFGSKMMAKMGFVEGAGLGRDSQGITAPLGAVRLPKSRGLGA  804

Query  124  K  122
            K
Sbjct  805  K  805



>ref|XP_006407631.1| hypothetical protein EUTSA_v10020109mg [Eutrema salsugineum]
 gb|ESQ49084.1| hypothetical protein EUTSA_v10020109mg [Eutrema salsugineum]
Length=783

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 106/155 (68%), Gaps = 11/155 (7%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANE  392
            GAFE+HT GFGSKMM KMGF  GGGLGKDG+GIA+PI+  QRPK+LGLG D P  S    
Sbjct  633  GAFEVHTKGFGSKMMAKMGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFPINS----  688

Query  391  TKTPTPKSVGFGEDLPTRsrksgkkgsqgq-----kaqygSPGFGSFENHTKGFGSKMMA  227
             + P+P S     + P+ S K  K+ S         A+      G+FE HT GFGS+MMA
Sbjct  689  -EDPSPSSNNAKRNKPSSSGKHVKRISHESGGASGSARIRDKRLGAFEQHTTGFGSRMMA  747

Query  226  KMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            +MGFVEG+GLG+DSQGI  P+ A RRPK++GLGA+
Sbjct  748  RMGFVEGSGLGRDSQGIVNPLFAVRRPKARGLGAE  782



>gb|KDP38622.1| hypothetical protein JCGZ_03975 [Jatropha curcas]
Length=756

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 21/161 (13%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E K    S   G+FE+HT GFGSKMM KMG+  GGGLGKDGQG+AEPI+V QRPK+LGLG
Sbjct  615  ENKVTIISAKVGSFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMAEPIEVIQRPKSLGLG  674

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
            A++  ++  +++    P+++   E                          G+FE HTKGF
Sbjct  675  ANI--SNPTDDSMENKPQTIERFE------------------KHAKPRNLGAFEKHTKGF  714

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GSKMMA+MGFVEG GLGK SQGI  P++A R PKS+GLGAK
Sbjct  715  GSKMMARMGFVEGMGLGKHSQGIINPLVAARLPKSRGLGAK  755



>gb|KFK38375.1| hypothetical protein AALP_AA3G105800 [Arabis alpina]
Length=761

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 104/157 (66%), Gaps = 11/157 (7%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-----P  413
            + GAFE+HT GFGSKMM KMGF  GGGLGKDG+GIA+PI+  QRPK+LGLG D       
Sbjct  609  DIGAFEVHTRGFGSKMMAKMGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSISTED  668

Query  412  ETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKM  233
             +S++N  K   P S G         R S   G     A+      G+FE HT GFGSKM
Sbjct  669  PSSSSNNAKRNRPSSSG-----KHVKRISHDSGGGSGSARIRDKRLGAFEQHTTGFGSKM  723

Query  232  MAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            MA+MGFVEG+GLG+DSQGI  P++A RRP+ +GLGA+
Sbjct  724  MARMGFVEGSGLGRDSQGIVNPLVAVRRPRVRGLGAE  760



>ref|XP_008443896.1| PREDICTED: uncharacterized protein LOC103487380 isoform X1 [Cucumis 
melo]
Length=800

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 99/155 (64%), Gaps = 16/155 (10%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  + G+FELHT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E 
Sbjct  660  SRDSIGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEA  719

Query  406  STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMA  227
            ST+            +     TRS    K               G+FE HTKGFGSKMMA
Sbjct  720  STS----AAGDNQASWVSSARTRSGALEKSKR-----------IGAFEVHTKGFGSKMMA  764

Query  226  KMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMGFVEG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  765  KMGFVEGMGLGKDSQGIVNPLLPVRRPKARGLGAK  799


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
             +  S   GAFE+HT GFGSKMM KMGF  G GLGKD QGI  P+   +RPKA GLGA
Sbjct  741  ALEKSKRIGAFEVHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLLPVRRPKARGLGA  798



>ref|XP_008336930.1| PREDICTED: uncharacterized protein LOC103400027 [Malus domestica]
Length=757

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 101/157 (64%), Gaps = 13/157 (8%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K  + S  Y +FE+HT GFGSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +
Sbjct  610  KVAAESTEYRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  669

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
                     +KTP  K++      P R R   +      +        GSFE HTKGFGS
Sbjct  670  FSTPVEIPVSKTPPVKNI------PVRRRSQAQSSQTQSER------VGSFEKHTKGFGS  717

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            KMMAKMGFVEG GLGKDSQGI  P+ A R PKS+GLG
Sbjct  718  KMMAKMGFVEGMGLGKDSQGIVYPLAAVRLPKSRGLG  754


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  618  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  669



>ref|XP_008443898.1| PREDICTED: uncharacterized protein LOC103487380 isoform X2 [Cucumis 
melo]
Length=795

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 99/155 (64%), Gaps = 16/155 (10%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  + G+FELHT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E 
Sbjct  655  SRDSIGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEA  714

Query  406  STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMA  227
            ST+            +     TRS    K               G+FE HTKGFGSKMMA
Sbjct  715  STS----AAGDNQASWVSSARTRSGALEKSKR-----------IGAFEVHTKGFGSKMMA  759

Query  226  KMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMGFVEG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  760  KMGFVEGMGLGKDSQGIVNPLLPVRRPKARGLGAK  794


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
             +  S   GAFE+HT GFGSKMM KMGF  G GLGKD QGI  P+   +RPKA GLGA
Sbjct  736  ALEKSKRIGAFEVHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLLPVRRPKARGLGA  793



>ref|XP_007155121.1| hypothetical protein PHAVU_003G175300g [Phaseolus vulgaris]
 gb|ESW27115.1| hypothetical protein PHAVU_003G175300g [Phaseolus vulgaris]
Length=759

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 102/162 (63%), Gaps = 13/162 (8%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGAD  419
            K V+ S N G+FE HTTGFGSKMM KMG+TGGG        +A+PIQV QRPK+LGLG +
Sbjct  606  KGVTGSANIGSFEEHTTGFGSKMMAKMGYTGGGGLGKNGQGMAQPIQVIQRPKSLGLGVE  665

Query  418  VPETSTANETKTPT---PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
                      KT      +SVG G +L  +  + G   S            G+FE HTKG
Sbjct  666  FSSDPGEPARKTSLRVGAESVGLGVELSNKPGEPGMNRSSR---------VGAFERHTKG  716

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGSKMMAKMGFVEG GLG++SQGIT P+ A R PKS+GLGAK
Sbjct  717  FGSKMMAKMGFVEGKGLGRESQGITTPLTALRLPKSRGLGAK  758



>ref|XP_010041360.1| PREDICTED: zinc finger CCCH-type with G patch domain-containing 
protein-like [Eucalyptus grandis]
Length=278

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 98/163 (60%), Gaps = 20/163 (12%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E   + +S ++GAFE+H  GFGSKMM KMGF  G GLGK G G+AEPI+V + PK+LGLG
Sbjct  108  EHVTLITSESFGAFEVHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHPKSLGLG  167

Query  424  ADVPET----STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENH  257
               PE+        E+++ + KS   G     R                     G+FE H
Sbjct  168  MSFPESGEEPERNRESESQSAKSKQSGRGASVRRTPQ---------------SIGAFERH  212

Query  256  TKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            TKGFGS++MAKMGFVE  GLGKDSQGI  P+ A R PKS+GLG
Sbjct  213  TKGFGSRVMAKMGFVESMGLGKDSQGIVNPLAAVRLPKSRGLG  255



>gb|KCW44417.1| hypothetical protein EUGRSUZ_L02096 [Eucalyptus grandis]
Length=287

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 98/164 (60%), Gaps = 20/164 (12%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGL  428
             E   + +S ++GAFE+H  GFGSKMM KMGF  G GLGK G G+AEPI+V + PK+LGL
Sbjct  116  EEHVTLITSESFGAFEVHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHPKSLGL  175

Query  427  GADVPET----STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFEN  260
            G   PE+        E+++ + KS   G     R                     G+FE 
Sbjct  176  GMSFPESGEEPERNRESESQSAKSKQSGRGASVRRTPQ---------------SIGAFER  220

Query  259  HTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            HTKGFGS++MAKMGFVE  GLGKDSQGI  P+ A R PKS+GLG
Sbjct  221  HTKGFGSRVMAKMGFVESMGLGKDSQGIVNPLAAVRLPKSRGLG  264



>ref|XP_004146703.1| PREDICTED: uncharacterized protein LOC101215133 [Cucumis sativus]
Length=793

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 100/159 (63%), Gaps = 24/159 (15%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  + G+FELHT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E 
Sbjct  653  SRDSIGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEA  712

Query  406  STA----NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
            ST+    N+    +    G      T+                     G+FE HTKGFGS
Sbjct  713  STSAAGDNQASGISSARTGSSALEKTKK-------------------IGAFEVHTKGFGS  753

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMMAKMGFVEG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  754  KMMAKMGFVEGMGLGKDSQGIINPLLPVRRPKARGLGAK  792



>gb|KGN65218.1| hypothetical protein Csa_1G266150 [Cucumis sativus]
Length=783

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 100/159 (63%), Gaps = 24/159 (15%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  + G+FELHT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E 
Sbjct  643  SRDSIGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEA  702

Query  406  STA----NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
            ST+    N+    +    G      T+                     G+FE HTKGFGS
Sbjct  703  STSAAGDNQASGISSARTGSSALEKTKK-------------------IGAFEVHTKGFGS  743

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            KMMAKMGFVEG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  744  KMMAKMGFVEGMGLGKDSQGIINPLLPVRRPKARGLGAK  782



>ref|XP_004162452.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226078 
[Cucumis sativus]
Length=802

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 100/157 (64%), Gaps = 21/157 (13%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  + G+FELHT GFGSKMM KMGF  GGGLGKDGQG+  PI+V ++PK+LGLG +  E 
Sbjct  663  SRDSIGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVXEKPKSLGLGIEFSEA  722

Query  406  ST--ANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKM  233
            ST  A + +     S   G  L                    +   G+FE HTKGFGSKM
Sbjct  723  STSAAGDNQASGISSARTGSVL------------------GKTKKIGAFEVHTKGFGSKM  764

Query  232  MAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            MAKMGFVEG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  765  MAKMGFVEGMGLGKDSQGIINPLLPVRRPKARGLGAK  801



>ref|XP_007203786.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
 gb|EMJ04985.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
Length=767

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 15/158 (9%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V  +  + +FE+HT GFGSKM+ KMGF  GGGLGKDGQG+A PI+V QRPK+LGLG +
Sbjct  622  KDVVEAAEFHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  681

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
               T       TP        +  P +++   ++ SQ Q+        GSFE HTKGFGS
Sbjct  682  FSNTVDLPVNNTPV-------KSYPVKNKSQSQRVSQPQR-------VGSFEKHTKGFGS  727

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            KMMAKMGFVEG GLGKDSQGI  P+ A R PKS+GLGA
Sbjct  728  KMMAKMGFVEGMGLGKDSQGIVNPLAAVRLPKSRGLGA  765


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG+ API   +RPKS GLG +
Sbjct  630  FHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  681



>ref|XP_006453696.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 ref|XP_006453697.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66936.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66937.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
Length=744

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 102/160 (64%), Gaps = 15/160 (9%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E K   SS   GAFE+HT GFGSKMM KMG+  GGGLGKDGQG+++PI+  QRPK LGLG
Sbjct  597  ESKGTVSSTQIGAFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMSKPIEAIQRPKKLGLG  656

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             +   T   +  K     S               +K S+   A+ G+   G+FE HT+GF
Sbjct  657  VEFSNTDDDSSRKESRSDSA--------------RKESRSNSAKKGAQNIGAFEKHTRGF  702

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GSKMMAKMGFVEG GLG+DSQGI  P+ A R PKS+GLGA
Sbjct  703  GSKMMAKMGFVEGMGLGRDSQGIVNPLAAVRLPKSRGLGA  742


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             G+FE HTKGFGSKMMAKMG+VEG GLGKD QG++ PI A +RPK  GLG +
Sbjct  607  IGAFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMSKPIEAIQRPKKLGLGVE  658



>tpg|DAA46961.1| TPA: hypothetical protein ZEAMMB73_831663 [Zea mays]
Length=125

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 79/137 (58%), Gaps = 16/137 (12%)
 Frame = -3

Query  529  MMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGE  353
            MM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +    K +    
Sbjct  1    MMAKMGFIEGTGLGKDGQGIVQPIQAVHRPKSLGLGVEFDSVAEAIKARAEPIKLI----  56

Query  352  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  173
                          +       + G GSFE HTKGFGSKMM  MGFV G+GLGKD QGI 
Sbjct  57   -----------SELRRNVWAPETSGVGSFEKHTKGFGSKMMVNMGFVPGSGLGKDGQGIA  105

Query  172  APILATRRPKSQGLGAK  122
             P+   RRPKS+GLGA+
Sbjct  106  TPLTGVRRPKSRGLGAE  122


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            G+FE HT GFGSKMMV MGF  G GLGKDGQGIA P+   +RPK+ GLGA+
Sbjct  72   GSFEKHTKGFGSKMMVNMGFVPGSGLGKDGQGIATPLTGVRRPKSRGLGAE  122



>ref|XP_008242893.1| PREDICTED: uncharacterized protein LOC103341193 [Prunus mume]
Length=769

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 103/158 (65%), Gaps = 15/158 (9%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
            K V     + +FE+HT GFGSKM+ KMGF  GGGLGKDGQG+A PI+V QRPK+LGLG +
Sbjct  624  KDVVEVAEFHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  683

Query  418  VPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGS  239
               T       TP   +       P +++   ++ SQ QK        GSFE HTKGFGS
Sbjct  684  FSNTVDLPVNNTPVKSN-------PVKNKAQSQRVSQPQK-------VGSFEKHTKGFGS  729

Query  238  KMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            KMMAKMGFVEG GLGKDSQGI  P+ A R PKS+GLGA
Sbjct  730  KMMAKMGFVEGMGLGKDSQGIVNPLAAVRLPKSRGLGA  767


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG+ API   +RPKS GLG +
Sbjct  632  FHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  683



>ref|XP_002884758.1| hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61017.1| hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 100/161 (62%), Gaps = 11/161 (7%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPE  410
            S+  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  QRPK+LGLG D   
Sbjct  621  SNGADIGAFEVHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDF--  678

Query  409  TSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPG-----FGSFENHTKGF  245
                 +T+ PTP S    +   + S     K    +    GS G      G+FE HT GF
Sbjct  679  ---NIDTEDPTPSSNNNAKRNRSSSSGKHVKRISHENGASGSGGIRDKRLGAFEQHTTGF  735

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GS+MMA+MGFVEG+GLG++SQGI  P++A RRP+++G+GA+
Sbjct  736  GSRMMARMGFVEGSGLGRESQGIVNPLVAVRRPRARGIGAE  776



>emb|CDY41580.1| BnaC05g43170D [Brassica napus]
Length=738

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 99/161 (61%), Gaps = 8/161 (5%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----  425
             SS  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  QRPK+LGLG    
Sbjct  580  ASSGADIGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDFS  639

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
             D  E S ++       +S   G+ +    R S   G     A+      G+FE HT GF
Sbjct  640  IDTEEASPSSNNNAKRNRSSSSGKQV---KRVSHVIGGGSGSARIRDKRLGAFEQHTTGF  696

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            GS+MMA+MGFV+G+GLG++SQGI  P++A RRPK++GLGA+
Sbjct  697  GSRMMARMGFVDGSGLGRESQGIVNPLVAVRRPKARGLGAE  737



>ref|XP_010464642.1| PREDICTED: uncharacterized protein LOC104745160 isoform X3 [Camelina 
sativa]
Length=776

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (61%), Gaps = 9/160 (6%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----A  422
            S+  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  +RPK+LGLG     
Sbjct  620  SNGADIGAFEMHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSI  679

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            D  + S ++       +S   G+ +    +            +      G+FE HT+GFG
Sbjct  680  DTEDMSPSSNNNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTRGFG  735

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            S+MMA+MGFVEG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  736  SRMMARMGFVEGSGLGRDSQGIVNPLVAVRRPRARGIGAE  775



>ref|XP_010464640.1| PREDICTED: uncharacterized protein LOC104745160 isoform X1 [Camelina 
sativa]
 ref|XP_010464641.1| PREDICTED: uncharacterized protein LOC104745160 isoform X2 [Camelina 
sativa]
Length=777

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (61%), Gaps = 9/160 (6%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----A  422
            S+  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  +RPK+LGLG     
Sbjct  621  SNGADIGAFEMHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSI  680

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            D  + S ++       +S   G+ +    +            +      G+FE HT+GFG
Sbjct  681  DTEDMSPSSNNNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTRGFG  736

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            S+MMA+MGFVEG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  737  SRMMARMGFVEGSGLGRDSQGIVNPLVAVRRPRARGIGAE  776



>ref|XP_010486561.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Camelina 
sativa]
Length=777

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 96/160 (60%), Gaps = 9/160 (6%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----A  422
            S+  + GAFELHT GFGSKMM KMGF  GG        IA+PI+  +RPK+LGLG     
Sbjct  621  SNGADIGAFELHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSI  680

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            D  + S ++       +S   G+ +    +            +      G+FE HT GFG
Sbjct  681  DTEDMSPSSNNNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTTGFG  736

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            S+MMA+MGFVEG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  737  SRMMARMGFVEGSGLGRDSQGIVNPLVAVRRPRARGIGAE  776



>ref|XP_010486559.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010486560.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Camelina 
sativa]
Length=775

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 96/160 (60%), Gaps = 9/160 (6%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----A  422
            S+  + GAFELHT GFGSKMM KMGF  GG        IA+PI+  +RPK+LGLG     
Sbjct  619  SNGADIGAFELHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSI  678

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            D  + S ++       +S   G+ +    +            +      G+FE HT GFG
Sbjct  679  DTEDMSPSSNNNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTTGFG  734

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            S+MMA+MGFVEG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  735  SRMMARMGFVEGSGLGRDSQGIVNPLVAVRRPRARGIGAE  774



>emb|CDY54616.1| BnaA05g28700D [Brassica napus]
Length=701

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 14/157 (9%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVP  413
             SS  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  QRPK+LGLG D  
Sbjct  557  ASSGADIGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDF-  615

Query  412  ETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKM  233
             +   +E   P   +            K  +  S G++ + GS   G+FE HT GFGS+M
Sbjct  616  -SIDTDEASPPINNNA-----------KKNRSSSSGKQVKRGSHDIGAFEQHTTGFGSRM  663

Query  232  MAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            MA+MGFV+G+GLG++SQGI  P++A RRP+++GLGA+
Sbjct  664  MARMGFVDGSGLGRESQGIVNPLVAVRRPRARGLGAE  700


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            K+    S + GAFE HTTGFGS+MM +MGF  G GLG++ QGI  P+   +RP+A GLGA
Sbjct  640  KQVKRGSHDIGAFEQHTTGFGSRMMARMGFVDGSGLGRESQGIVNPLVAVRRPRARGLGA  699

Query  421  D  419
            +
Sbjct  700  E  700



>ref|XP_004287228.1| PREDICTED: uncharacterized protein LOC101294206 [Fragaria vesca 
subsp. vesca]
Length=778

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGI-AEPIQVSQRPKALGLGADVPETS  404
            S ++ +FE+HT GFGSKM+ KMGF  GG         AEPI+  QRPK+LGLG +   T 
Sbjct  626  SADFRSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGRAEPIEAVQRPKSLGLGVEFSNTI  685

Query  403  TANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAK  224
                  TP+ ++          S KS    +   + +  +   GSFE HTKGFGSKMMA+
Sbjct  686  GVQVINTPSRQNPAKNTPAKRNSAKSMLAKNNPVRNKPQTERVGSFERHTKGFGSKMMAR  745

Query  223  MGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            MGFVEG GLGKDSQGI  P+ A R  KS+G+GA
Sbjct  746  MGFVEGMGLGKDSQGIVNPLAAVRLRKSRGIGA  778


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG   PI A +RPKS GLG +
Sbjct  629  FRSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGRAEPIEAVQRPKSLGLGVE  680



>ref|XP_010040586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Eucalyptus grandis]
Length=981

 Score =   120 bits (300),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 81/136 (60%), Gaps = 20/136 (15%)
 Frame = -3

Query  517  MGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA----NETKTPTPKSVGFGE  353
            MGFT   GLGK G G+AEPI+V +RPK+LGLG   PE+        E+++ + KS   G 
Sbjct  1    MGFTEARGLGKGGTGLAEPIEVIKRPKSLGLGMSFPESGVEPERNRESESQSAKSKQSGR  60

Query  352  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  173
                R                     G+FE HTKGFGS++MAKMGFVEG GLGKDSQGI 
Sbjct  61   GASVRRTPQS---------------IGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIV  105

Query  172  APILATRRPKSQGLGA  125
             P+ A R PKS+GLGA
Sbjct  106  NPLAAVRLPKSRGLGA  121


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            GAFE HT GFGS++M KMGF  G GLGKD QGI  P+   + PK+ GLGA
Sbjct  72   GAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPLAAVRLPKSRGLGA  121



>ref|XP_006299668.1| hypothetical protein CARUB_v10015856mg [Capsella rubella]
 gb|EOA32566.1| hypothetical protein CARUB_v10015856mg [Capsella rubella]
Length=774

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 96/160 (60%), Gaps = 9/160 (6%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----A  422
            S+  + GAFE+HT GFGSKMM KMGF  GG        I++PI+  QRPK+LGLG     
Sbjct  618  SNGADIGAFEVHTRGFGSKMMAKMGFIDGGGLGKDGKGISQPIEAVQRPKSLGLGLDFSI  677

Query  421  DVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFG  242
            D  +TS ++       +S   G+     ++            +      G+FE HT GFG
Sbjct  678  DTEDTSPSSNNNAKRNRSSSSGK----HAKHISHDNGASSSGRIRDKRLGAFEQHTTGFG  733

Query  241  SKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            S+MMA+MGFVEG+GLG++SQGI  P++A RRP+ +G+GA+
Sbjct  734  SRMMARMGFVEGSGLGRESQGIVNPLVAVRRPRVRGIGAE  773



>ref|XP_010477969.1| PREDICTED: uncharacterized protein LOC104756959 [Camelina sativa]
Length=775

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 93/162 (57%), Gaps = 13/162 (8%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVP-  413
            S+  + GAFELHT GFGSKMM KMGF  GG        IA+PI+  +RPK+LGLG D   
Sbjct  619  SNGADIGAFELHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSI  678

Query  412  ET-----STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKG  248
            ET     S+ N  K     S G         +            +      G+FE HT G
Sbjct  679  ETEDMSPSSNNNAKRNRSSSSG------KHVKHISHDNGASSSGRIRDKRLGAFEQHTTG  732

Query  247  FGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            FGS+MMA+MGFVEG+GLG+DSQGI  P+ A RRP+ +G+GA+
Sbjct  733  FGSRMMARMGFVEGSGLGRDSQGIVNPLAAVRRPRGRGIGAE  774



>ref|XP_009146893.1| PREDICTED: uncharacterized protein LOC103870513 [Brassica rapa]
Length=739

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 99/167 (59%), Gaps = 20/167 (12%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADV-  416
             SS  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  QRPK+LGLG D  
Sbjct  581  ASSGADIGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAIQRPKSLGLGLDFS  640

Query  415  --------PETSTANETKTPTP-KSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFE  263
                    P  + A + ++ +  K V  G         S   G     A+      G+FE
Sbjct  641  IDTDEAISPINNNARKNRSSSSGKQVKRG---------SHDIGGGSSSARIRDKRLGAFE  691

Query  262  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             HT GFGS+MMA+MGFV+G+GLG++SQGI  P++A RRP+++GLGA+
Sbjct  692  QHTTGFGSRMMARMGFVDGSGLGRESQGIVNPLVAVRRPRARGLGAE  738



>ref|XP_010265699.1| PREDICTED: uncharacterized protein LOC104603377 [Nelumbo nucifera]
Length=820

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 108/205 (53%), Gaps = 54/205 (26%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E K VS+S   GAFE+HT GFGSKMM KMGF  GGGLGKDGQG+ EPI+  +RPK+LGLG
Sbjct  625  ESKDVSNSSKLGAFEMHTRGFGSKMMTKMGFVEGGGLGKDGQGMVEPIEAIKRPKSLGLG  684

Query  424  ADV-----------PETSTANETKT---------------------------------PT  377
             +            PE   A E  T                                   
Sbjct  685  VNFSKTDDDTVRSKPEQFRAFEKHTKGFGSKMMAKMGFVEGGGLGKDGQGMVEPIEAIKR  744

Query  376  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  197
            PKS+G G +            +     +     F +FE HTKGFGSKMMAKMGFVEG GL
Sbjct  745  PKSLGLGVNF---------SKTDDDTVRSKPEQFRAFEKHTKGFGSKMMAKMGFVEGMGL  795

Query  196  GKDSQGITAPILATRRPKSQGLGAK  122
            G+DSQG+  P++A R PKS+GLGAK
Sbjct  796  GRDSQGMVNPLVAVRLPKSRGLGAK  820



>ref|XP_010244790.1| PREDICTED: uncharacterized protein LOC104588524 [Nelumbo nucifera]
Length=737

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 95/160 (59%), Gaps = 34/160 (21%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            E + +SSS   GAFE+HT GFGSKMM KMGF  GGGLG+DGQG+ EP++  + PK+LGLG
Sbjct  609  ENRVISSSSKLGAFEMHTKGFGSKMMAKMGFVEGGGLGRDGQGMVEPLEAIKWPKSLGLG  668

Query  424  ADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGF  245
                             K++G     P R                     G+FE HTKG 
Sbjct  669  VKFS-------------KAIGTARSQPER--------------------IGAFEKHTKGS  695

Query  244  GSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            GS+MM +MGFVEG GLG+DSQGI  P++A R PKS+GLGA
Sbjct  696  GSRMMERMGFVEGMGLGRDSQGIVTPLVAVRLPKSRGLGA  735


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             G+FE HTKGFGSKMMAKMGFVEG GLG+D QG+  P+ A + PKS GLG K
Sbjct  619  LGAFEMHTKGFGSKMMAKMGFVEGGGLGRDGQGMVEPLEAIKWPKSLGLGVK  670


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  416
            GAFE HT G GS+MM +MGF  G GLG+D QGI  P+   + PK+ GLGA+ 
Sbjct  686  GAFEKHTKGSGSRMMERMGFVEGMGLGRDSQGIVTPLVAVRLPKSRGLGANA  737



>ref|NP_566359.1| D111/G-patch domain-containing protein [Arabidopsis thaliana]
 gb|AAF23251.1|AC015985_9 hypothetical protein [Arabidopsis thaliana]
 gb|AAL09738.1| AT3g09850/F8A24_10 [Arabidopsis thaliana]
 gb|AAN18212.1| At3g09850/F8A24_10 [Arabidopsis thaliana]
 gb|AEE74821.1| D111/G-patch domain-containing protein [Arabidopsis thaliana]
Length=781

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 92/158 (58%), Gaps = 3/158 (2%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPE  410
            S+  + GAFE+HT GFGSKMM KMGF  GG        IA+PI+  QRPK+LGLG D   
Sbjct  623  SNGADIGAFEVHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSI  682

Query  409  TSTANETKTPTPKSVGFGEDLPT--RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSK  236
             +      +    +        +    ++           +      G+FE HT GFGS+
Sbjct  683  DTEDPSPSSNNNNNAKRNRSSSSGKHGKRITHDNGASGSGRIRDKRLGAFEQHTTGFGSR  742

Query  235  MMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            MMA+MGFVEG+GLG++SQGI  P++A RRP+++G+GA+
Sbjct  743  MMARMGFVEGSGLGRESQGIVNPLVAVRRPRARGIGAE  780



>gb|KCW82695.1| hypothetical protein EUGRSUZ_C04076 [Eucalyptus grandis]
Length=123

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 82/138 (59%), Gaps = 24/138 (17%)
 Frame = -3

Query  517  MGFTGGG-LGKDGQGIAEPIQVSQRPKALGLGADVPET------STANETKTPTPKSVGF  359
            MGF  G  LG+ G G+AEPI+V +RPK+LGLG   PE+      +  +E+++   K  G 
Sbjct  1    MGFIEGQVLGRGGTGLAEPIEVIKRPKSLGLGMSFPESGEEPERNRESESQSAKLKQSGR  60

Query  358  GEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQG  179
            G  +                 +      G+FE HTKGFGS++MAKMGFVEG GLGKDSQG
Sbjct  61   GASV-----------------RRTPQSIGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQG  103

Query  178  ITAPILATRRPKSQGLGA  125
            I  P+ A R PKS+GLGA
Sbjct  104  IVNPLAAVRFPKSRGLGA  121


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            + GAFE HT GFGS++M KMGF  G GLGKD QGI  P+   + PK+ GLGA
Sbjct  70   SIGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPLAAVRFPKSRGLGA  121



>gb|EPS60366.1| hypothetical protein M569_14436, partial [Genlisea aurea]
Length=64

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 2/51 (4%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGG--GLGKDGQGIAEPIQVSQRPKALGLGA  422
            G+FE HTTGFGSKM+ KMG+ GG  GLGKDGQGI+EPI+VSQRPK+LGLGA
Sbjct  11   GSFERHTTGFGSKMLAKMGYVGGRRGLGKDGQGISEPIEVSQRPKSLGLGA  61


 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEG-TGLGKDSQGITAPILATRRPKSQGLGA  125
            GSFE HT GFGSKM+AKMG+V G  GLGKD QGI+ PI  ++RPKS GLGA
Sbjct  11   GSFERHTTGFGSKMLAKMGYVGGRRGLGKDGQGISEPIEVSQRPKSLGLGA  61



>emb|CBI25601.3| unnamed protein product [Vitis vinifera]
Length=636

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGL  428
            HE K  +SS   GAFE+HT GFGS+MM KMGF  G GLGKDGQG+ + I+V++RPK+LGL
Sbjct  572  HENKGGASSTKLGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGL  631

Query  427  GAD  419
            G +
Sbjct  632  GVE  634


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             G+FE HTKGFGS+MMAKMGFV G GLGKD QG+   I  T+RPKS GLG +
Sbjct  583  LGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  634



>ref|XP_002265219.2| PREDICTED: uncharacterized protein LOC100260114 [Vitis vinifera]
Length=677

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGL  428
            HE K  +SS   GAFE+HT GFGS+MM KMGF  G GLGKDGQG+ + I+V++RPK+LGL
Sbjct  613  HENKGGASSTKLGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGL  672

Query  427  GAD  419
            G +
Sbjct  673  GVE  675


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             G+FE HTKGFGS+MMAKMGFV G GLGKD QG+   I  T+RPKS GLG +
Sbjct  624  LGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  675



>ref|XP_001776479.1| predicted protein [Physcomitrella patens]
 gb|EDQ58746.1| predicted protein [Physcomitrella patens]
Length=856

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
             G FE HTKGFGS+MM+KMGFVEG GLG+D QGI +P+ A +RPKS GLGA
Sbjct  799  IGHFEAHTKGFGSRMMSKMGFVEGQGLGRDGQGIYSPLEAVKRPKSLGLGA  849


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            G FE HT GFGS+MM KMGF  G GLG+DGQGI  P++  +RPK+LGLGA  P T
Sbjct  800  GHFEAHTKGFGSRMMSKMGFVEGQGLGRDGQGIYSPLEAVKRPKSLGLGAYAPST  854



>ref|XP_002163283.2| PREDICTED: tuftelin-interacting protein 11-like [Hydra vulgaris]
Length=797

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -3

Query  601  EKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            + K V +S N+GA+E +TTGFGSKM+ KMG+ G GLGK G+GI EPI+  +R     +GA
Sbjct  105  KSKTVINSKNFGAWEKYTTGFGSKMLEKMGYKGKGLGKHGEGITEPIEAFKRGGRAAIGA  164

Query  421  DVPETSTANE  392
               ET  + E
Sbjct  165  YGSETKKSRE  174


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FG++E +T GFGSKM+ KMG+ +G GLGK  +GIT PI A +R     +GA
Sbjct  115  FGAWEKYTTGFGSKMLEKMGY-KGKGLGKHGEGITEPIEAFKRGGRAAIGA  164



>ref|XP_001418877.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97170.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=105

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGF--TGGGLGKDGQGIAEPIQVSQRPKALGLGA  422
             V +   YGAFE HTTGFGS+M+ KMGF   G G+G++G+GIAEP+  + R K +GLGA
Sbjct  42   VVGAGHEYGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVTATTRGKRVGLGA  100


 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  125
            +G+FE HT GFGS+M+AKMGF  +G+G+G++ +GI  P+ AT R K  GLGA
Sbjct  49   YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVTATTRGKRVGLGA  100



>ref|XP_004164520.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11-like [Cucumis sativus]
Length=872

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 7/80 (9%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD----  419
            S   N GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +    
Sbjct  196  SDPGNVGAFEKHTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKE  255

Query  418  ---VPETSTANETKTPTPKS  368
               +P      E   P P S
Sbjct  256  APKIPALQEVEEKTLPQPTS  275


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -3

Query  283  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  198  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  249



>ref|XP_004151854.1| PREDICTED: tuftelin-interacting protein 11-like [Cucumis sativus]
 gb|KGN63340.1| hypothetical protein Csa_2G431100 [Cucumis sativus]
Length=871

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 7/80 (9%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD----  419
            S   N GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +    
Sbjct  195  SDPGNVGAFEKHTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKE  254

Query  418  ---VPETSTANETKTPTPKS  368
               +P      E   P P S
Sbjct  255  APKIPALQEVEEKTLPQPTS  274


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -3

Query  283  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  248



>ref|XP_008462814.1| PREDICTED: tuftelin-interacting protein 11 [Cucumis melo]
Length=871

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 7/80 (9%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD----  419
            S   N GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +    
Sbjct  195  SDPGNVGAFEKHTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKE  254

Query  418  ---VPETSTANETKTPTPKS  368
               +P      E   P P +
Sbjct  255  APKIPALQEVEEKSLPQPTT  274


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -3

Query  283  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  248



>gb|KII63443.1| Tuftelin-interacting protein 11 [Thelohanellus kitauei]
Length=714

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -3

Query  571  YGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETS--T  401
            + ++E HTTGFGSKM+ KMGF  G GLGK G GI EPIQ   RP    LGA   E S   
Sbjct  72   FASWEKHTTGFGSKMLEKMGFKPGMGLGKHGSGIIEPIQAVSRPGRAALGAYGAEASENV  131

Query  400  ANETKTPTPKSV  365
             +ETK P+PK V
Sbjct  132  PSETK-PSPKPV  142


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            F S+E HT GFGSKM+ KMGF  G GLGK   GI  PI A  RP    LGA
Sbjct  72   FASWEKHTTGFGSKMLEKMGFKPGMGLGKHGSGIIEPIQAVSRPGRAALGA  122



>ref|XP_004300043.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464964.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464965.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464966.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
Length=860

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            N G+FE HT  FG KM+ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +        
Sbjct  191  NLGSFEQHTKAFGMKMLEKMGYKGGGLGKNQQGILAPIEAKLRPKNMGMGFN-----DYK  245

Query  394  ETKTPT  377
            ETK P+
Sbjct  246  ETKQPS  251


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
             GSFE HTK FG KM+ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  192  LGSFEQHTKAFGMKMLEKMGY-KGGGLGKNQQGILAPIEAKLRPKNMGMG  240



>ref|XP_010065638.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Eucalyptus grandis]
 gb|KCW63225.1| hypothetical protein EUGRSUZ_G00845 [Eucalyptus grandis]
Length=859

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 8/81 (10%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG--------  425
            S N G FE +T G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G        
Sbjct  182  SGNVGGFEKYTKGIGMKLLEKMGYKGGGLGKNQQGIVAPVEAKLRPKNMGMGFNDYKETP  241

Query  424  ADVPETSTANETKTPTPKSVG  362
            A  P  S   E K P P   G
Sbjct  242  AKAPVASLEPEEKKPLPDVPG  262


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE +TKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  186  GGFEKYTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPVEAKLRPKNMGMG  233



>ref|XP_010553814.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Tarenaya hassleriana]
Length=881

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 46/81 (57%), Gaps = 11/81 (14%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGL--------GADVP  413
            G FE  T GFG KM+ KMG+ GGGLGK+ QGI  PIQ   RPK +G+        GA +P
Sbjct  213  GQFEKFTKGFGMKMLEKMGYKGGGLGKNEQGIVAPIQAQLRPKKMGMGYNDFKETGAKLP  272

Query  412  ETSTANETKTPTPKSVGFGED  350
             T    E KT T   +G  E+
Sbjct  273  GTKQVEEKKTVT---IGISEN  290


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKGFG KM+ KMG+ +G GLGK+ QGI API A  RPK  G+G
Sbjct  213  GQFEKFTKGFGMKMLEKMGY-KGGGLGKNEQGIVAPIQAQLRPKKMGMG  260



>ref|XP_005645320.1| hypothetical protein COCSUDRAFT_57335 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20776.1| hypothetical protein COCSUDRAFT_57335 [Coccomyxa subellipsoidea 
C-169]
Length=582

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGF--TGGGLGKDGQGIAEPIQVSQRPKALGLGAD  419
             V +S  +G+FE HTTGFGS+M+ K GF   G GLG++ QG AEPI    RPK LGLGA+
Sbjct  521  IVETSLRFGSFERHTTGFGSRMLAKYGFEGQGAGLGRNSQGRAEPINAVMRPKNLGLGAN  580


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGSFE HT GFGS+M+AK GF  +G GLG++SQG   PI A  RPK+ GLGA
Sbjct  528  FGSFERHTTGFGSRMLAKYGFEGQGAGLGRNSQGRAEPINAVMRPKNLGLGA  579



>ref|XP_010906679.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Elaeis guineensis]
Length=864

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FENHTKG G K++  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  197  GKFENHTKGIGMKLLKLMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  245


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 7/94 (7%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG-  425
            ++ V+ + + G FE HT G G K++  MG+  G GLGK+ QGI  PI+   RPK +G+G 
Sbjct  187  RRDVTGTEDIGKFENHTKGIGMKLLKLMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMGF  246

Query  424  -----ADVPETSTANETKTPTPKSVGFGEDLPTR  338
                 A +P    A   +     SV  G     R
Sbjct  247  NDYKEAKLPVLEEAVPQEKAAANSVAVGRSREKR  280



>ref|XP_006679437.1| hypothetical protein BATDEDRAFT_25372 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79675.1| hypothetical protein BATDEDRAFT_25372 [Batrachochytrium dendrobatidis 
JAM81]
Length=1036

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            F +FE HTKGFGSKM+AKMG+V GTGLG +  GI API    RP   GLG
Sbjct  282  FATFERHTKGFGSKMLAKMGYVPGTGLGANRVGIIAPIDVKLRPSGMGLG  331


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            N+  FE HT GFGSKM+ KMG+  G GLG +  GI  PI V  RP  +GLG
Sbjct  281  NFATFERHTKGFGSKMLAKMGYVPGTGLGANRVGIIAPIDVKLRPSGMGLG  331



>gb|KJB44347.1| hypothetical protein B456_007G247300 [Gossypium raimondii]
Length=853

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------AD  419
            + + G+FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A 
Sbjct  187  NGDVGSFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAK  246

Query  418  VPETSTANETKTPTPKSVG  362
            +P      E K+ + + VG
Sbjct  247  LPGLQQLEEKKSVSQQPVG  265


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  238



>gb|KHG03685.1| Tuftelin-interacting 11 [Gossypium arboreum]
 gb|KHG18046.1| Tuftelin-interacting 11 [Gossypium arboreum]
Length=853

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------AD  419
            + + G+FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A 
Sbjct  187  NGDVGSFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAK  246

Query  418  VPETSTANETKTPTPKSVG  362
            +P      E K+ + + VG
Sbjct  247  LPGLQQLEEKKSVSQQPVG  265


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  238



>gb|KJB73095.1| hypothetical protein B456_011G214400, partial [Gossypium raimondii]
Length=616

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 6/84 (7%)
 Frame = -3

Query  595  KCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG---  425
            K    + + G+FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G   
Sbjct  66   KAGGGNGDVGSFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFND  125

Query  424  ---ADVPETSTANETKTPTPKSVG  362
               A +P      E K+ + + VG
Sbjct  126  FKEAKLPGLQQLEERKSVSQQPVG  149


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  75   GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  122



>ref|XP_003080235.1| Tuftelin-interacting protein TIP39, contains G-patch domain (ISS) 
[Ostreococcus tauri]
Length=230

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGF--TGGGLGKDGQGIAEPIQVSQRPKALGLGA  422
             V +   YGAFE HTTGFGS+M+ KMGF   G G+G++G GIAEP+    R K +GLGA
Sbjct  167  VVGAGHEYGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  225


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  125
            +G+FE HT GFGS+M+AKMGF  +G+G+G++  GI  P+ A  R K  GLGA
Sbjct  174  YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  225



>emb|CDQ06825.1| Protein Bm9097, isoform a [Brugia malayi]
Length=434

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 65/148 (44%), Gaps = 27/148 (18%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  398
            + G +E HT G G K+++KMG+  G GLG+   GI   IQ    PK      D+  TS+ 
Sbjct  175  DIGDWEKHTRGIGMKLLLKMGYRAGEGLGRKSDGIVHAIQPVIFPKNEAATNDLA-TSSW  233

Query  397  NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  218
             E K     +V  G+                          G +E HT+G G K++ KMG
Sbjct  234  KEYKQERRGNVTIGD-------------------------IGDWEKHTRGIGMKLLLKMG  268

Query  217  FVEGTGLGKDSQGITAPILATRRPKSQG  134
            +  G GLG+ S GI   I     PK + 
Sbjct  269  YRAGEGLGRKSDGIVHAIQPVIFPKKKN  296



>ref|XP_008804692.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
 ref|XP_008804693.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
 ref|XP_008804694.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
Length=868

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE+HTKG G K++  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  201  GKFESHTKGIGLKLLKMMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  249


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 7/94 (7%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG-  425
            ++ V+ +   G FE HT G G K++  MG+  G GLGK+ QGI  PI+   RPK +G+G 
Sbjct  191  RRDVTGTDEIGKFESHTKGIGLKLLKMMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMGF  250

Query  424  -----ADVPETSTANETKTPTPKSVGFGEDLPTR  338
                 A +P    A   +     SV  G     R
Sbjct  251  NDYKEAKLPVLEEAVLQEKAAANSVAVGRSREKR  284



>emb|CEF98642.1| G-patch domain [Ostreococcus tauri]
Length=390

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -3

Query  592  CVSSSXNYGAFELHTTGFGSKMMVKMGF--TGGGLGKDGQGIAEPIQVSQRPKALGLGA  422
             V +   YGAFE HTTGFGS+M+ KMGF   G G+G++G GIAEP+    R K +GLGA
Sbjct  327  VVGAGHEYGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  385


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  125
            +G+FE HT GFGS+M+AKMGF  +G+G+G++  GI  P+ A  R K  GLGA
Sbjct  334  YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  385



>gb|KDP39564.1| hypothetical protein JCGZ_02584 [Jatropha curcas]
Length=870

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST  401
            S + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +      
Sbjct  195  SGDVGEFEKHTKGIGFKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFN-----D  249

Query  400  ANETKTPTPKSV  365
              E K P P+ +
Sbjct  250  FKEAKLPQPEEI  261


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  199  GEFEKHTKGIGFKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  246



>ref|XP_009397719.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=850

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K+M  MG+ EG+GLGK  QGI AP+ A  RPK+ G+G
Sbjct  185  GKFEVHTKGIGLKLMKMMGYKEGSGLGKSEQGIVAPVEAKLRPKNMGMG  233


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG-  425
            ++  SS+ + G FE+HT G G K+M  MG+  G GLGK  QGI  P++   RPK +G+G 
Sbjct  175  RRSGSSADDVGKFEVHTKGIGLKLMKMMGYKEGSGLGKSEQGIVAPVEAKLRPKNMGMGF  234

Query  424  ADVPETSTANETKTPTPKS  368
             D  E       + P  K+
Sbjct  235  NDYKEAKLPAVDEAPREKA  253



>ref|XP_005850261.1| hypothetical protein CHLNCDRAFT_50559 [Chlorella variabilis]
 gb|EFN58159.1| hypothetical protein CHLNCDRAFT_50559 [Chlorella variabilis]
Length=915

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G+K++AKMG+ EG GLG+D +GI+ P+ A  RPK  G+G
Sbjct  256  GKFEAHTKGIGAKLLAKMGWAEGEGLGRDRRGISKPLEAKLRPKGMGMG  304


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  425
            K  V    + G FE HT G G+K++ KMG+  G GLG+D +GI++P++   RPK +G+G
Sbjct  246  KAAVGPKADVGKFEAHTKGIGAKLLAKMGWAEGEGLGRDRRGISKPLEAKLRPKGMGMG  304



>ref|XP_010256250.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Nelumbo nucifera]
Length=849

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 6/73 (8%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------  425
            S   + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      
Sbjct  184  SEFGDVGQFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVTPIEAKLRPKNMGMGFNDYKE  243

Query  424  ADVPETSTANETK  386
            A +P    A E K
Sbjct  244  ASLPAVEEAEEKK  256


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI  PI A  RPK+ G+G
Sbjct  190  GQFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVTPIEAKLRPKNMGMG  237



>ref|XP_002325453.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
 gb|EEE99834.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
Length=690

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 11/81 (14%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------  425
            +   + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      
Sbjct  14   AKDGDVGEFERHTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAKMRPKNMGMGFNDFKE  73

Query  424  --ADVP---ETSTANETKTPT  377
              A +P   ET T ++ ++ T
Sbjct  74   ASAKLPQLQETETVSQRQSQT  94


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  20   GEFERHTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAKMRPKNMGMG  67



>sp|Q0IIX9.2|TFP11_XENTR RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Xenopus 
(Silurana) tropicalis]
 gb|ABC69924.1| STIP [Xenopus (Silurana) tropicalis]
Length=825

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V+G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            + S+ ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  132  IKSNTDFGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188



>ref|NP_001090845.1| tuftelin-interacting protein 11 [Xenopus (Silurana) tropicalis]
 gb|AAI21498.1| LOC100038256 protein [Xenopus (Silurana) tropicalis]
Length=825

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V+G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            + S+ ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  132  IKSNTDFGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188



>ref|XP_010459271.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Camelina sativa]
Length=851

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            S + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+V  RPK +G+G  D  E  
Sbjct  190  SNDIGQFEKSTKGIGMKLLEKMGYQGGGLGKNQQGIVAPIEVQLRPKNMGMGYNDFKEAK  249

Query  403  TANETKTPTPKSVG  362
              +  K    K VG
Sbjct  250  LPDLNKVEEKKIVG  263


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API    RPK+ G+G
Sbjct  194  GQFEKSTKGIGMKLLEKMGY-QGGGLGKNQQGIVAPIEVQLRPKNMGMG  241



>ref|XP_002501462.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62720.1| predicted protein [Micromonas sp. RCC299]
Length=1485

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = -3

Query  595   KCVSSSXNYGAFELHTTGFGSKMMVKMGFT--GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
             + V +  ++GAFE HT+GFGS+M+ KMGF   G G+GKDG+GI+EPI  S R K +GLGA
Sbjct  1423  RVVGAGHSFGAFEAHTSGFGSRMLAKMGFQGEGAGMGKDGRGISEPIAASIRGKRVGLGA  1482

Query  421   D  419
             +
Sbjct  1483  E  1483


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  277   FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             FG+FE HT GFGS+M+AKMGF  EG G+GKD +GI+ PI A+ R K  GLGA+
Sbjct  1431  FGAFEAHTSGFGSRMLAKMGFQGEGAGMGKDGRGISEPIAASIRGKRVGLGAE  1483



>gb|KFK43898.1| hypothetical protein AALP_AA1G188300 [Arabis alpina]
Length=846

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG--  425
            KK      + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  
Sbjct  175  KKATLGGGDIGKFEKSTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYN  234

Query  424  ----ADVPETSTANETKT  383
                A +P+     E KT
Sbjct  235  DFKEAKLPDLKKVEEKKT  252


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  185  GKFEKSTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  232



>ref|XP_001773432.1| predicted protein [Physcomitrella patens]
 gb|EDQ61805.1| predicted protein [Physcomitrella patens]
Length=834

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  565  AFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTA  398
            +FE+ T G GSK++ KMG+ GGGLGK+ QGIA+PI+   RPK +G+G  +  ETST 
Sbjct  179  SFEMFTRGIGSKLLEKMGYKGGGLGKNEQGIAQPIEAKLRPKNMGMGFNEFRETSTG  235


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -3

Query  271  SFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            SFE  T+G GSK++ KMG+ +G GLGK+ QGI  PI A  RPK+ G+G
Sbjct  179  SFEMFTRGIGSKLLEKMGY-KGGGLGKNEQGIAQPIEAKLRPKNMGMG  225



>ref|XP_011098023.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Sesamum indicum]
Length=859

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  425
            GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  190  GAFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPIEAKMRPKNMGMG  237


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  280  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  188  GVGAFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPIEAKMRPKNMGMG  237



>ref|XP_005649692.1| TFP11-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25148.1| TFP11-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=862

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  283  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            P  G FE HTKG G+K++A MG+ EG GLG++ QGI+ PI    RPK  G+G
Sbjct  195  PSVGEFERHTKGIGAKLLAGMGYKEGEGLGRNRQGISKPIEVKLRPKGMGMG  246


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 8/67 (12%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGAD-------VP  413
            G FE HT G G+K++  MG+  G GLG++ QGI++PI+V  RPK +G+G +       +P
Sbjct  198  GEFERHTKGIGAKLLAGMGYKEGEGLGRNRQGISKPIEVKLRPKGMGMGYNDYEEHKLIP  257

Query  412  ETSTANE  392
            +   A E
Sbjct  258  DEKPAEE  264



>ref|XP_010670678.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670679.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670680.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670681.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
Length=858

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  425
            N G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  197  NVGGFERHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMG  246


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  199  GGFERHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  246



>ref|XP_002524028.1| tuftelin interacting protein, putative [Ricinus communis]
 gb|EEF38396.1| tuftelin interacting protein, putative [Ricinus communis]
Length=883

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ETS
Sbjct  207  DVGEFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPIEAKLRPKNMGMGFNDYKETS  264


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  209  GEFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPIEAKLRPKNMGMG  256



>ref|XP_009399051.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=853

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G F+++TKG G K+M  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  188  GKFQSYTKGIGFKLMKMMGYKEGSGLGKNEQGIVAPIEAKLRPKNMGMG  236


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  425
            K+ VS +   G F+ +T G G K+M  MG+  G GLGK+ QGI  PI+   RPK +G+G
Sbjct  178  KRDVSGADEIGKFQSYTKGIGFKLMKMMGYKEGSGLGKNEQGIVAPIEAKLRPKNMGMG  236



>ref|XP_007029764.1| GC-rich sequence DNA-binding factor-like protein with Tuftelin 
interacting domain [Theobroma cacao]
 gb|EOY10266.1| GC-rich sequence DNA-binding factor-like protein with Tuftelin 
interacting domain [Theobroma cacao]
Length=859

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -3

Query  562  FELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPETST  401
            FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P    
Sbjct  193  FEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKEAKLPGLQQ  252

Query  400  ANETKTPTPKSVG  362
             +E K+   + VG
Sbjct  253  LDEKKSVNQQPVG  265


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  268  FENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  193  FEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  238



>ref|XP_008339239.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11-like [Malus domestica]
Length=875

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTANE  392
            GAFE HT G G KM+  MG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ET    E
Sbjct  203  GAFEKHTKGIGMKMLKNMGYKGGGLGKNEQGILAPIEAKLRPKNMGMGFNDYKET----E  258

Query  391  TKTPT  377
             K P+
Sbjct  259  VKRPS  263


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  280  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G G+FE HTKG G KM+  MG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  201  GLGAFEKHTKGIGMKMLKNMGY-KGGGLGKNEQGILAPIEAKLRPKNMGMG  250



>emb|CDP06007.1| unnamed protein product [Coffea canephora]
Length=847

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + G+FE HT G G +++ KMG+ GGGLGK+ QGI  PIQ   RPK +G+G  D  ET+
Sbjct  187  DVGSFEKHTKGIGLRLLEKMGYKGGGLGKNEQGIVSPIQAKLRPKNMGMGFNDYKETN  244


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -3

Query  283  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            PG  GSFE HTKG G +++ KMG+ +G GLGK+ QGI +PI A  RPK+ G+G
Sbjct  185  PGDVGSFEKHTKGIGLRLLEKMGY-KGGGLGKNEQGIVSPIQAKLRPKNMGMG  236



>ref|XP_009861899.1| PREDICTED: sip1/TFIP11 interacting protein isoform X1 [Ciona 
intestinalis]
 ref|XP_009861900.1| PREDICTED: sip1/TFIP11 interacting protein isoform X1 [Ciona 
intestinalis]
Length=826

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            F SFE HT+G G K++ KMG+  G GLGK +QGI  PI A +R K  GLGA
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -3

Query  571  YGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            + +FE HT G G K++ KMG+  G GLGK  QGI  PI+  +R K  GLGA   E +  +
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGAAGTERTKQS  203

Query  394  ETKTPTPKS  368
                P   S
Sbjct  204  YIHFPMQDS  212



>ref|NP_001091088.1| Sip1/TFIP11 interacting protein [Ciona intestinalis]
 gb|ABC69930.1| STIP [Ciona intestinalis]
Length=832

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            F SFE HT+G G K++ KMG+  G GLGK +QGI  PI A +R K  GLGA
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -3

Query  571  YGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            + +FE HT G G K++ KMG+  G GLGK  QGI  PI+  +R K  GLGA   E +  +
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGAAGTERTKQS  203

Query  394  ETKTPTPKS  368
                P   S
Sbjct  204  YIHFPMQDS  212



>ref|XP_002949572.1| hypothetical protein VOLCADRAFT_89953 [Volvox carteri f. nagariensis]
 gb|EFJ49591.1| hypothetical protein VOLCADRAFT_89953 [Volvox carteri f. nagariensis]
Length=1107

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -3

Query  601   EKKCVSS-SXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGL  428
             E  C +S S  Y +FE H TG GS++M +MG++ G GLG+D QG AEP++   RPK+LGL
Sbjct  1029  ETACPASLSYEYASFERHGTGIGSRLMARMGWSAGDGLGRDRQGRAEPLRAFIRPKSLGL  1088

Query  427   GAD  419
             GA+
Sbjct  1089  GAE  1091


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  277   FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
             + SFE H  G GS++MA+MG+  G GLG+D QG   P+ A  RPKS GLGA+
Sbjct  1040  YASFERHGTGIGSRLMARMGWSAGDGLGRDRQGRAEPLRAFIRPKSLGLGAE  1091



>emb|CDY21767.1| BnaA09g45180D [Brassica napus]
Length=809

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPET  407
            G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P+ 
Sbjct  158  GKFEKATKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAKLPDL  217

Query  406  STANETKTPT  377
                E KT T
Sbjct  218  KKVEEKKTVT  227


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  158  GKFEKATKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  205



>emb|CBI26422.3| unnamed protein product [Vitis vinifera]
Length=739

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 5/77 (6%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            + G FE  T G G K+M KMG+TGGGLGK+ QGI  PI+   RPK +G+G +        
Sbjct  108  DVGRFEKFTKGIGMKLMEKMGYTGGGLGKNEQGIVAPIEAKLRPKNMGMGFN-----DYK  162

Query  394  ETKTPTPKSVGFGEDLP  344
            ETK P  +     + LP
Sbjct  163  ETKLPALQEPEEKKSLP  179


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K+M KMG+  G GLGK+ QGI API A  RPK+ G+G
Sbjct  110  GRFEKFTKGIGMKLMEKMGYT-GGGLGKNEQGIVAPIEAKLRPKNMGMG  157



>ref|XP_010094613.1| Tuftelin-interacting protein 11 [Morus notabilis]
 gb|EXB56432.1| Tuftelin-interacting protein 11 [Morus notabilis]
Length=940

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  425
            S    G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  289  SGAAVGGFEKHTKGIGMKLLEKMGYKGGGLGKNAQGIVAPIEAKLRPKNMGMG  341


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK++QGI API A  RPK+ G+G
Sbjct  294  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNAQGIVAPIEAKLRPKNMGMG  341



>ref|XP_010498050.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Camelina sativa]
Length=853

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+V  RPK +G+G  D  E  
Sbjct  192  AGDIGQFEKSTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEVQLRPKNMGMGYNDFKEAK  251

Query  403  TANETKTPTPKSVG  362
              +  K    K VG
Sbjct  252  LPDLKKVEEKKIVG  265


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API    RPK+ G+G
Sbjct  196  GQFEKSTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEVQLRPKNMGMG  243



>ref|XP_009117727.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Brassica rapa]
Length=837

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPET  407
            G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P+ 
Sbjct  186  GKFEKATKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAKLPDL  245

Query  406  STANETKTPT  377
                E KT T
Sbjct  246  KKVEEKKTVT  255


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  186  GKFEKATKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  233



>ref|XP_002506795.1| hypothetical protein MICPUN_113307 [Micromonas sp. RCC299]
 gb|ACO68053.1| hypothetical protein MICPUN_113307 [Micromonas sp. RCC299]
Length=788

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  283  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            P  G FE HTKG G K++ KMG+ +G GLGKD +G+ AP+    RPK+ G+G K
Sbjct  48   PKLGEFEKHTKGIGMKLLEKMGYKKGMGLGKDGKGMAAPMETQMRPKNMGMGFK  101


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  425
            G FE HT G G K++ KMG+  G GLGKDG+G+A P++   RPK +G+G
Sbjct  51   GEFEKHTKGIGMKLLEKMGYKKGMGLGKDGKGMAAPMETQMRPKNMGMG  99



>ref|XP_007058458.1| PREDICTED: tuftelin-interacting protein 11 [Chelonia mydas]
Length=776

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA   E 
Sbjct  134  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGAYGSER  193

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  194  TSQSLQDFPVVDS  206



>ref|XP_005298544.1| PREDICTED: tuftelin-interacting protein 11 [Chrysemys picta bellii]
Length=827

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA   E 
Sbjct  134  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGAYGSER  193

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  194  TSQSLQDFPVVDS  206



>ref|XP_006137534.1| PREDICTED: tuftelin-interacting protein 11 [Pelodiscus sinensis]
Length=872

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  183  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  233


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA   E 
Sbjct  179  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGAYGSER  238

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  239  TTQSLQDFPVVDS  251



>ref|XP_009801630.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Nicotiana sylvestris]
 ref|XP_009801631.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Nicotiana sylvestris]
 ref|XP_009801632.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Nicotiana sylvestris]
Length=860

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS
Sbjct  190  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETS  247


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  192  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  239



>ref|XP_009616302.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009616309.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009616317.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009616324.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
Length=860

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS
Sbjct  190  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETS  247


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  192  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  239



>ref|XP_009616253.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616260.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616266.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616273.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616280.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616288.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616296.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS
Sbjct  205  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETS  262


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  207  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  254



>ref|XP_009603610.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Nicotiana tomentosiformis]
Length=860

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS
Sbjct  190  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETS  247


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  192  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  239



>gb|EMP37184.1| Tuftelin-interacting protein 11 [Chelonia mydas]
Length=1157

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  506  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  556


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA   E 
Sbjct  502  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGAYGSER  561

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  562  TSQSLQDFPVVDS  574



>ref|XP_010528677.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Tarenaya hassleriana]
Length=880

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            S   G FE  T GFG KM+ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  E+S
Sbjct  208  SGEVGQFEKFTKGFGMKMLEKMGYKGGGLGKNEQGIVAPVEAQLRPKNMGMGYKDFKESS  267


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  122
            G FE  TKGFG KM+ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G K
Sbjct  212  GQFEKFTKGFGMKMLEKMGY-KGGGLGKNEQGIVAPVEAQLRPKNMGMGYK  261



>ref|XP_001781004.1| predicted protein [Physcomitrella patens]
 gb|EDQ54188.1| predicted protein [Physcomitrella patens]
Length=835

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -3

Query  562  FELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTA  398
            FE+ T G GSK++ KMG+ GGGLGK+ QGIA+PI+   RPK +G+G  +  ET+T 
Sbjct  180  FEMFTRGIGSKLLEKMGYKGGGLGKNEQGIAQPIEAKLRPKNMGMGFNEFRETATG  235


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -3

Query  271  SFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            +FE  T+G GSK++ KMG+ +G GLGK+ QGI  PI A  RPK+ G+G
Sbjct  179  TFEMFTRGIGSKLLEKMGY-KGGGLGKNEQGIAQPIEAKLRPKNMGMG  225



>ref|XP_003080850.1| Tuftelin-interacting protein TIP39, contains G-patch domain (ISS) 
[Ostreococcus tauri]
 emb|CAL55018.1| G-patch domain [Ostreococcus tauri]
Length=328

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  280  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            G G+FE HT+GFGS+++A+ GF  G+GLG+++QGI  P+ A  R K  GLGA
Sbjct  277  GMGAFEAHTRGFGSRILARFGFKPGSGLGRENQGIVEPLSAETRAKRAGLGA  328


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -3

Query  586  SSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            S+S   GAFE HT GFGS+++ + GF  G GLG++ QGI EP+    R K  GLGA
Sbjct  273  SASDGMGAFEAHTRGFGSRILARFGFKPGSGLGRENQGIVEPLSAETRAKRAGLGA  328



>ref|XP_006836389.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda]
 gb|ERM99242.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda]
Length=877

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            + G FE HT G G +++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +  E  +  
Sbjct  197  DVGEFEKHTKGIGMRLLEKMGYKGGGLGKNAQGIVAPIEAKLRPKNMGMGYNSYEEKSMG  256

Query  394  ETKTP  380
                P
Sbjct  257  LAPLP  261


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G +++ KMG+ +G GLGK++QGI API A  RPK+ G+G
Sbjct  199  GEFEKHTKGIGMRLLEKMGY-KGGGLGKNAQGIVAPIEAKLRPKNMGMG  246



>gb|ABC69931.1| STIP [Ciona savignyi]
Length=820

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            F SFE HTKG G K++ KMG+  G GLGK +QGI  P+ A +R K  GLG+
Sbjct  141  FASFERHTKGIGMKLLTKMGYRHGRGLGKGNQGIINPVEAIKRNKKAGLGS  191


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = -3

Query  571  YGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            + +FE HT G G K++ KMG+  G GLGK  QGI  P++  +R K  GLG+   E +  +
Sbjct  141  FASFERHTKGIGMKLLTKMGYRHGRGLGKGNQGIINPVEAIKRNKKAGLGSGGSERTKQS  200

Query  394  ETKTPTPKS  368
                PT  S
Sbjct  201  YIHFPTEDS  209



>ref|XP_001968838.1| GG25092 [Drosophila erecta]
 gb|EDV57897.1| GG25092 [Drosophila erecta]
Length=839

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGAYGP  213

Query  412  ETSTANETKTPTPKSVGFGEDL  347
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  161  GAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGA  210



>ref|XP_007443812.1| PREDICTED: tuftelin-interacting protein 11 [Python bivittatus]
Length=741

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  49   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKAAIGA  99


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  45   SFTDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKAAIGAYGSER  104

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  105  TTQSLQDFPIVDS  117



>ref|XP_002037985.1| Sip1-TFIP11 interacting protein [Drosophila sechellia]
 gb|ABC69936.1| STIP [Drosophila sechellia]
 gb|EDW54403.1| Sip1-TFIP11 interacting protein [Drosophila sechellia]
Length=839

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGAYGP  213

Query  412  ETSTANETKTPTPKSVGFGEDL  347
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 38/143 (27%), Positives = 65/143 (45%), Gaps = 14/143 (10%)
 Frame = -3

Query  517  MGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLP--  344
            + F  GG+ + G+   + +Q      +   GAD  +   ++++      +  FG ++P  
Sbjct  70   VNFVAGGIQQSGKKKKKALQADDEKGSQKEGADADQGEQSDDSDASGRPA--FGRNVPGS  127

Query  343  ----------TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLG  194
                      T  RK      Q +         G++E HT+G G+K++ +MG+  G GLG
Sbjct  128  SNSSSEEERPTLGRKQPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLG  187

Query  193  KDSQGITAPILATRRPKSQGLGA  125
            KD QGI+ P+ A  R     +GA
Sbjct  188  KDLQGISQPVQAHVRKGRGAIGA  210



>ref|XP_006261823.1| PREDICTED: tuftelin-interacting protein 11 [Alligator mississippiensis]
Length=828

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI +PI A +R     +GA
Sbjct  139  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGA  189


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  135  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGAYGSER  194

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  195  TSQSLQDFPVVDS  207



>gb|EPS61679.1| hypothetical protein M569_13115, partial [Genlisea aurea]
Length=782

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  280  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G GSF  HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  153  GVGSFGKHTKGIGLKLLEKMGY-KGGGLGKNEQGIIAPIEAKLRPKNMGMG  202


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  425
            G+F  HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  155  GSFGKHTKGIGLKLLEKMGYKGGGLGKNEQGIIAPIEAKLRPKNMGMG  202



>ref|XP_006015340.1| PREDICTED: tuftelin-interacting protein 11 [Alligator sinensis]
Length=853

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI +PI A +R     +GA
Sbjct  164  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGA  214


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  160  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGAYGSER  219

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  220  TSQSLQDFPVVDS  232



>ref|XP_006352537.1| PREDICTED: tuftelin-interacting protein 11-like [Solanum tuberosum]
Length=868

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTA  398
            + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ETS+A
Sbjct  196  DVGGFEKFTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKKMGMGFNDYKETSSA  255


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK  G+G
Sbjct  198  GGFEKFTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKKMGMG  245



>emb|CDX81801.1| BnaC08g38000D [Brassica napus]
Length=777

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -3

Query  568  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPET  407
            G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P+ 
Sbjct  126  GKFEKATKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAKLPDL  185

Query  406  STANETKTPT  377
                E K+ T
Sbjct  186  KKVEEKKSVT  195


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  126  GKFEKATKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  173



>gb|EHB00444.1| G patch domain-containing protein 2, partial [Heterocephalus 
glaber]
Length=527

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 5/60 (8%)
 Frame = -3

Query  544  GFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKS  368
              G++M+  MG+T G GLG+DG+GIAEPIQ  QRP+ LGLG  +P++++A    TPTP S
Sbjct  469  NIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPRGLGLGFPLPKSTSA----TPTPAS  524



>ref|XP_004880608.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004867444.1| PREDICTED: G patch domain-containing protein 2 [Heterocephalus 
glaber]
Length=528

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 5/60 (8%)
 Frame = -3

Query  544  GFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKS  368
              G++M+  MG+T G GLG+DG+GIAEPIQ  QRP+ LGLG  +P++++A    TPTP S
Sbjct  469  NIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPRGLGLGFPLPKSTSA----TPTPAS  524



>ref|XP_008140712.1| PREDICTED: tuftelin-interacting protein 11 [Eptesicus fuscus]
Length=837

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_006102063.1| PREDICTED: tuftelin-interacting protein 11 [Myotis lucifugus]
Length=837

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_005869775.1| PREDICTED: tuftelin-interacting protein 11 [Myotis brandtii]
 gb|EPQ09886.1| Tuftelin-interacting protein 11 [Myotis brandtii]
Length=837

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_006762106.1| PREDICTED: tuftelin-interacting protein 11 [Myotis davidii]
 gb|ELK31482.1| Tuftelin-interacting protein 11 [Myotis davidii]
Length=837

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_004248294.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Solanum lycopersicum]
Length=867

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPET  407
            +  + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ET
Sbjct  192  TGGDVGGFEKFTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDYKET  251

Query  406  STA  398
            S+A
Sbjct  252  SSA  254


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  GGFEKFTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  244



>gb|ABC69949.1| STIP [Chlamydomonas reinhardtii]
Length=844

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  283  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK  GLG
Sbjct  182  PTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  233


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  425
            +S+   +  FE HT G G K++ KMG+  G GLG++ QGIA P++   RPK +GLG
Sbjct  178  LSTDPTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  233



>ref|XP_006306528.1| hypothetical protein CARUB_v10012542mg [Capsella rubella]
 gb|EOA39426.1| hypothetical protein CARUB_v10012542mg [Capsella rubella]
Length=860

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  580  SXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  404
            + + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  E  
Sbjct  194  AGDIGKFEKSTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAK  253

Query  403  TANETKTPTPKSVG  362
              +  K    K VG
Sbjct  254  LPDLKKVEEKKVVG  267


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  198  GKFEKSTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  245



>ref|XP_010662048.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Vitis vinifera]
Length=863

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 5/77 (6%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  395
            + G FE  T G G K+M KMG+TGGGLGK+ QGI  PI+   RPK +G+G +        
Sbjct  190  DVGRFEKFTKGIGMKLMEKMGYTGGGLGKNEQGIVAPIEAKLRPKNMGMGFN-----DYK  244

Query  394  ETKTPTPKSVGFGEDLP  344
            ETK P  +     + LP
Sbjct  245  ETKLPALQEPEEKKSLP  261


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE  TKG G K+M KMG+  G GLGK+ QGI API A  RPK+ G+G
Sbjct  192  GRFEKFTKGIGMKLMEKMGYT-GGGLGKNEQGIVAPIEAKLRPKNMGMG  239



>ref|XP_007151865.1| hypothetical protein PHAVU_004G082100g [Phaseolus vulgaris]
 gb|ESW23859.1| hypothetical protein PHAVU_004G082100g [Phaseolus vulgaris]
Length=871

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 42/80 (53%), Gaps = 8/80 (10%)
 Frame = -3

Query  604  HEKKCVSSSXNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  425
            H+      S + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   R K  G+G
Sbjct  185  HQSSVQDGSSDVGKFEKHTKGIGMKLLEKMGYKGGGLGKNKQGIVAPIEAKLRAKNSGIG  244

Query  424  ADVPETSTANETKTPTPKSV  365
                     NE+K   P  V
Sbjct  245  --------FNESKETMPLPV  256


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  R K+ G+G
Sbjct  197  GKFEKHTKGIGMKLLEKMGY-KGGGLGKNKQGIVAPIEAKLRAKNSGIG  244



>ref|XP_002089187.1| Sip1-TFIP11 interacting protein [Drosophila yakuba]
 gb|ABC69937.1| STIP [Drosophila yakuba]
 gb|EDW88899.1| Sip1-TFIP11 interacting protein [Drosophila yakuba]
Length=839

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGAYGP  213

Query  412  ETSTANETKTPTPKSVGFGEDL  347
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  161  GAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGA  210



>gb|EOB05036.1| Tuftelin-interacting protein 11, partial [Anas platyrhynchos]
Length=710

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  21   FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  71


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  398
            ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E ++ 
Sbjct  20   DFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSERTSQ  79

Query  397  NETKTPTPKS  368
            +    P   S
Sbjct  80   SLQDFPVVDS  89



>ref|XP_004615574.1| PREDICTED: tuftelin-interacting protein 11 [Sorex araneus]
Length=837

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIVNPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIVNPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_001702893.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96850.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=786

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  283  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK  GLG
Sbjct  99   PTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  150


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  425
            +S+   +  FE HT G G K++ KMG+  G GLG++ QGIA P++   RPK +GLG
Sbjct  95   LSTDPTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  150



>ref|XP_005014621.1| PREDICTED: tuftelin-interacting protein 11 [Anas platyrhynchos]
Length=765

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  76   FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  126


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query  574  NYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  398
            ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E ++ 
Sbjct  75   DFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSERTSQ  134

Query  397  NETKTPTPKS  368
            +    P   S
Sbjct  135  SLQDFPVVDS  144



>ref|XP_010081004.1| PREDICTED: tuftelin-interacting protein 11 [Pterocles gutturalis]
Length=771

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  82   FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  132


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  78   SFVDFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  137

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  138  TSQSLQDFPVVDS  150



>ref|XP_002078265.1| GD23359 [Drosophila simulans]
 gb|EDX03850.1| GD23359 [Drosophila simulans]
Length=751

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGAYGP  213

Query  412  ETSTANETKTPTPKSVGFGEDL  347
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 38/143 (27%), Positives = 65/143 (45%), Gaps = 14/143 (10%)
 Frame = -3

Query  517  MGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLP--  344
            + F  GG+ + G+   + +Q      +   GAD  +   ++++      +  FG ++P  
Sbjct  70   VNFVAGGIQQSGKKKKKALQADDEKGSQKEGADADQGEQSDDSDASGRPA--FGRNVPGS  127

Query  343  ----------TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLG  194
                      T  RK      Q +         G++E HT+G G+K++ +MG+  G GLG
Sbjct  128  SNSSSEEERPTLGRKQPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLG  187

Query  193  KDSQGITAPILATRRPKSQGLGA  125
            KD QGI+ P+ A  R     +GA
Sbjct  188  KDLQGISQPVQAHVRKGRGAIGA  210



>ref|XP_003761206.1| PREDICTED: tuftelin-interacting protein 11 [Sarcophilus harrisii]
Length=834

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  141  FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  191


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  137  SFTDFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  196

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  197  TTQSVQDFPVVDS  209



>gb|KFV01223.1| Tuftelin-interacting protein 11, partial [Pterocles gutturalis]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|AAF26743.1|AF221101_1 septin interacting protein [Drosophila melanogaster]
Length=839

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI+ P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGAYGP  213

Query  412  ETSTANETKTPTPKSVGFGEDL  347
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  161  GAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGA  210



>ref|XP_010208491.1| PREDICTED: tuftelin-interacting protein 11, partial [Colius striatus]
Length=633

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  58   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  108


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  54   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  113

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  114  TTQSLQDFPVVDS  126



>gb|KFP23981.1| Tuftelin-interacting protein 11, partial [Colius striatus]
Length=644

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  128  TTQSLQDFPVVDS  140



>ref|NP_524725.2| septin interacting protein 1, isoform A [Drosophila melanogaster]
 ref|NP_001285636.1| septin interacting protein 1, isoform B [Drosophila melanogaster]
 sp|Q9Y103.1|TFP11_DROME RecName: Full=Septin-interacting protein 1; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Drosophila 
melanogaster]
 gb|AAD38645.1|AF145670_1 BcDNA.GH11690 [Drosophila melanogaster]
 gb|AAF52282.1| septin interacting protein 1, isoform A [Drosophila melanogaster]
 gb|ACL89377.1| sip1-PA [synthetic construct]
 gb|AHN54151.1| septin interacting protein 1, isoform B [Drosophila melanogaster]
Length=839

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  413
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI+ P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGAYGP  213

Query  412  ETSTANETKTPTPKSVGFGEDL  347
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  161  GAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGA  210



>ref|XP_004479136.1| PREDICTED: tuftelin-interacting protein 11 [Dasypus novemcinctus]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|NP_001087642.1| tuftelin-interacting protein 11 [Xenopus laevis]
 sp|Q66J74.1|TFP11_XENLA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Xenopus 
laevis]
 gb|AAH81033.1| MGC81713 protein [Xenopus laevis]
 gb|ABC69925.1| STIP [Xenopus laevis]
Length=824

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG++ G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYMPGRGLGKNAQGIIAPIEAKQRRGKGAVGA  188


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -3

Query  589  VSSSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            + S+ ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  132  IKSNTDFGSWERHTKGIGQKLLQKMGYMPGRGLGKNAQGIIAPIEAKQRRGKGAVGA  188



>ref|NP_001091078.1| tuftelin-interacting protein 11 [Monodelphis domestica]
 ref|XP_007490114.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Monodelphis 
domestica]
 ref|XP_007490115.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Monodelphis 
domestica]
 sp|A4UMC6.1|TFP11_MONDO RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Monodelphis 
domestica]
 gb|ABP04113.1| septin and tuftelin-interacting protein 1 [Monodelphis domestica]
Length=834

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  141  FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  191


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  137  SFTDFGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  196

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  197  TTQSVQDFPVVDS  209



>gb|KFQ79462.1| Tuftelin-interacting protein 11, partial [Phoenicopterus ruber 
ruber]
Length=710

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  21   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  71


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  17   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  76

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  77   TSQSLQDFPVVDS  89



>ref|XP_009490572.1| PREDICTED: tuftelin-interacting protein 11 [Pelecanus crispus]
Length=739

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  50   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  100


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  46   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  105

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  106  TSQSLQDFPVVDS  118



>gb|KFV72048.1| Tuftelin-interacting protein 11, partial [Struthio camelus australis]
Length=760

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  68   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122



>ref|XP_010131846.1| PREDICTED: tuftelin-interacting protein 11, partial [Buceros 
rhinoceros silvestris]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KGL96598.1| Tuftelin-interacting protein 11, partial [Charadrius vociferus]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KGL84782.1| Tuftelin-interacting protein 11, partial [Tinamus guttatus]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  68   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122



>ref|XP_010176320.1| PREDICTED: tuftelin-interacting protein 11, partial [Caprimulgus 
carolinensis]
 gb|KFZ52397.1| Tuftelin-interacting protein 11, partial [Caprimulgus carolinensis]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009511274.1| PREDICTED: tuftelin-interacting protein 11, partial [Phalacrocorax 
carbo]
 gb|KFW97420.1| Tuftelin-interacting protein 11, partial [Phalacrocorax carbo]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFW62564.1| Tuftelin-interacting protein 11, partial [Pygoscelis adeliae]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009571985.1| PREDICTED: tuftelin-interacting protein 11, partial [Fulmarus 
glacialis]
 gb|KFV90469.1| Tuftelin-interacting protein 11, partial [Fulmarus glacialis]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009965680.1| PREDICTED: tuftelin-interacting protein 11, partial [Tyto alba]
 gb|KFV51419.1| Tuftelin-interacting protein 11, partial [Tyto alba]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009809419.1| PREDICTED: tuftelin-interacting protein 11, partial [Gavia stellata]
 gb|KFV42458.1| Tuftelin-interacting protein 11, partial [Gavia stellata]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFR13925.1| Tuftelin-interacting protein 11, partial [Opisthocomus hoazin]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122



>gb|KFR00697.1| Tuftelin-interacting protein 11, partial [Nipponia nippon]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_010294372.1| PREDICTED: tuftelin-interacting protein 11, partial [Phaethon 
lepturus]
 gb|KFQ70101.1| Tuftelin-interacting protein 11, partial [Phaethon lepturus]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFQ48373.1| Tuftelin-interacting protein 11, partial [Pelecanus crispus]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFQ43028.1| Tuftelin-interacting protein 11, partial [Nestor notabilis]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SIVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFP95623.1| Tuftelin-interacting protein 11, partial [Haliaeetus albicilla]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009707726.1| PREDICTED: tuftelin-interacting protein 11, partial [Cariama 
cristata]
 gb|KFP56041.1| Tuftelin-interacting protein 11, partial [Cariama cristata]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFP35899.1| Tuftelin-interacting protein 11, partial [Chlamydotis macqueenii]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFP12550.1| Tuftelin-interacting protein 11, partial [Egretta garzetta]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_010306276.1| PREDICTED: tuftelin-interacting protein 11, partial [Balearica 
regulorum gibbericeps]
 gb|KFO05881.1| Tuftelin-interacting protein 11, partial [Balearica regulorum 
gibbericeps]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>gb|KFM09886.1| Tuftelin-interacting protein 11, partial [Aptenodytes forsteri]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009936877.1| PREDICTED: tuftelin-interacting protein 11 [Opisthocomus hoazin]
Length=763

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  74   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  70   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  124



>gb|KFW83342.1| Tuftelin-interacting protein 11, partial [Manacus vitellinus]
Length=763

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  74   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  124


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  70   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  129

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  130  TTQSLQDFPVVDS  142



>ref|XP_008925041.1| PREDICTED: tuftelin-interacting protein 11 [Manacus vitellinus]
Length=765

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  76   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  126


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  72   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  131

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  132  TTQSLQDFPVVDS  144



>ref|XP_010016065.1| PREDICTED: tuftelin-interacting protein 11, partial [Nestor notabilis]
Length=776

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  87   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  137


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  83   SIVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  142

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  143  TSQSLQDFPVVDS  155



>ref|XP_009281103.1| PREDICTED: tuftelin-interacting protein 11 [Aptenodytes forsteri]
Length=777

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  88   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  138


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  84   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  143

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  144  TSQSLQDFPVVDS  156



>ref|XP_009983332.1| PREDICTED: tuftelin-interacting protein 11, partial [Tauraco 
erythrolophus]
 gb|KFV01662.1| Tuftelin-interacting protein 11, partial [Tauraco erythrolophus]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009332696.1| PREDICTED: tuftelin-interacting protein 11 [Pygoscelis adeliae]
Length=779

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  90   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  140


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  86   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  145

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  146  TSQSLQDFPVVDS  158



>ref|XP_010117527.1| PREDICTED: tuftelin-interacting protein 11, partial [Chlamydotis 
macqueenii]
Length=780

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  91   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  141


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  87   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  146

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  147  TSQSLQDFPVVDS  159



>ref|XP_009633041.1| PREDICTED: tuftelin-interacting protein 11 [Egretta garzetta]
Length=780

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  91   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  141


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  87   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  146

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  147  TSQSLQDFPVVDS  159



>ref|XP_009927441.1| PREDICTED: tuftelin-interacting protein 11, partial [Haliaeetus 
albicilla]
Length=789

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  100  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  150


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  96   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  155

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  156  TSQSLQDFPVVDS  168



>gb|KFO88150.1| Tuftelin-interacting protein 11, partial [Buceros rhinoceros 
silvestris]
Length=795

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_009676417.1| PREDICTED: tuftelin-interacting protein 11 [Struthio camelus 
australis]
Length=811

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  122  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  172


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  118  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  172



>gb|KFQ39573.1| Tuftelin-interacting protein 11 [Mesitornis unicolor]
Length=811

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  122  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  172


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  118  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  177

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  178  TSQSLQDFPVVDS  190



>gb|KIZ04951.1| Tuftelin-interacting protein 11, partial [Monoraphidium neglectum]
Length=759

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  283  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  128
            P F SFE  TKG GSK+++KMG+  G GLG++ QGI  PI A  RPK  G+G
Sbjct  272  PKFASFETFTKGIGSKLLSKMGYRPGEGLGREKQGIAKPIEAKLRPKGMGMG  323


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGF-TGGGLGKDGQGIAEPIQVSQRPKALGLG  425
            S   + +FE  T G GSK++ KMG+  G GLG++ QGIA+PI+   RPK +G+G
Sbjct  270  SDPKFASFETFTKGIGSKLLSKMGYRPGEGLGREKQGIAKPIEAKLRPKGMGMG  323



>ref|XP_005336129.1| PREDICTED: tuftelin-interacting protein 11 [Ictidomys tridecemlineatus]
Length=821

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTP  380
            +T +    P
Sbjct  198  TTQSLQDFP  206



>ref|XP_006869252.1| PREDICTED: tuftelin-interacting protein 11 [Chrysochloris asiatica]
Length=834

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_009466848.1| PREDICTED: tuftelin-interacting protein 11 [Nipponia nippon]
Length=814

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  125  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  175


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  121  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  180

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  181  TSQSLQDFPVVDS  193



>ref|XP_010373885.1| PREDICTED: tuftelin-interacting protein 11 [Rhinopithecus roxellana]
 ref|XP_010373886.1| PREDICTED: tuftelin-interacting protein 11 [Rhinopithecus roxellana]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|XP_010602003.1| PREDICTED: tuftelin-interacting protein 11 [Fukomys damarensis]
 gb|KFO23600.1| Tuftelin-interacting protein 11 [Fukomys damarensis]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_008050251.1| PREDICTED: tuftelin-interacting protein 11 [Tarsius syrichta]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_009006562.1| PREDICTED: tuftelin-interacting protein 11 [Callithrix jacchus]
 ref|XP_009006567.1| PREDICTED: tuftelin-interacting protein 11 [Callithrix jacchus]
 ref|XP_009006571.1| PREDICTED: tuftelin-interacting protein 11 [Callithrix jacchus]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSVQDFPVVDS  210



>ref|XP_006904928.1| PREDICTED: tuftelin-interacting protein 11 [Pteropus alecto]
 ref|XP_011372946.1| PREDICTED: tuftelin-interacting protein 11 [Pteropus vampyrus]
 ref|XP_011372947.1| PREDICTED: tuftelin-interacting protein 11 [Pteropus vampyrus]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|NP_036275.1| tuftelin-interacting protein 11 [Homo sapiens]
 ref|NP_001008697.1| tuftelin-interacting protein 11 [Homo sapiens]
 ref|XP_003820230.1| PREDICTED: tuftelin-interacting protein 11 [Pan paniscus]
 ref|XP_004063258.1| PREDICTED: tuftelin-interacting protein 11 [Gorilla gorilla gorilla]
 ref|XP_008971830.1| PREDICTED: tuftelin-interacting protein 11 [Pan paniscus]
 sp|Q9UBB9.1|TFP11_HUMAN RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Homo 
sapiens]
 emb|CAB43360.1| hypothetical protein [Homo sapiens]
 emb|CAB45740.1| hypothetical protein [Homo sapiens]
 gb|AAH11599.1| Tuftelin interacting protein 11 [Homo sapiens]
 gb|AAP35938.1| tuftelin interacting protein 11 [Homo sapiens]
 emb|CAI17878.1| tuftelin interacting protein 11 [Homo sapiens]
 gb|AAX42152.1| tuftelin interacting protein 11 [synthetic construct]
 emb|CAJ86441.1| bK445C9.6 [Homo sapiens]
 emb|CAK54393.1| TFIP11 [synthetic construct]
 emb|CAK54692.1| TFIP11 [synthetic construct]
 gb|EAW59723.1| tuftelin interacting protein 11, isoform CRA_b [Homo sapiens]
 gb|EAW59724.1| tuftelin interacting protein 11, isoform CRA_b [Homo sapiens]
 gb|ABM83177.1| tuftelin interacting protein 11 [synthetic construct]
 gb|ABM87848.1| tuftelin interacting protein 11 [synthetic construct]
 dbj|BAG10606.1| tuftelin-interacting protein 11 [synthetic construct]
 gb|AIC56104.1| TFIP11, partial [synthetic construct]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|XP_006213616.1| PREDICTED: tuftelin-interacting protein 11 [Vicugna pacos]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_005396205.1| PREDICTED: tuftelin-interacting protein 11 [Chinchilla lanigera]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_006185809.1| PREDICTED: tuftelin-interacting protein 11 [Camelus ferus]
 ref|XP_010949573.1| PREDICTED: tuftelin-interacting protein 11 [Camelus bactrianus]
 ref|XP_010990626.1| PREDICTED: tuftelin-interacting protein 11 [Camelus dromedarius]
 gb|EPY80348.1| tuftelin-interacting protein 11 [Camelus ferus]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|NP_001126744.1| tuftelin-interacting protein 11 [Pongo abelii]
 sp|Q5R5K8.1|TFP11_PONAB RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Pongo 
abelii]
 emb|CAH92958.1| hypothetical protein [Pongo abelii]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|XP_010347495.1| PREDICTED: tuftelin-interacting protein 11 [Saimiri boliviensis 
boliviensis]
 ref|XP_010347496.1| PREDICTED: tuftelin-interacting protein 11 [Saimiri boliviensis 
boliviensis]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSVQDFPVVDS  210



>ref|XP_003789889.1| PREDICTED: tuftelin-interacting protein 11 [Otolemur garnettii]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_004893175.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004893176.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004843406.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004843407.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Heterocephalus 
glaber]
 gb|EHB08443.1| Tuftelin-interacting protein 11 [Heterocephalus glaber]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_003277776.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Nomascus leucogenys]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>sp|A1XD95.1|TFP11_MACFA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Macaca 
fascicularis]
 gb|ABC69920.1| STIP [Macaca fascicularis]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>emb|CAL37965.1| hypothetical protein [synthetic construct]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|NP_001073621.1| tuftelin-interacting protein 11 [Pan troglodytes]
 sp|A1XD93.1|TFP11_PANTR RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Pan 
troglodytes]
 gb|ABC69918.1| STIP [Pan troglodytes]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|NP_001073589.1| tuftelin-interacting protein 11 [Macaca mulatta]
 ref|XP_005567787.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Macaca 
fascicularis]
 ref|XP_005567788.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Macaca 
fascicularis]
 ref|XP_005567789.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Macaca 
fascicularis]
 ref|XP_007973422.1| PREDICTED: tuftelin-interacting protein 11 [Chlorocebus sabaeus]
 ref|XP_007973423.1| PREDICTED: tuftelin-interacting protein 11 [Chlorocebus sabaeus]
 ref|XP_009215244.1| PREDICTED: tuftelin-interacting protein 11 [Papio anubis]
 ref|XP_009215245.1| PREDICTED: tuftelin-interacting protein 11 [Papio anubis]
 ref|XP_009215246.1| PREDICTED: tuftelin-interacting protein 11 [Papio anubis]
 sp|A1XD94.1|TFP11_MACMU RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Macaca 
mulatta]
 gb|ABC69919.1| STIP [Macaca mulatta]
 gb|EHH20106.1| hypothetical protein EGK_02894 [Macaca mulatta]
 gb|EHH65715.1| hypothetical protein EGM_02538 [Macaca fascicularis]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|NP_001073577.1| tuftelin-interacting protein 11 [Canis lupus familiaris]
 ref|XP_005636074.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Canis 
lupus familiaris]
 sp|A1XD97.1|TFP11_CANFA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Canis 
lupus familiaris]
 gb|ABC69922.1| STIP [Canis lupus familiaris]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>gb|AAH33080.1| Tuftelin interacting protein 11 [Homo sapiens]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSMQDFPVVDS  210



>ref|XP_008576508.1| PREDICTED: tuftelin-interacting protein 11 [Galeopterus variegatus]
Length=838

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  139  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  198

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  199  TTQSLQDFPVVDS  211



>ref|XP_005144938.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Melopsittacus undulatus]
Length=839

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  134  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  193

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  194  TSQSLQDFPVVDS  206



>ref|XP_010718697.1| PREDICTED: tuftelin-interacting protein 11 [Meleagris gallopavo]
Length=854

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  165  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  215


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  161  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  220

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  221  TSQSLQDFPVVDS  233



>ref|XP_004766607.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Mustela 
putorius furo]
 ref|XP_004766608.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Mustela 
putorius furo]
 ref|XP_004766609.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Mustela 
putorius furo]
 ref|XP_004816058.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Mustela 
putorius furo]
 ref|XP_004816059.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Mustela 
putorius furo]
 ref|XP_004816060.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Mustela 
putorius furo]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>ref|XP_004429903.1| PREDICTED: tuftelin-interacting protein 11 [Ceratotherium simum 
simum]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>gb|ELK18625.1| Tuftelin-interacting protein 11 [Pteropus alecto]
Length=860

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  165  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  215


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  161  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  220

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  221  TTQSLQDFPVVDS  233



>ref|XP_004628080.1| PREDICTED: tuftelin-interacting protein 11 [Octodon degus]
Length=838

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  139  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  198

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  199  TTQSIQDFPVVDS  211



>ref|XP_002922821.1| PREDICTED: tuftelin-interacting protein 11 [Ailuropoda melanoleuca]
 ref|XP_011227643.1| PREDICTED: tuftelin-interacting protein 11 [Ailuropoda melanoleuca]
 gb|EFB16402.1| hypothetical protein PANDA_011839 [Ailuropoda melanoleuca]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPAVDS  210



>ref|XP_006738156.1| PREDICTED: tuftelin-interacting protein 11 [Leptonychotes weddellii]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_001988208.1| GH10693 [Drosophila grimshawi]
 gb|EDW03075.1| GH10693 [Drosophila grimshawi]
Length=866

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -3

Query  598  KKCVSSSXNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  422
            K  ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI +P+Q   R     +GA
Sbjct  165  KSHIASGRNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGIQQPVQAHVRKGRGAIGA  224

Query  421  DVPETSTANETKTPTPK  371
              PET+ +   +   PK
Sbjct  225  YGPETAASIGGQAKPPK  241


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  274  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            G++E HT+G G+K++ +MG+  G GLGKD QGI  P+ A  R     +GA
Sbjct  175  GAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGIQQPVQAHVRKGRGAIGA  224



>ref|XP_004412506.1| PREDICTED: tuftelin-interacting protein 11 [Odobenus rosmarus 
divergens]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  406  STANETKTPTPKS  368
            +T +    P   S
Sbjct  198  TTQSLQDFPVVDS  210



>gb|KFZ55957.1| Tuftelin-interacting protein 11, partial [Podiceps cristatus]
Length=761

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  407
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  127

Query  406  STANETKTPTPKS  368
            ++ +    P   S
Sbjct  128  TSQSLQDFPVVDS  140



>ref|XP_006890530.1| PREDICTED: tuftelin-interacting protein 11 [Elephantulus edwardii]
Length=837

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  277  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  125
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  583  SSXNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  422
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230