BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036C12

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98250.1|  unnamed protein product                                167   2e-44   Coffea canephora [robusta coffee]
ref|XP_006341421.1|  PREDICTED: uncharacterized protein LOC102590599    164   2e-43   Solanum tuberosum [potatoes]
ref|XP_010318696.1|  PREDICTED: uncharacterized protein LOC101254...    163   7e-43   Solanum lycopersicum
ref|XP_004235885.1|  PREDICTED: uncharacterized protein LOC101254...    163   7e-43   Solanum lycopersicum
ref|XP_009615690.1|  PREDICTED: uncharacterized protein LOC104108...    162   1e-42   Nicotiana tomentosiformis
ref|XP_009615691.1|  PREDICTED: uncharacterized protein LOC104108...    162   1e-42   Nicotiana tomentosiformis
ref|XP_009758247.1|  PREDICTED: uncharacterized protein LOC104210...    162   2e-42   Nicotiana sylvestris
ref|XP_009758249.1|  PREDICTED: uncharacterized protein LOC104210...    162   2e-42   Nicotiana sylvestris
ref|XP_009604129.1|  PREDICTED: uncharacterized protein LOC104098...    161   4e-42   Nicotiana tomentosiformis
ref|XP_009604130.1|  PREDICTED: uncharacterized protein LOC104098...    161   4e-42   Nicotiana tomentosiformis
ref|XP_011082590.1|  PREDICTED: uncharacterized protein LOC105165312    156   3e-40   Sesamum indicum [beniseed]
ref|XP_009783853.1|  PREDICTED: uncharacterized protein LOC104232...    155   3e-40   Nicotiana sylvestris
ref|XP_009783852.1|  PREDICTED: uncharacterized protein LOC104232...    155   3e-40   Nicotiana sylvestris
ref|XP_006366262.1|  PREDICTED: uncharacterized protein LOC102579...    144   4e-36   Solanum tuberosum [potatoes]
ref|XP_006366261.1|  PREDICTED: uncharacterized protein LOC102579...    144   4e-36   Solanum tuberosum [potatoes]
gb|EYU21802.1|  hypothetical protein MIMGU_mgv1a011461mg                137   4e-35   Erythranthe guttata [common monkey flower]
ref|XP_004241674.1|  PREDICTED: uncharacterized protein LOC101256...    139   2e-34   Solanum lycopersicum
ref|XP_010322653.1|  PREDICTED: uncharacterized protein LOC101256...    139   2e-34   Solanum lycopersicum
ref|XP_011073225.1|  PREDICTED: uncharacterized protein LOC105158248    134   2e-32   Sesamum indicum [beniseed]
gb|EPS69285.1|  hypothetical protein M569_05482                         122   2e-28   Genlisea aurea
ref|XP_010656631.1|  PREDICTED: uncharacterized protein LOC100251...    120   7e-28   Vitis vinifera
gb|EYU24571.1|  hypothetical protein MIMGU_mgv1a004911mg                120   8e-28   Erythranthe guttata [common monkey flower]
ref|XP_002274694.1|  PREDICTED: uncharacterized protein LOC100251...    120   9e-28   Vitis vinifera
gb|EYU24572.1|  hypothetical protein MIMGU_mgv1a004911mg                120   9e-28   Erythranthe guttata [common monkey flower]
dbj|BAD72448.1|  unknown protein                                        117   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528397.1|  conserved hypothetical protein                     119   6e-27   Ricinus communis
ref|NP_001057011.1|  Os06g0186600                                       117   1e-26   
gb|EAZ36075.1|  hypothetical protein OsJ_20384                          117   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99950.1|  hypothetical protein OsI_21952                          117   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_006655862.1|  PREDICTED: uncharacterized protein LOC102701454    115   4e-26   Oryza brachyantha
ref|XP_007013889.1|  Uncharacterized protein isoform 1                  114   2e-25   
ref|XP_007013890.1|  Uncharacterized protein isoform 2                  114   2e-25   
ref|XP_010906671.1|  PREDICTED: uncharacterized protein LOC105033...    114   2e-25   Elaeis guineensis
ref|XP_010906672.1|  PREDICTED: uncharacterized protein LOC105033...    114   2e-25   Elaeis guineensis
gb|KJB23593.1|  hypothetical protein B456_004G106800                    112   3e-25   Gossypium raimondii
gb|KHG03368.1|  ATP-dependent DNA helicase pcrA                         113   4e-25   Gossypium arboreum [tree cotton]
ref|XP_010265510.1|  PREDICTED: uncharacterized protein LOC104603232    113   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008791339.1|  PREDICTED: uncharacterized protein LOC103708...    112   8e-25   Phoenix dactylifera
ref|XP_008791338.1|  PREDICTED: uncharacterized protein LOC103708...    112   8e-25   Phoenix dactylifera
gb|KJB23596.1|  hypothetical protein B456_004G106800                    111   9e-25   Gossypium raimondii
gb|KJB23594.1|  hypothetical protein B456_004G106800                    111   1e-24   Gossypium raimondii
gb|KJB23592.1|  hypothetical protein B456_004G106800                    111   2e-24   Gossypium raimondii
ref|XP_011018078.1|  PREDICTED: uncharacterized protein LOC105121219    112   2e-24   Populus euphratica
ref|XP_010227931.1|  PREDICTED: uncharacterized protein LOC100821...    110   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_011020564.1|  PREDICTED: uncharacterized protein LOC105122893    110   3e-24   Populus euphratica
ref|XP_006385936.1|  hypothetical protein POPTR_0003s18310g             110   3e-24   
ref|XP_002324519.2|  hypothetical protein POPTR_0018s11180g             111   3e-24   
gb|KDP38724.1|  hypothetical protein JCGZ_04077                         111   3e-24   Jatropha curcas
ref|XP_002512753.1|  conserved hypothetical protein                     110   4e-24   Ricinus communis
ref|XP_003564178.1|  PREDICTED: uncharacterized protein LOC100821...    110   5e-24   Brachypodium distachyon [annual false brome]
ref|XP_011033365.1|  PREDICTED: uncharacterized protein LOC105131880    110   5e-24   Populus euphratica
ref|XP_011012246.1|  PREDICTED: uncharacterized protein LOC105116539    110   6e-24   Populus euphratica
ref|XP_011034585.1|  PREDICTED: uncharacterized protein LOC105132...    108   6e-24   Populus euphratica
ref|XP_007023516.1|  Uncharacterized protein TCM_027550                 109   8e-24   
ref|XP_010655141.1|  PREDICTED: uncharacterized protein LOC100262...    109   9e-24   
ref|XP_011034581.1|  PREDICTED: uncharacterized protein LOC105132...    109   1e-23   Populus euphratica
gb|KDO55394.1|  hypothetical protein CISIN_1g012603mg                   107   1e-23   Citrus sinensis [apfelsine]
ref|XP_004954196.1|  PREDICTED: uncharacterized protein LOC101774...    108   1e-23   Setaria italica
ref|XP_010655140.1|  PREDICTED: uncharacterized protein LOC100262...    109   1e-23   Vitis vinifera
ref|XP_010268524.1|  PREDICTED: uncharacterized protein LOC104605439    109   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010111118.1|  hypothetical protein L484_008495                   108   2e-23   Morus notabilis
ref|XP_008452508.1|  PREDICTED: uncharacterized protein LOC103493516    108   2e-23   Cucumis melo [Oriental melon]
ref|XP_009418539.1|  PREDICTED: uncharacterized protein LOC103998...    108   2e-23   
gb|KDO55392.1|  hypothetical protein CISIN_1g012603mg                   106   3e-23   Citrus sinensis [apfelsine]
ref|XP_009418538.1|  PREDICTED: uncharacterized protein LOC103998...    107   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO55371.1|  hypothetical protein CISIN_1g012603mg                   107   4e-23   Citrus sinensis [apfelsine]
gb|KDO55369.1|  hypothetical protein CISIN_1g012603mg                   107   4e-23   Citrus sinensis [apfelsine]
gb|KDO55387.1|  hypothetical protein CISIN_1g012603mg                   106   4e-23   Citrus sinensis [apfelsine]
ref|XP_006493461.1|  PREDICTED: uncharacterized protein LOC102624...    107   5e-23   Citrus sinensis [apfelsine]
ref|XP_006427676.1|  hypothetical protein CICLE_v10027000mg             106   8e-23   Citrus clementina [clementine]
gb|EMT26553.1|  hypothetical protein F775_08200                         105   2e-22   
ref|XP_010094072.1|  hypothetical protein L484_018088                   105   2e-22   Morus notabilis
ref|XP_002299157.1|  hypothetical protein POPTR_0001s03330g             105   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002309367.2|  hypothetical protein POPTR_0006s19420g             105   3e-22   
ref|XP_008342829.1|  PREDICTED: uncharacterized protein LOC103405596    104   4e-22   
ref|XP_004144718.1|  PREDICTED: uncharacterized protein LOC101216574    104   5e-22   Cucumis sativus [cucumbers]
ref|XP_002437983.1|  hypothetical protein SORBIDRAFT_10g005890          103   6e-22   
gb|ADB08053.1|  putative protein                                        103   1e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009354222.1|  PREDICTED: uncharacterized protein LOC103945389    103   1e-21   Pyrus x bretschneideri [bai li]
gb|EMS68538.1|  hypothetical protein TRIUR3_33455                       103   2e-21   Triticum urartu
dbj|BAJ98844.1|  predicted protein                                      102   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010687332.1|  PREDICTED: uncharacterized protein LOC104901445    102   3e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010927930.1|  PREDICTED: uncharacterized protein LOC105049...    102   4e-21   
ref|XP_008443833.1|  PREDICTED: uncharacterized protein LOC103487...    102   4e-21   Cucumis melo [Oriental melon]
ref|XP_008462951.1|  PREDICTED: uncharacterized protein LOC103501212    101   5e-21   Cucumis melo [Oriental melon]
ref|XP_008443832.1|  PREDICTED: uncharacterized protein LOC103487...    102   5e-21   Cucumis melo [Oriental melon]
ref|XP_008443831.1|  PREDICTED: uncharacterized protein LOC103487...    102   5e-21   Cucumis melo [Oriental melon]
ref|XP_008443830.1|  PREDICTED: uncharacterized protein LOC103487...    102   5e-21   Cucumis melo [Oriental melon]
ref|XP_003525940.1|  PREDICTED: uncharacterized protein LOC100792008    101   6e-21   Glycine max [soybeans]
ref|XP_004137649.1|  PREDICTED: uncharacterized protein LOC101216149    101   6e-21   Cucumis sativus [cucumbers]
ref|XP_004146718.1|  PREDICTED: uncharacterized protein LOC101219584    101   6e-21   Cucumis sativus [cucumbers]
ref|XP_010927928.1|  PREDICTED: uncharacterized protein LOC105049...    102   6e-21   Elaeis guineensis
ref|XP_010927929.1|  PREDICTED: uncharacterized protein LOC105049...    101   6e-21   Elaeis guineensis
ref|XP_008223604.1|  PREDICTED: uncharacterized protein LOC103323...    101   8e-21   Prunus mume [ume]
gb|KHN24188.1|  hypothetical protein glysoja_042005                     101   8e-21   Glycine soja [wild soybean]
ref|XP_008223605.1|  PREDICTED: uncharacterized protein LOC103323...    101   8e-21   Prunus mume [ume]
ref|XP_006343599.1|  PREDICTED: uncharacterized protein LOC102599998    100   1e-20   Solanum tuberosum [potatoes]
ref|XP_007223233.1|  hypothetical protein PRUPE_ppa003793mg             100   1e-20   Prunus persica
gb|KHN30277.1|  hypothetical protein glysoja_042437                     100   1e-20   Glycine soja [wild soybean]
ref|XP_009336665.1|  PREDICTED: uncharacterized protein LOC103929...    100   1e-20   
ref|XP_006575320.1|  PREDICTED: uncharacterized protein LOC100794...    100   1e-20   Glycine max [soybeans]
ref|XP_009336666.1|  PREDICTED: uncharacterized protein LOC103929...    100   1e-20   
ref|XP_009336662.1|  PREDICTED: uncharacterized protein LOC103929...    100   1e-20   
ref|XP_004964644.1|  PREDICTED: uncharacterized protein LOC101773914    100   2e-20   Setaria italica
ref|XP_006575319.1|  PREDICTED: uncharacterized protein LOC100794...    100   2e-20   Glycine max [soybeans]
gb|KGN65185.1|  hypothetical protein Csa_1G257910                       100   2e-20   Cucumis sativus [cucumbers]
ref|XP_007138292.1|  hypothetical protein PHAVU_009G196100g             100   2e-20   Phaseolus vulgaris [French bean]
ref|XP_010687648.1|  PREDICTED: uncharacterized protein LOC104901744  99.8    3e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW85535.1|  hypothetical protein ZEAMMB73_400214                  99.4    3e-20   
ref|NP_001143180.1|  uncharacterized protein LOC100275680             99.4    4e-20   Zea mays [maize]
gb|KHN02051.1|  hypothetical protein glysoja_045196                   97.1    6e-20   Glycine soja [wild soybean]
ref|XP_002304738.2|  hypothetical protein POPTR_0003s18310g           98.2    6e-20   
ref|XP_008647634.1|  PREDICTED: hypothetical protein isoform X1       99.0    6e-20   Zea mays [maize]
ref|NP_001143086.1|  hypothetical protein                             98.6    6e-20   Zea mays [maize]
ref|XP_009800570.1|  PREDICTED: uncharacterized protein LOC104246459  98.2    1e-19   Nicotiana sylvestris
ref|XP_004303224.1|  PREDICTED: uncharacterized protein LOC101296120  97.8    1e-19   Fragaria vesca subsp. vesca
ref|XP_006453555.1|  hypothetical protein CICLE_v10007906mg           97.4    2e-19   Citrus clementina [clementine]
ref|XP_009375478.1|  PREDICTED: uncharacterized protein LOC103964285  97.1    2e-19   Pyrus x bretschneideri [bai li]
gb|KDP41944.1|  hypothetical protein JCGZ_26962                       97.1    2e-19   Jatropha curcas
ref|XP_004242622.1|  PREDICTED: uncharacterized protein LOC101251694  97.1    2e-19   Solanum lycopersicum
ref|XP_003522941.1|  PREDICTED: uncharacterized protein LOC100807349  97.1    3e-19   Glycine max [soybeans]
ref|XP_011069649.1|  PREDICTED: uncharacterized protein LOC105155471  95.9    5e-19   
ref|XP_009396243.1|  PREDICTED: uncharacterized protein LOC103981292  95.9    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006474053.1|  PREDICTED: uncharacterized protein LOC102622...  95.9    6e-19   Citrus sinensis [apfelsine]
ref|XP_006474052.1|  PREDICTED: uncharacterized protein LOC102622...  95.9    7e-19   Citrus sinensis [apfelsine]
ref|XP_011034584.1|  PREDICTED: uncharacterized protein LOC105132...  95.1    9e-19   Populus euphratica
ref|XP_004507763.1|  PREDICTED: uncharacterized protein LOC101495...  95.5    1e-18   Cicer arietinum [garbanzo]
gb|KEH28578.1|  hypothetical protein MTR_4g007710                     95.1    1e-18   Medicago truncatula
gb|KEH32610.1|  hypothetical protein MTR_4g130310                     94.7    1e-18   Medicago truncatula
ref|XP_003610264.1|  hypothetical protein MTR_4g130310                94.7    1e-18   Medicago truncatula
ref|XP_009395482.1|  PREDICTED: uncharacterized protein LOC103980727  94.4    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP02853.1|  unnamed protein product                              94.4    2e-18   Coffea canephora [robusta coffee]
ref|XP_004161876.1|  PREDICTED: uncharacterized LOC101219584          94.0    3e-18   
ref|XP_004166179.1|  PREDICTED: uncharacterized LOC101216574          94.0    3e-18   
ref|XP_010047053.1|  PREDICTED: uncharacterized protein LOC104436016  93.6    4e-18   Eucalyptus grandis [rose gum]
gb|KCW78806.1|  hypothetical protein EUGRSUZ_C00240                   93.6    4e-18   Eucalyptus grandis [rose gum]
ref|XP_011034582.1|  PREDICTED: uncharacterized protein LOC105132...  92.8    5e-18   Populus euphratica
ref|XP_009623108.1|  PREDICTED: uncharacterized protein LOC104114385  93.2    5e-18   Nicotiana tomentosiformis
ref|XP_010655142.1|  PREDICTED: uncharacterized protein LOC100262...  92.4    8e-18   
gb|KHN17516.1|  hypothetical protein glysoja_005713                   90.9    2e-17   Glycine soja [wild soybean]
ref|XP_008228846.1|  PREDICTED: uncharacterized protein LOC103328229  91.3    2e-17   Prunus mume [ume]
ref|XP_008789898.1|  PREDICTED: uncharacterized protein LOC103707259  91.3    2e-17   Phoenix dactylifera
ref|XP_006600521.1|  PREDICTED: uncharacterized protein LOC100791924  90.5    3e-17   Glycine max [soybeans]
ref|XP_002452970.1|  hypothetical protein SORBIDRAFT_04g035716        86.7    4e-17   
gb|KHG24428.1|  Pesticidal crystal cry1Fa                             89.7    6e-17   Gossypium arboreum [tree cotton]
ref|XP_009345909.1|  PREDICTED: uncharacterized protein LOC103937692  89.4    9e-17   
ref|XP_009360003.1|  PREDICTED: uncharacterized protein LOC103950506  89.4    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_009399571.1|  PREDICTED: uncharacterized protein LOC103983938  87.4    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB68963.1|  hypothetical protein B456_011G001000                  87.0    4e-16   Gossypium raimondii
gb|KJB68964.1|  hypothetical protein B456_011G001000                  87.0    4e-16   Gossypium raimondii
ref|XP_004309859.1|  PREDICTED: uncharacterized protein LOC101299924  86.3    1e-15   Fragaria vesca subsp. vesca
ref|XP_004507038.1|  PREDICTED: uncharacterized protein LOC101500032  85.9    1e-15   Cicer arietinum [garbanzo]
ref|XP_010235910.1|  PREDICTED: uncharacterized protein LOC100824...  85.5    1e-15   
ref|XP_010235909.1|  PREDICTED: uncharacterized protein LOC100824...  85.5    2e-15   
ref|XP_006845397.1|  hypothetical protein AMTR_s00019p00062450        84.7    4e-15   Amborella trichopoda
gb|EYU37144.1|  hypothetical protein MIMGU_mgv1a006661mg              82.0    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_010525794.1|  PREDICTED: uncharacterized protein LOC104803...  81.6    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010525792.1|  PREDICTED: uncharacterized protein LOC104803...  81.6    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010525793.1|  PREDICTED: uncharacterized protein LOC104803...  81.3    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010525791.1|  PREDICTED: uncharacterized protein LOC104803...  81.3    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010063615.1|  PREDICTED: uncharacterized protein LOC104450...  80.9    4e-14   
ref|XP_010063614.1|  PREDICTED: uncharacterized protein LOC104450...  80.9    5e-14   Eucalyptus grandis [rose gum]
ref|XP_010526305.1|  PREDICTED: uncharacterized protein LOC104803910  79.0    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_008381124.1|  PREDICTED: uncharacterized protein LOC103443996  77.0    1e-12   
ref|XP_009396105.1|  PREDICTED: uncharacterized protein LOC103981...  77.0    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396106.1|  PREDICTED: uncharacterized protein LOC103981...  77.0    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN04197.1|  hypothetical protein glysoja_032693                   75.1    5e-12   Glycine soja [wild soybean]
ref|XP_003530210.1|  PREDICTED: uncharacterized protein LOC100808...  75.1    5e-12   Glycine max [soybeans]
ref|XP_006583081.1|  PREDICTED: uncharacterized protein LOC100808...  75.1    6e-12   Glycine max [soybeans]
ref|XP_002878722.1|  hypothetical protein ARALYDRAFT_481267           74.7    6e-12   
ref|XP_003538884.1|  PREDICTED: uncharacterized protein LOC100809148  73.9    9e-12   Glycine max [soybeans]
gb|KHN38060.1|  hypothetical protein glysoja_007102                   73.6    2e-11   Glycine soja [wild soybean]
ref|XP_003531752.1|  PREDICTED: uncharacterized protein LOC100808...  73.6    2e-11   Glycine max [soybeans]
ref|XP_006585654.1|  PREDICTED: uncharacterized protein LOC100808...  73.6    2e-11   Glycine max [soybeans]
gb|AAD03372.2|  expressed protein                                     71.6    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565562.2|  uncharacterized protein                             71.6    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544349.1|  PREDICTED: uncharacterized protein LOC104816994  71.2    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_006294201.1|  hypothetical protein CARUB_v10023197mg           70.9    1e-10   Capsella rubella
ref|XP_007142109.1|  hypothetical protein PHAVU_008G253300g           69.7    3e-10   Phaseolus vulgaris [French bean]
emb|CDP19452.1|  unnamed protein product                              64.7    4e-10   Coffea canephora [robusta coffee]
ref|XP_008679230.1|  PREDICTED: uncharacterized protein LOC103654180  68.6    7e-10   Zea mays [maize]
gb|AFW64169.1|  hypothetical protein ZEAMMB73_443308                  67.4    2e-09   
ref|XP_006412670.1|  hypothetical protein EUTSA_v10024775mg           67.0    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006580837.1|  PREDICTED: uncharacterized protein LOC102669004  66.6    3e-09   
gb|KHN25903.1|  hypothetical protein glysoja_018757                   66.2    4e-09   Glycine soja [wild soybean]
ref|XP_009127531.1|  PREDICTED: uncharacterized protein LOC103852376  66.2    4e-09   Brassica rapa
ref|XP_009771706.1|  PREDICTED: uncharacterized protein LOC104222...  62.8    4e-09   Nicotiana sylvestris
gb|AGV54845.1|  hypothetical protein                                  65.9    6e-09   Phaseolus vulgaris [French bean]
ref|XP_009771709.1|  PREDICTED: uncharacterized protein LOC104222...  61.6    9e-09   Nicotiana sylvestris
gb|KFK41359.1|  hypothetical protein AALP_AA2G119900                  64.7    1e-08   Arabis alpina [alpine rockcress]
gb|KFK41360.1|  hypothetical protein AALP_AA2G119900                  64.3    2e-08   Arabis alpina [alpine rockcress]
ref|XP_006404909.1|  hypothetical protein EUTSA_v10000158mg           64.3    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010472409.1|  PREDICTED: uncharacterized protein LOC104752037  63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002869363.1|  hypothetical protein ARALYDRAFT_491676           63.5    4e-08   
emb|CAN68794.1|  hypothetical protein VITISV_016174                   63.5    4e-08   Vitis vinifera
ref|XP_010438134.1|  PREDICTED: uncharacterized protein LOC104721765  63.2    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010432947.1|  PREDICTED: uncharacterized protein LOC104717115  62.8    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006283391.1|  hypothetical protein CARUB_v10004435mg           61.2    2e-07   Capsella rubella
ref|XP_010447673.1|  PREDICTED: uncharacterized protein LOC104730227  61.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|NP_001173180.1|  Os02g0793800                                     61.2    2e-07   
dbj|BAD19195.1|  hypothetical protein                                 61.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDX68693.1|  BnaC01g07600D                                        61.2    2e-07   
ref|XP_007217228.1|  hypothetical protein PRUPE_ppa005301mg           60.8    2e-07   
ref|XP_009137965.1|  PREDICTED: uncharacterized protein LOC103862001  60.8    2e-07   Brassica rapa
gb|EAY87838.1|  hypothetical protein OsI_09259                        60.5    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_009117249.1|  PREDICTED: uncharacterized protein LOC103842383  58.9    9e-07   Brassica rapa
emb|CDY34799.1|  BnaA09g41660D                                        58.5    1e-06   Brassica napus [oilseed rape]
emb|CDY39241.1|  BnaA03g50530D                                        58.5    2e-06   Brassica napus [oilseed rape]
ref|NP_194807.1|  uncharacterized protein                             58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72268.1|  BnaC07g42900D                                        58.2    2e-06   
ref|XP_009771711.1|  PREDICTED: uncharacterized protein LOC104222...  53.5    6e-06   Nicotiana sylvestris
emb|CBI25264.3|  unnamed protein product                              56.6    6e-06   Vitis vinifera
ref|XP_010655143.1|  PREDICTED: uncharacterized protein LOC100262...  56.6    6e-06   Vitis vinifera
ref|XP_009771710.1|  PREDICTED: uncharacterized protein LOC104222...  53.1    1e-05   Nicotiana sylvestris
ref|XP_003610268.1|  hypothetical protein MTR_4g130350                52.0    1e-05   
emb|CDX76839.1|  BnaC08g34250D                                        55.5    1e-05   
gb|EEE69217.1|  hypothetical protein OsJ_28438                        55.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84117.1|  hypothetical protein OsI_30449                        55.5    2e-05   Oryza sativa Indica Group [Indian rice]
emb|CDY23256.1|  BnaA08g12900D                                        55.5    2e-05   Brassica napus [oilseed rape]
gb|ABR16502.1|  unknown                                               55.5    2e-05   Picea sitchensis
ref|XP_009108969.1|  PREDICTED: uncharacterized protein LOC103834656  53.5    8e-05   Brassica rapa
gb|KFK29655.1|  hypothetical protein AALP_AA7G161600                  51.2    4e-04   Arabis alpina [alpine rockcress]



>emb|CDO98250.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 120/176 (68%), Gaps = 32/176 (18%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLE R+SEQ+TS +F LSS+ERQ LE+LEEINRCLFSD+QY+P ASDEKSLMSRVN
Sbjct  360  DLVSHLENRISEQRTSDNFILSSDERQGLEILEEINRCLFSDSQYVP-ASDEKSLMSRVN  418

Query  574  SLCCLLQKDPPPPTAQ----RRENFHEPAMGDKGVGEFNF---ASASVVSERNYEENRpp  416
            SLCCLLQKD  P T Q    + E+  +  + DK + + +F   AS S + E+        
Sbjct  419  SLCCLLQKD--PMTGQILPSKSESISDVLVMDKRIDDSSFTLQASGSKIDEK--------  468

Query  415  tpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                         S Q   MSRKDSVGDLLLNLPRI SLPQFLFNI+ED D +QAR
Sbjct  469  -------------SAQPPPMSRKDSVGDLLLNLPRIASLPQFLFNISEDVD-NQAR  510



>ref|XP_006341421.1| PREDICTED: uncharacterized protein LOC102590599 [Solanum tuberosum]
Length=525

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 111/171 (65%), Gaps = 25/171 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+   LSS+ERQSLE+LEEI+RCLFSDTQ MP ASDEKSLM+RVN
Sbjct  378  DLVSHFEQRFSEQGTSEVICLSSDERQSLEILEEISRCLFSDTQNMP-ASDEKSLMTRVN  436

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEF--NFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD  P TA + EN+ + A+G K   E    F      SE              
Sbjct  437  SLCCLLQKD--PATAHKSENYDDVAVGGKRTDELISFFPGDPSTSE--------------  480

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                    +    SMSRKDS+GDLLLNLPRI SLP FLFNI EDSD H AR
Sbjct  481  -----DKSNDPAPSMSRKDSIGDLLLNLPRIASLPHFLFNIYEDSD-HPAR  525



>ref|XP_010318696.1| PREDICTED: uncharacterized protein LOC101254582 isoform X2 [Solanum 
lycopersicum]
Length=534

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 109/164 (66%), Gaps = 12/164 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+  +LSS+E QSLE+LEEI+RCLFSDTQ MP ASDEKSLM+RVN
Sbjct  379  DLVSHFEQRFSEQGTSEVISLSSDELQSLEILEEISRCLFSDTQNMP-ASDEKSLMTRVN  437

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TA + EN+   A+G K   E           +  E+           
Sbjct  438  SLCCLLQKD--PATAHKSENYGGVAVGGKRTDELISFFPGATCGKKVED---------PS  486

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              +   +    SMSRKDS+GDLLLNLPRI SLPQFLFNI EDSD
Sbjct  487  TSEDKSNDPAPSMSRKDSIGDLLLNLPRIASLPQFLFNIYEDSD  530



>ref|XP_004235885.1| PREDICTED: uncharacterized protein LOC101254582 isoform X1 [Solanum 
lycopersicum]
Length=535

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 109/164 (66%), Gaps = 12/164 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+  +LSS+E QSLE+LEEI+RCLFSDTQ MP ASDEKSLM+RVN
Sbjct  380  DLVSHFEQRFSEQGTSEVISLSSDELQSLEILEEISRCLFSDTQNMP-ASDEKSLMTRVN  438

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TA + EN+   A+G K   E           +  E+           
Sbjct  439  SLCCLLQKD--PATAHKSENYGGVAVGGKRTDELISFFPGATCGKKVED---------PS  487

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              +   +    SMSRKDS+GDLLLNLPRI SLPQFLFNI EDSD
Sbjct  488  TSEDKSNDPAPSMSRKDSIGDLLLNLPRIASLPQFLFNIYEDSD  531



>ref|XP_009615690.1| PREDICTED: uncharacterized protein LOC104108377 isoform X1 [Nicotiana 
tomentosiformis]
Length=532

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 117/173 (68%), Gaps = 22/173 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+D NLSS+ERQSL++LE+I+RCLFSDTQ MP  SDEKSLMSRVN
Sbjct  378  DLVSHFEQRFSEQGTSEDINLSSDERQSLQILEDISRCLFSDTQNMP-ESDEKSLMSRVN  436

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNF----ASASVVSERNYEENRpptpd  407
            SLCCL+QKD  P TA + E+    A+      E +F    AS   V + +  E++     
Sbjct  437  SLCCLIQKD--PATAHKSESSGYVAVEGNRTDELSFFPVAASVDKVEDPSTTEDK-----  489

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                      +    SMSRKDSVG+LL+NLPRI SLPQFLFNI EDS+Y QAR
Sbjct  490  ---------SNDPTPSMSRKDSVGELLMNLPRIASLPQFLFNIYEDSEY-QAR  532



>ref|XP_009615691.1| PREDICTED: uncharacterized protein LOC104108377 isoform X2 [Nicotiana 
tomentosiformis]
Length=531

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 117/173 (68%), Gaps = 22/173 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+D NLSS+ERQSL++LE+I+RCLFSDTQ MP  SDEKSLMSRVN
Sbjct  377  DLVSHFEQRFSEQGTSEDINLSSDERQSLQILEDISRCLFSDTQNMP-ESDEKSLMSRVN  435

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNF----ASASVVSERNYEENRpptpd  407
            SLCCL+QKD  P TA + E+    A+      E +F    AS   V + +  E++     
Sbjct  436  SLCCLIQKD--PATAHKSESSGYVAVEGNRTDELSFFPVAASVDKVEDPSTTEDK-----  488

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                      +    SMSRKDSVG+LL+NLPRI SLPQFLFNI EDS+Y QAR
Sbjct  489  ---------SNDPTPSMSRKDSVGELLMNLPRIASLPQFLFNIYEDSEY-QAR  531



>ref|XP_009758247.1| PREDICTED: uncharacterized protein LOC104210965 isoform X1 [Nicotiana 
sylvestris]
Length=535

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLEQR+SEQKTSK  NL+S+ERQSLE+LEEI++ L SDTQ +P ASDEKSLMSRVN
Sbjct  376  DLVSHLEQRVSEQKTSKGINLASDERQSLEILEEISKSLLSDTQNVP-ASDEKSLMSRVN  434

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TAQ+ EN  +   G K V E NF   +    R  E++  P+  +D  
Sbjct  435  SLCCLLQKD--PATAQKSENCGDVVPGGKRVNEINFIPTAPFG-REVEDD--PSTSEDES  489

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D  +C K   +MSRKDSVG+LLLNLPRI SLPQFLF I ED+  +QAR
Sbjct  490  NDFSSC-KPAPTMSRKDSVGNLLLNLPRIASLPQFLF-ICEDTG-NQAR  535



>ref|XP_009758249.1| PREDICTED: uncharacterized protein LOC104210965 isoform X2 [Nicotiana 
sylvestris]
Length=534

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLEQR+SEQKTSK  NL+S+ERQSLE+LEEI++ L SDTQ +P ASDEKSLMSRVN
Sbjct  375  DLVSHLEQRVSEQKTSKGINLASDERQSLEILEEISKSLLSDTQNVP-ASDEKSLMSRVN  433

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TAQ+ EN  +   G K V E NF   +    R  E++  P+  +D  
Sbjct  434  SLCCLLQKD--PATAQKSENCGDVVPGGKRVNEINFIPTAPFG-REVEDD--PSTSEDES  488

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D  +C K   +MSRKDSVG+LLLNLPRI SLPQFLF I ED+  +QAR
Sbjct  489  NDFSSC-KPAPTMSRKDSVGNLLLNLPRIASLPQFLF-ICEDTG-NQAR  534



>ref|XP_009604129.1| PREDICTED: uncharacterized protein LOC104098979 isoform X1 [Nicotiana 
tomentosiformis]
Length=535

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 121/169 (72%), Gaps = 9/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLEQR+SEQKTSK  NL+ +ERQSLE+LEEI++ L SDTQ +  ASDEKSLMSRVN
Sbjct  376  DLVSHLEQRVSEQKTSKGINLACDERQSLEILEEISKSLLSDTQNV-TASDEKSLMSRVN  434

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TAQ+ EN      G+K V E NF   +    R  EE+  P+  D+  
Sbjct  435  SLCCLLQKD--PATAQKGENCGVVVPGEKRVNELNFIPTAPFG-REVEED--PSTSDNES  489

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D  +C K   +MSRKDSVGDLLLNLPRI SLPQFLF I EDS  +QAR
Sbjct  490  NDLSSC-KPAPTMSRKDSVGDLLLNLPRIASLPQFLF-ICEDSG-NQAR  535



>ref|XP_009604130.1| PREDICTED: uncharacterized protein LOC104098979 isoform X2 [Nicotiana 
tomentosiformis]
Length=534

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 121/169 (72%), Gaps = 9/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLEQR+SEQKTSK  NL+ +ERQSLE+LEEI++ L SDTQ +  ASDEKSLMSRVN
Sbjct  375  DLVSHLEQRVSEQKTSKGINLACDERQSLEILEEISKSLLSDTQNV-TASDEKSLMSRVN  433

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TAQ+ EN      G+K V E NF   +    R  EE+  P+  D+  
Sbjct  434  SLCCLLQKD--PATAQKGENCGVVVPGEKRVNELNFIPTAPFG-REVEED--PSTSDNES  488

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D  +C K   +MSRKDSVGDLLLNLPRI SLPQFLF I EDS  +QAR
Sbjct  489  NDLSSC-KPAPTMSRKDSVGDLLLNLPRIASLPQFLF-ICEDSG-NQAR  534



>ref|XP_011082590.1| PREDICTED: uncharacterized protein LOC105165312 [Sesamum indicum]
Length=531

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 120/171 (70%), Gaps = 10/171 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLE R+SEQ TS    LSSEE +SL++L++INRCLFSD Q++P  SDEKSLMSRVN
Sbjct  369  DLVSHLEHRISEQGTSDTPTLSSEEWESLQILDDINRCLFSDIQHLP-DSDEKSLMSRVN  427

Query  574  SLCCLLQKDPPPPTAQRRENFHEP--AMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD  P +  + ++ H P  A+  K   E N   AS  +E+  EEN       +
Sbjct  428  SLCCLLQKDTAPGSNIQFKSDHSPDLALVQKRGEESNNLGASTSAEK-VEEN-----IHN  481

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
               + ++   Q +SMSRKDSVGDLLLNLPRI SLPQFLFNI+ED + +QAR
Sbjct  482  DDSEGISGPNQVSSMSRKDSVGDLLLNLPRIASLPQFLFNISEDLE-NQAR  531



>ref|XP_009783853.1| PREDICTED: uncharacterized protein LOC104232363 isoform X2 [Nicotiana 
sylvestris]
Length=531

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 22/173 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+  NLSS+ERQSL++LE+I+RCLFSD Q MP  SDEKSLMSRVN
Sbjct  377  DLVSHFEQRFSEQGTSEVINLSSDERQSLQILEDISRCLFSDAQNMP-ESDEKSLMSRVN  435

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNF----ASASVVSERNYEENRpptpd  407
            SLCCL+QKD    TA + EN    A+      E +F    AS + V + +  E++     
Sbjct  436  SLCCLIQKD--HATAHKSENSGYVAVEGNRTDELSFFPVAASVNKVEDPSTTEDK-----  488

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                      +    SMSRKDSVG+LL+NLPRI SLPQFLFNI EDS+Y QAR
Sbjct  489  ---------SNDPTPSMSRKDSVGELLMNLPRIASLPQFLFNIYEDSEY-QAR  531



>ref|XP_009783852.1| PREDICTED: uncharacterized protein LOC104232363 isoform X1 [Nicotiana 
sylvestris]
Length=532

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 22/173 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH EQR SEQ TS+  NLSS+ERQSL++LE+I+RCLFSD Q MP  SDEKSLMSRVN
Sbjct  378  DLVSHFEQRFSEQGTSEVINLSSDERQSLQILEDISRCLFSDAQNMP-ESDEKSLMSRVN  436

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNF----ASASVVSERNYEENRpptpd  407
            SLCCL+QKD    TA + EN    A+      E +F    AS + V + +  E++     
Sbjct  437  SLCCLIQKD--HATAHKSENSGYVAVEGNRTDELSFFPVAASVNKVEDPSTTEDK-----  489

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                      +    SMSRKDSVG+LL+NLPRI SLPQFLFNI EDS+Y QAR
Sbjct  490  ---------SNDPTPSMSRKDSVGELLMNLPRIASLPQFLFNIYEDSEY-QAR  532



>ref|XP_006366262.1| PREDICTED: uncharacterized protein LOC102579955 isoform X2 [Solanum 
tuberosum]
Length=527

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVS LEQR+SEQ TSK  NL+++ER+S E+LEEI++ L SDTQ + ++SDEKSLMSRVN
Sbjct  367  DLVSQLEQRVSEQTTSKVINLANDERRSSEILEEISKSLLSDTQNV-SSSDEKSLMSRVN  425

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TA   EN  +    ++ V E NF   + +   + E+   P+  +D  
Sbjct  426  SLCCLLQKD--PATAHASENCGDVVSDERRVNEINFIPTAPLGREDVED---PSMPEDES  480

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D   C K  ++MSRKDSVGDLLLNLPRI SLP FLF + +DS  +QAR
Sbjct  481  TDLSGC-KPTSTMSRKDSVGDLLLNLPRIASLPHFLF-LCDDSAGNQAR  527



>ref|XP_006366261.1| PREDICTED: uncharacterized protein LOC102579955 isoform X1 [Solanum 
tuberosum]
Length=528

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVS LEQR+SEQ TSK  NL+++ER+S E+LEEI++ L SDTQ + ++SDEKSLMSRVN
Sbjct  368  DLVSQLEQRVSEQTTSKVINLANDERRSSEILEEISKSLLSDTQNV-SSSDEKSLMSRVN  426

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TA   EN  +    ++ V E NF   + +   + E+   P+  +D  
Sbjct  427  SLCCLLQKD--PATAHASENCGDVVSDERRVNEINFIPTAPLGREDVED---PSMPEDES  481

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D   C K  ++MSRKDSVGDLLLNLPRI SLP FLF + +DS  +QAR
Sbjct  482  TDLSGC-KPTSTMSRKDSVGDLLLNLPRIASLPHFLF-LCDDSAGNQAR  528



>gb|EYU21802.1| hypothetical protein MIMGU_mgv1a011461mg [Erythranthe guttata]
Length=281

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 108/170 (64%), Gaps = 23/170 (14%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFN-LSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DLVSHLE R+S+  +S +   LS+EE QS ++LE+INRCLFSD Q MP  SDEK LMSRV
Sbjct  134  DLVSHLENRISKHGSSDNKTPLSTEEWQSFQVLEDINRCLFSDIQNMPG-SDEKLLMSRV  192

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            NSLCCLLQKD       + ++F   ++   G  E N A AS   ++ +E+          
Sbjct  193  NSLCCLLQKD------SKNDSFANASLLQNGANESNNAGASTSGDK-FED----------  235

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                    +  +SM+R DSVGDLLLNLPRI SLPQFLFNI+ED   +QAR
Sbjct  236  ---IYGYDQSTSSMARNDSVGDLLLNLPRIASLPQFLFNISEDFG-NQAR  281



>ref|XP_004241674.1| PREDICTED: uncharacterized protein LOC101256298 isoform X1 [Solanum 
lycopersicum]
Length=527

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 117/169 (69%), Gaps = 9/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVS LEQR+SEQ T K  NL+S+ER S E+LEEI++ L SDTQ + ++SDEKSLMSRVN
Sbjct  368  DLVSQLEQRVSEQTTLKVINLASDERPSSEILEEISQSLLSDTQNV-SSSDEKSLMSRVN  426

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P T Q  EN  +    ++ V E NF   + +  ++ E++   +  +D  
Sbjct  427  SLCCLLQKD--PATVQASENCGD-VSDERRVNEINFIPTAPLGRKDEEDS---SMPEDES  480

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D  +C K  ++MSRKDSVGDLLLNLPRI SLP FLF + +DS  +QAR
Sbjct  481  ADLSSC-KPTSTMSRKDSVGDLLLNLPRIASLPHFLF-LCDDSTGNQAR  527



>ref|XP_010322653.1| PREDICTED: uncharacterized protein LOC101256298 isoform X2 [Solanum 
lycopersicum]
Length=526

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 117/169 (69%), Gaps = 9/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVS LEQR+SEQ T K  NL+S+ER S E+LEEI++ L SDTQ + ++SDEKSLMSRVN
Sbjct  367  DLVSQLEQRVSEQTTLKVINLASDERPSSEILEEISQSLLSDTQNV-SSSDEKSLMSRVN  425

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P T Q  EN  +    ++ V E NF   + +  ++ E++   +  +D  
Sbjct  426  SLCCLLQKD--PATVQASENCGD-VSDERRVNEINFIPTAPLGRKDEEDS---SMPEDES  479

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             D  +C K  ++MSRKDSVGDLLLNLPRI SLP FLF + +DS  +QAR
Sbjct  480  ADLSSC-KPTSTMSRKDSVGDLLLNLPRIASLPHFLF-LCDDSTGNQAR  526



>ref|XP_011073225.1| PREDICTED: uncharacterized protein LOC105158248 [Sesamum indicum]
Length=536

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 105/171 (61%), Gaps = 10/171 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHLE R+SEQ +  +  LSSEE + L++L++INR LFSDTQ MP  SDEKSL+SRVN
Sbjct  374  DLVSHLENRISEQGSLSNPTLSSEEWEGLQILDDINRYLFSDTQNMPD-SDEKSLVSRVN  432

Query  574  SLCCLLQKDPP--PPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD         + +N  + +   +   E N             EN+       
Sbjct  433  SLCCLLQKDTAVDANVQSKTDNCQDTSSVQERADESNGIGVPT------SENKVREKCSI  486

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
               +      Q ASMSRKDSVGDLLLNLPRI SLPQFLFNI+E  + +QAR
Sbjct  487  FQDEFNVIHNQSASMSRKDSVGDLLLNLPRIASLPQFLFNISEGFE-NQAR  536



>gb|EPS69285.1| hypothetical protein M569_05482, partial [Genlisea aurea]
Length=516

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 98/165 (59%), Gaps = 28/165 (17%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSD---TQYMPAASDEKSLMS  584
            DLV+HLE RMSEQ++  + NLS E+ + L+ML++INRCLF D   +  +  A D+KSLMS
Sbjct  372  DLVNHLESRMSEQESPTNPNLSLEDWEGLQMLDDINRCLFGDFHGSNGVVIAPDDKSLMS  431

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQKDP  P +                      S++   +   + +     + 
Sbjct  432  RVNSLCCLLQKDPNNPGSD---------------------SSTPQPQPQPKRDDDDDSNK  470

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                    CS    S+SRKDS+GDLL+NLPRI SLPQFLFNI++D
Sbjct  471  KDDQQQQACS----SISRKDSIGDLLMNLPRIASLPQFLFNISQD  511



>ref|XP_010656631.1| PREDICTED: uncharacterized protein LOC100251901 isoform X2 [Vitis 
vinifera]
Length=495

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 108/174 (62%), Gaps = 15/174 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+E R+SEQ TS +  LS E  +   +LE+I + L SD+ +  AASDEKSLMSRVN
Sbjct  332  DLMNHIENRISEQMTSGNPALSEEGVECQGILEDIAQYLLSDSHFT-AASDEKSLMSRVN  390

Query  574  SLCCLLQKDPPPPTAQRRENFHEPA---MGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            SLCCLLQKDP   + Q  +   E     + +K   + N  S SV       EN+ P    
Sbjct  391  SLCCLLQKDPG--SVQNLQMNGEGCFEELDEKKDVQLNHTSESV------HENKAPGDIT  442

Query  403  dglpddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                D    +  KQ  +MSRKDS GDLLL+LPRITSLP+FLFNI+ED D +QAR
Sbjct  443  VPEGDSKDVTGYKQAPAMSRKDSFGDLLLHLPRITSLPKFLFNISED-DENQAR  495



>gb|EYU24571.1| hypothetical protein MIMGU_mgv1a004911mg [Erythranthe guttata]
Length=504

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 99/170 (58%), Gaps = 49/170 (29%)
 Frame = -1

Query  754  DLVSHLEQRMSEQ----KTSKDFNLSSEERQSLEMLEEINRCLFSD----TQYMPAASDE  599
            DLV+HLE R+SEQ     +S++  LSS+E QSL++L++I RCLF++    +Q+ P A DE
Sbjct  370  DLVNHLEHRISEQGISASSSQNPILSSDEWQSLQILDDIQRCLFTENNNNSQHSPDA-DE  428

Query  598  KSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRp  419
            KSLMSRVNSLCCLLQKD      +R +        D+  G+ N  S              
Sbjct  429  KSLMSRVNSLCCLLQKDKDNDNVKRED--------DENRGDVNGVS--------------  466

Query  418  ptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                              +SMSRKDS GDLLLNLPRI SLPQFLFNI+ED
Sbjct  467  ------------------SSMSRKDSAGDLLLNLPRIASLPQFLFNISED  498



>ref|XP_002274694.1| PREDICTED: uncharacterized protein LOC100251901 isoform X1 [Vitis 
vinifera]
Length=553

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 108/174 (62%), Gaps = 15/174 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+E R+SEQ TS +  LS E  +   +LE+I + L SD+ +  AASDEKSLMSRVN
Sbjct  390  DLMNHIENRISEQMTSGNPALSEEGVECQGILEDIAQYLLSDSHFT-AASDEKSLMSRVN  448

Query  574  SLCCLLQKDPPPPTAQRRENFHEPA---MGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            SLCCLLQKDP   + Q  +   E     + +K   + N  S SV       EN+ P    
Sbjct  449  SLCCLLQKDPG--SVQNLQMNGEGCFEELDEKKDVQLNHTSESV------HENKAPGDIT  500

Query  403  dglpddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                D    +  KQ  +MSRKDS GDLLL+LPRITSLP+FLFNI+ED D +QAR
Sbjct  501  VPEGDSKDVTGYKQAPAMSRKDSFGDLLLHLPRITSLPKFLFNISED-DENQAR  553



>gb|EYU24572.1| hypothetical protein MIMGU_mgv1a004911mg [Erythranthe guttata]
Length=503

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 99/170 (58%), Gaps = 49/170 (29%)
 Frame = -1

Query  754  DLVSHLEQRMSEQ----KTSKDFNLSSEERQSLEMLEEINRCLFSD----TQYMPAASDE  599
            DLV+HLE R+SEQ     +S++  LSS+E QSL++L++I RCLF++    +Q+ P A DE
Sbjct  369  DLVNHLEHRISEQGISASSSQNPILSSDEWQSLQILDDIQRCLFTENNNNSQHSPDA-DE  427

Query  598  KSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRp  419
            KSLMSRVNSLCCLLQKD      +R +        D+  G+ N  S              
Sbjct  428  KSLMSRVNSLCCLLQKDKDNDNVKRED--------DENRGDVNGVS--------------  465

Query  418  ptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                              +SMSRKDS GDLLLNLPRI SLPQFLFNI+ED
Sbjct  466  ------------------SSMSRKDSAGDLLLNLPRIASLPQFLFNISED  497



>dbj|BAD72448.1| unknown protein [Oryza sativa Japonica Group]
Length=299

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 96/169 (57%), Gaps = 26/169 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAA-SDEKSLMSRV  578
            DLV+HL   +SEQ TS +  L S E  + E LEEI + L  D Q  PA+ SDE+SLM+RV
Sbjct  151  DLVNHLGNCISEQITSVNPTLPSNEVPTKETLEEIAQYLLGDAQGPPASTSDERSLMARV  210

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVG----EFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD PP    + E     ++G  G      EF+ A+++V +            
Sbjct  211  DSLCCLIQKDTPPVAQPKPEPNDSDSIGGDGTEGSDEEFSSAASTVKTTG----------  260

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                         Q  +MSRKDS GDLL+NLPRI SLPQFLF I EDS+
Sbjct  261  -----------PAQPPAMSRKDSFGDLLMNLPRIASLPQFLFKIPEDSE  298



>ref|XP_002528397.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33990.1| conserved hypothetical protein [Ricinus communis]
Length=560

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 109/172 (63%), Gaps = 10/172 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+E  +SEQ TS + +LS++  +   +LE+I + L SD Q +  +SDEK LM+RVN
Sbjct  396  DLMNHIENCISEQITSGNPSLSADGSEGQNILEDIAQYLLSDNQ-LTTSSDEKRLMARVN  454

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG--DKGVG-EFNFASASVVSERNYEENRpptpdd  404
            SLCCLLQKDP   ++Q  +   E  +G  D G G + N    S+    N  +N+    D 
Sbjct  455  SLCCLLQKDPA--SSQNSQANEEIYVGESDNGKGVQLNNTYESL----NENKNKGGIKDP  508

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
            +    D++ SKQ   MSRKDS GDLLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  509  ELNTKDVSGSKQVPGMSRKDSFGDLLLHLPRIASLPKFLFNISEEDGESQAR  560



>ref|NP_001057011.1| Os06g0186600 [Oryza sativa Japonica Group]
 dbj|BAF18925.1| Os06g0186600 [Oryza sativa Japonica Group]
 dbj|BAG94307.1| unnamed protein product [Oryza sativa Japonica Group]
Length=472

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 96/169 (57%), Gaps = 26/169 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAA-SDEKSLMSRV  578
            DLV+HL   +SEQ TS +  L S E  + E LEEI + L  D Q  PA+ SDE+SLM+RV
Sbjct  324  DLVNHLGNCISEQITSVNPTLPSNEVPTKETLEEIAQYLLGDAQGPPASTSDERSLMARV  383

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVG----EFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD PP    + E     ++G  G      EF+ A+++V +            
Sbjct  384  DSLCCLIQKDTPPVAQPKPEPNDSDSIGGDGTEGSDEEFSSAASTVKTTG----------  433

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                         Q  +MSRKDS GDLL+NLPRI SLPQFLF I EDS+
Sbjct  434  -----------PAQPPAMSRKDSFGDLLMNLPRIASLPQFLFKIPEDSE  471



>gb|EAZ36075.1| hypothetical protein OsJ_20384 [Oryza sativa Japonica Group]
Length=509

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 97/169 (57%), Gaps = 26/169 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAA-SDEKSLMSRV  578
            DLV+HL   +SEQ TS +  L S E  + E LEEI + L  D Q  PA+ SDE+SLM+RV
Sbjct  361  DLVNHLGNCISEQITSVNPTLPSNEVPTKETLEEIAQYLLGDAQGPPASTSDERSLMARV  420

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVG----EFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD PP    + E     ++G  G      EF+ A+++V +            
Sbjct  421  DSLCCLIQKDTPPVAQPKPEPNDSDSIGGDGTEGSDEEFSSAASTVKT------------  468

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                     T   Q  +MSRKDS GDLL+NLPRI SLPQFLF I EDS+
Sbjct  469  ---------TGPAQPPAMSRKDSFGDLLMNLPRIASLPQFLFKIPEDSE  508



>gb|EAY99950.1| hypothetical protein OsI_21952 [Oryza sativa Indica Group]
Length=525

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 97/169 (57%), Gaps = 26/169 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAA-SDEKSLMSRV  578
            DLV+HL   +SEQ TS +  L S E  + E LEEI + L  D Q  PA+ SDE+SLM+RV
Sbjct  377  DLVNHLGNCISEQITSVNPTLPSNEVPTKETLEEIAQYLLGDAQGPPASTSDERSLMARV  436

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVG----EFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD PP    + E     ++G  G      EF+ A+++V +            
Sbjct  437  DSLCCLIQKDTPPVAQPKPEPNDSDSIGGDGTEGSDEEFSSAASTVKT------------  484

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                     T   Q  +MSRKDS GDLL+NLPRI SLPQFLF I EDS+
Sbjct  485  ---------TGPAQPPAMSRKDSFGDLLMNLPRIASLPQFLFKIPEDSE  524



>ref|XP_006655862.1| PREDICTED: uncharacterized protein LOC102701454 [Oryza brachyantha]
Length=472

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 94/165 (57%), Gaps = 18/165 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAA-SDEKSLMSRV  578
            DLV+HL   +SEQ TS + +L S E  + E LEEI + L  D Q  PA+ SDE+SLM+RV
Sbjct  324  DLVNHLGNCISEQITSVNPSLPSNEVPTKETLEEIAQYLLGDAQGPPASTSDERSLMARV  383

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            +SLCCL+QKD PP    + E     ++G +     +   +S  S R   +          
Sbjct  384  DSLCCLIQKDTPPVAKPKPEPNDSDSIGGEDTEGSDEEFSSAASSRKTTD----------  433

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                     Q  SMSRKDS GDLL+NLPRI SLPQFLF I EDS+
Sbjct  434  -------PAQPPSMSRKDSFGDLLMNLPRIASLPQFLFKIPEDSE  471



>ref|XP_007013889.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31508.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=552

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 103/180 (57%), Gaps = 28/180 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            D +SH+   +SEQ TS   N SSE      EMLEEI + L SDTQ+   ASDEKSLMSRV
Sbjct  390  DFMSHIGHCLSEQMTSG--NPSSENIPDCQEMLEEIAQYLLSDTQFT-TASDEKSLMSRV  446

Query  577  NSLCCLLQKDPPPPTAQRR--ENFHEPAMGD----KGVGEFNF---ASASV-VSERNYEE  428
            NSLCCLLQKD    T  +   EN+  P  G      G  E  F   A+  V  SE + +E
Sbjct  447  NSLCCLLQKDTTTGTNSQGNGENYGGPDDGKDVQLNGSYESGFNITANGDVKTSEGDTKE  506

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                          ++ SKQ   MSRKDS G+LLL+LPRI SLP+FLFNI+ED    QAR
Sbjct  507  --------------VSTSKQAPGMSRKDSFGELLLHLPRIASLPKFLFNISEDDGESQAR  552



>ref|XP_007013890.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31509.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=544

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 103/180 (57%), Gaps = 28/180 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            D +SH+   +SEQ TS   N SSE      EMLEEI + L SDTQ+   ASDEKSLMSRV
Sbjct  382  DFMSHIGHCLSEQMTSG--NPSSENIPDCQEMLEEIAQYLLSDTQFT-TASDEKSLMSRV  438

Query  577  NSLCCLLQKDPPPPTAQRR--ENFHEPAMGD----KGVGEFNF---ASASV-VSERNYEE  428
            NSLCCLLQKD    T  +   EN+  P  G      G  E  F   A+  V  SE + +E
Sbjct  439  NSLCCLLQKDTTTGTNSQGNGENYGGPDDGKDVQLNGSYESGFNITANGDVKTSEGDTKE  498

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                          ++ SKQ   MSRKDS G+LLL+LPRI SLP+FLFNI+ED    QAR
Sbjct  499  --------------VSTSKQAPGMSRKDSFGELLLHLPRIASLPKFLFNISEDDGESQAR  544



>ref|XP_010906671.1| PREDICTED: uncharacterized protein LOC105033515 isoform X1 [Elaeis 
guineensis]
Length=552

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 8/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL   +SEQ  S +  LS +  ++ ++LEEI + L SD+Q + +ASDEKSLMSRVN
Sbjct  392  DLVNHLGHCISEQINSGNPPLSGDGLKTKDILEEITQYLLSDSQ-ISSASDEKSLMSRVN  450

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCL+QKD         +N    + GD  VG+    +AS     +  +     P  +G 
Sbjct  451  SLCCLIQKD-----GGSAQNLQINS-GDGAVGDDVIDNASKAGSTSERKPLFDFPVAEGE  504

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +D    KQ A++SRK+S G+LL++LPRI SLPQFLFNIAED++ +QAR
Sbjct  505  SNDAPGCKQPANISRKESFGELLMHLPRIASLPQFLFNIAEDAE-NQAR  552



>ref|XP_010906672.1| PREDICTED: uncharacterized protein LOC105033515 isoform X2 [Elaeis 
guineensis]
Length=551

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 8/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL   +SEQ  S +  LS +  ++ ++LEEI + L SD+Q + +ASDEKSLMSRVN
Sbjct  391  DLVNHLGHCISEQINSGNPPLSGDGLKTKDILEEITQYLLSDSQ-ISSASDEKSLMSRVN  449

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCL+QKD         +N    + GD  VG+    +AS     +  +     P  +G 
Sbjct  450  SLCCLIQKD-----GGSAQNLQINS-GDGAVGDDVIDNASKAGSTSERKPLFDFPVAEGE  503

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +D    KQ A++SRK+S G+LL++LPRI SLPQFLFNIAED++ +QAR
Sbjct  504  SNDAPGCKQPANISRKESFGELLMHLPRIASLPQFLFNIAEDAE-NQAR  551



>gb|KJB23593.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=344

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 14/173 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL++H+  R+SE  TS+  N SSE R    EMLE+I + L SDTQ+   ASDEKSLMSRV
Sbjct  182  DLMNHIGHRLSEHMTSE--NPSSENRPDCQEMLEDIAQYLLSDTQFT-TASDEKSLMSRV  238

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN---Rpptpd  407
            NSLCCLLQKD    T+ +       A G+   G  +     +     +E N   +     
Sbjct  239  NSLCCLLQKDNTTGTSSQ-------ANGENYDGRDDGKDVQLNRSHGFEFNITGKDDVKA  291

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +G   +++ S+Q   MSRKDS  +LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  292  FEGETKEVSSSRQAPGMSRKDSFSELLLHLPRIASLPKFLFNISEEDGERQAR  344



>gb|KHG03368.1| ATP-dependent DNA helicase pcrA [Gossypium arboreum]
Length=540

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 102/178 (57%), Gaps = 24/178 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL++H+  R+SE  TS+  N SSE R    EMLE+I + L SDTQ+   ASDEKSLMSRV
Sbjct  378  DLMNHIGHRLSEHMTSE--NPSSENRPDCQEMLEDIAQYLLSDTQFT-TASDEKSLMSRV  434

Query  577  NSLCCLLQKDPPPPTAQRR--ENFHEPAMG-----DKGVG-EFNFASASVVSERNYEENR  422
            NSLCCLLQKD    T+ +   EN+     G     ++G G EFN      V     E   
Sbjct  435  NSLCCLLQKDNTTGTSSQANGENYDGGDDGKDVQLNRGHGFEFNITGKDDVKAFEGETKE  494

Query  421  pptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
              +            S+Q   MSRKDS  +LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  495  VSS------------SRQAPGMSRKDSFSELLLHLPRIASLPKFLFNISEEDGERQAR  540



>ref|XP_010265510.1| PREDICTED: uncharacterized protein LOC104603232 [Nelumbo nucifera]
Length=548

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 106/180 (59%), Gaps = 24/180 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDE--------  599
            DLV+H+   +SEQ TS +   SSE  Q+ ++LEEI + L SD+Q+  + SDE        
Sbjct  382  DLVNHIGNCISEQMTSGNPLFSSEGLQNRDVLEEITQYLLSDSQFA-SVSDEQSHARVNS  440

Query  598  KSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRp  419
            +SLMSRVNS CCLLQKD  P T Q  +    P  G  G           +S  +  EN+ 
Sbjct  441  QSLMSRVNSFCCLLQKD--PATIQNNQINSGPDDGKDG---------QTISANSTSENKV  489

Query  418  ptpdddglpddlTC--SKQKASMSRKDSVGD-LLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                  G  +      SKQ+++MSRKDSVGD LLLNLPRI SLPQFLF+I+ED + +QAR
Sbjct  490  LGEIAGGKGESTDVPGSKQQSTMSRKDSVGDLLLLNLPRIASLPQFLFHISEDEE-NQAR  548



>ref|XP_008791339.1| PREDICTED: uncharacterized protein LOC103708273 isoform X2 [Phoenix 
dactylifera]
Length=551

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 108/169 (64%), Gaps = 8/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL   +SEQ  S +  LS +   + +MLEE+ + L SD+Q + +ASDEKSLMSRVN
Sbjct  391  DLVNHLGHCISEQINSGNPLLSGDGLATKDMLEELTQYLLSDSQ-ISSASDEKSLMSRVN  449

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCL+QKD     A   +N  + + GD  VG+    + S     +  +     P  +G 
Sbjct  450  SLCCLIQKD-----AGTAQNL-QISSGDSAVGDDVIDNTSRAGSTSERKPLFDFPAAEGE  503

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +D    KQ A++SRK+S G+LL++LPRI SLPQFLFNI+ED++ +QAR
Sbjct  504  ANDSPGCKQPANISRKESFGELLMHLPRIASLPQFLFNISEDAE-NQAR  551



>ref|XP_008791338.1| PREDICTED: uncharacterized protein LOC103708273 isoform X1 [Phoenix 
dactylifera]
Length=552

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 108/169 (64%), Gaps = 8/169 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL   +SEQ  S +  LS +   + +MLEE+ + L SD+Q + +ASDEKSLMSRVN
Sbjct  392  DLVNHLGHCISEQINSGNPLLSGDGLATKDMLEELTQYLLSDSQ-ISSASDEKSLMSRVN  450

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCL+QKD     A   +N  + + GD  VG+    + S     +  +     P  +G 
Sbjct  451  SLCCLIQKD-----AGTAQNL-QISSGDSAVGDDVIDNTSRAGSTSERKPLFDFPAAEGE  504

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +D    KQ A++SRK+S G+LL++LPRI SLPQFLFNI+ED++ +QAR
Sbjct  505  ANDSPGCKQPANISRKESFGELLMHLPRIASLPQFLFNISEDAE-NQAR  552



>gb|KJB23596.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=451

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 14/173 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL++H+  R+SE  TS+  N SSE R    EMLE+I + L SDTQ+   ASDEKSLMSRV
Sbjct  289  DLMNHIGHRLSEHMTSE--NPSSENRPDCQEMLEDIAQYLLSDTQFT-TASDEKSLMSRV  345

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN---Rpptpd  407
            NSLCCLLQKD    T+ +       A G+   G  +     +     +E N   +     
Sbjct  346  NSLCCLLQKDNTTGTSSQ-------ANGENYDGRDDGKDVQLNRSHGFEFNITGKDDVKA  398

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +G   +++ S+Q   MSRKDS  +LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  399  FEGETKEVSSSRQAPGMSRKDSFSELLLHLPRIASLPKFLFNISEEDGERQAR  451



>gb|KJB23594.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=493

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 14/173 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL++H+  R+SE  TS+  N SSE R    EMLE+I + L SDTQ+   ASDEKSLMSRV
Sbjct  331  DLMNHIGHRLSEHMTSE--NPSSENRPDCQEMLEDIAQYLLSDTQFT-TASDEKSLMSRV  387

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN---Rpptpd  407
            NSLCCLLQKD    T+ +       A G+   G  +     +     +E N   +     
Sbjct  388  NSLCCLLQKDNTTGTSSQ-------ANGENYDGRDDGKDVQLNRSHGFEFNITGKDDVKA  440

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +G   +++ S+Q   MSRKDS  +LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  441  FEGETKEVSSSRQAPGMSRKDSFSELLLHLPRIASLPKFLFNISEEDGERQAR  493



>gb|KJB23592.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=540

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 14/173 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSL-EMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL++H+  R+SE  TS+  N SSE R    EMLE+I + L SDTQ+   ASDEKSLMSRV
Sbjct  378  DLMNHIGHRLSEHMTSE--NPSSENRPDCQEMLEDIAQYLLSDTQFT-TASDEKSLMSRV  434

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN---Rpptpd  407
            NSLCCLLQKD    T+ +       A G+   G  +     +     +E N   +     
Sbjct  435  NSLCCLLQKDNTTGTSSQ-------ANGENYDGRDDGKDVQLNRSHGFEFNITGKDDVKA  487

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +G   +++ S+Q   MSRKDS  +LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  488  FEGETKEVSSSRQAPGMSRKDSFSELLLHLPRIASLPKFLFNISEEDGERQAR  540



>ref|XP_011018078.1| PREDICTED: uncharacterized protein LOC105121219 [Populus euphratica]
Length=561

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 102/174 (59%), Gaps = 13/174 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SEQ TS +   S++  +  ++LE+I + L SDTQ    +SDEK +M+RVN
Sbjct  396  DLMNHIGNCISEQMTSGNQPFSADGSECQDILEDIAQYLLSDTQQT-TSSDEKGIMARVN  454

Query  574  SLCCLLQKDPPPPT--AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRppt---p  410
            SLCCLLQKDP          E+F E +   KGV   N  + S      + EN+       
Sbjct  455  SLCCLLQKDPASTQNLQGNGESFFEESKNGKGV-LLNHTNES------FHENKVRGDIIG  507

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +     D++ SK    MSRKDS GDLLL+LPRI SLP+FLFNI+E+  Y Q R
Sbjct  508  SEGSSSKDISGSKPAPGMSRKDSFGDLLLHLPRIASLPKFLFNISEEDGYSQDR  561



>ref|XP_010227931.1| PREDICTED: uncharacterized protein LOC100821383 isoform X2 [Brachypodium 
distachyon]
Length=471

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 22/166 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHL   ++EQ TS + +L+++E  + E LEEI + L  DTQ   A + ++ LM+RV+
Sbjct  325  DLVSHLGNCINEQITSGNPSLTNDEVPTKESLEEIAQYLLGDTQGPQAPASDERLMARVD  384

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG--DKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD  P T  + E     ++G  D G  +  F+SAS     +            
Sbjct  385  SLCCLLQKDSAPTTKPKPEPNDSESIGGEDSGGSDDEFSSASTRKTAD------------  432

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                    + Q   MSRKDS G+LL+NLPRI S+PQFLF I EDS+
Sbjct  433  --------TSQPPGMSRKDSFGELLMNLPRIASIPQFLFKIPEDSE  470



>ref|XP_011020564.1| PREDICTED: uncharacterized protein LOC105122893 [Populus euphratica]
Length=514

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 104/162 (64%), Gaps = 10/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS +  L   + +S ++L+EI + L  D+Q + +ASDE+SLM+RVN
Sbjct  360  DLVNHIGHCISEQMTSGNSILCGGDIKSSDILDEITQYLLGDSQ-VTSASDEQSLMTRVN  418

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG-DKG--VGEFNFASASVVSERNYEENRpptpdd  404
            SLCCLLQKDP   TA+     H   +  D G  V E N  +AS   + N  E+    P  
Sbjct  419  SLCCLLQKDPG--TARDLHGKHHDNLDMDHGGRVDETNSVTASEC-QSNLAED---FPAP  472

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
            +G   ++TC KQ  +M+RKDSVG+L+LNLPRI SLP FLFN+
Sbjct  473  EGEASNVTCCKQAPAMTRKDSVGELMLNLPRIASLPHFLFNV  514



>ref|XP_006385936.1| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
 gb|ERP63733.1| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
Length=495

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 10/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS +  L   + +S ++L+EI + L  D+Q + +ASDE+SLM+RVN
Sbjct  341  DLVNHIGHCISEQMTSGNSILCGGDIKSSDILDEITQYLLGDSQ-VTSASDEQSLMTRVN  399

Query  574  SLCCLLQKDPPPPT---AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            SLCCLLQKDP        + R+N      G   V E N  SAS    +  E+     P  
Sbjct  400  SLCCLLQKDPGTAWDLQGKCRDNLDMDHGGR--VDETNSVSASECQSKLAED----FPAP  453

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
            +G   ++TC KQ  +M+RKDSVG+L+LNLPRI SLP FLFN+
Sbjct  454  EGEASNVTCCKQAPAMTRKDSVGELMLNLPRIASLPHFLFNV  495



>ref|XP_002324519.2| hypothetical protein POPTR_0018s11180g [Populus trichocarpa]
 gb|EEF03084.2| hypothetical protein POPTR_0018s11180g [Populus trichocarpa]
Length=561

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 105/176 (60%), Gaps = 17/176 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SEQ TS +   S++  +  ++LE+I + L SDTQ    +SDEK +M+RVN
Sbjct  396  DLMNHIGNCISEQMTSGNQPFSADGSECQDILEDIAQYLLSDTQQT-TSSDEKGIMARVN  454

Query  574  SLCCLLQKDPPPPTAQRREN----FHEPAMGDKGVGEFNFASASVVSERNYEENRp---p  416
            SLCCLLQKDP   T   + N    F EP  G KGV   N  + S      + EN+     
Sbjct  455  SLCCLLQKDPAS-TQNLQGNGESFFEEPNNG-KGV-LLNHTNES------FHENKVRGDI  505

Query  415  tpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
            +  +     D++ SK    MSRKDS GDLLL+LPRI SLP+FLFNI+E+  Y Q R
Sbjct  506  SGSEGSSSKDISGSKPAPGMSRKDSFGDLLLHLPRIASLPKFLFNISEEDGYSQDR  561



>gb|KDP38724.1| hypothetical protein JCGZ_04077 [Jatropha curcas]
Length=557

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 102/173 (59%), Gaps = 12/173 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SEQ TS +   S+ E +   +LE+I + L SDTQ +  +SDEK LM+RVN
Sbjct  393  DLMNHIGNCISEQMTSGNPQFSTGESERQYILEDIAQYLLSDTQ-LTTSSDEKRLMARVN  451

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERN--YEENRpptpddd  401
            SLCCLLQKDP   + Q  +   E ++ D      + A    +S  N  ++EN+      D
Sbjct  452  SLCCLLQKDPA--SMQNLQINEESSISD-----LDDAKEVQLSLNNESFQENKNMGDTKD  504

Query  400  glpddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                    S  KQ   MSRKDS GDLLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  505  PEGKLKDVSGSKQTPGMSRKDSFGDLLLHLPRIASLPKFLFNISEEDGESQAR  557



>ref|XP_002512753.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49256.1| conserved hypothetical protein [Ricinus communis]
Length=517

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 100/160 (63%), Gaps = 6/160 (4%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+H+ Q +SEQ T+ +  +  +E +  ++LEEI + L SD Q + +ASDE+SLMSRVN
Sbjct  363  DFVNHIGQCISEQMTTGNPTILDDETKYNDILEEITQYLLSDYQ-LTSASDEQSLMSRVN  421

Query  574  SLCCLLQKDPPPP-TAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKDP      Q R +      GD   GE   A ++ ++    +        +D 
Sbjct  422  SLCCLLQKDPGSARNLQARSSIDLEIDGDGRKGE---AISNTMAACQSKAADGFPLPEDQ  478

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
            L +  +C KQ  +MSRKDS+GDLLLNLPRI SLPQFL+NI
Sbjct  479  LDNVSSC-KQAPAMSRKDSIGDLLLNLPRIASLPQFLYNI  517



>ref|XP_003564178.1| PREDICTED: uncharacterized protein LOC100821383 isoform X1 [Brachypodium 
distachyon]
Length=536

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 22/166 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHL   ++EQ TS + +L+++E  + E LEEI + L  DTQ   A + ++ LM+RV+
Sbjct  390  DLVSHLGNCINEQITSGNPSLTNDEVPTKESLEEIAQYLLGDTQGPQAPASDERLMARVD  449

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG--DKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD  P T  + E     ++G  D G  +  F+SAS     +            
Sbjct  450  SLCCLLQKDSAPTTKPKPEPNDSESIGGEDSGGSDDEFSSASTRKTAD------------  497

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                    + Q   MSRKDS G+LL+NLPRI S+PQFLF I EDS+
Sbjct  498  --------TSQPPGMSRKDSFGELLMNLPRIASIPQFLFKIPEDSE  535



>ref|XP_011033365.1| PREDICTED: uncharacterized protein LOC105131880 [Populus euphratica]
Length=558

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 102/165 (62%), Gaps = 9/165 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+E  +SEQ TS +   S+ + +  ++LE+I +CL SDTQ    +SDEK +M+RVN
Sbjct  393  DLMNHIENCISEQMTSGNQLFSANKSECRDILEDIAQCLLSDTQQT-TSSDEKRIMARVN  451

Query  574  SLCCLLQKDPPPPTAQR--RENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKDP      +   E+F E +   KG+ + N  + S+  E  +   R      +
Sbjct  452  SLCCLLQKDPASTQNLQVNGESFFEESNNGKGL-QLNCTNESL-HENKF---RGDIRGSE  506

Query  400  glpddlTC-SKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
            G      C SKQ   MSRKDS GDLLL+LPRI SL +FLFNI+E+
Sbjct  507  GSSIKDVCGSKQAPGMSRKDSFGDLLLHLPRIASLSKFLFNISEE  551



>ref|XP_011012246.1| PREDICTED: uncharacterized protein LOC105116539 [Populus euphratica]
 ref|XP_011012247.1| PREDICTED: uncharacterized protein LOC105116539 [Populus euphratica]
Length=558

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 102/165 (62%), Gaps = 9/165 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+E  +SEQ TS +   S+ + +  ++LE+I +CL SDTQ    +SDEK +M+RVN
Sbjct  393  DLMNHIENCISEQMTSGNQLFSANKSECRDILEDIAQCLLSDTQQT-TSSDEKRIMARVN  451

Query  574  SLCCLLQKDPPPPTAQR--RENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKDP      +   E+F E +   KG+ + N  + S+  E  +   R      +
Sbjct  452  SLCCLLQKDPASTQNLQVNGESFFEESNNGKGL-QLNCTNESL-HENKF---RGDIRGSE  506

Query  400  glpddlTC-SKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
            G      C SKQ   MSRKDS GDLLL+LPRI SL +FLFNI+E+
Sbjct  507  GSSIKDVCGSKQAPGMSRKDSFGDLLLHLPRIASLSKFLFNISEE  551



>ref|XP_011034585.1| PREDICTED: uncharacterized protein LOC105132669 isoform X4 [Populus 
euphratica]
Length=454

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+ +   +SEQ TS +F+LS  + +S ++L+EI + L  D+Q M +ASDE+S+MS VN
Sbjct  300  DLVNQIGHCISEQMTSGNFSLSGGDIKSSDILDEITQYLLGDSQAM-SASDEQSVMSSVN  358

Query  574  SLCCLLQKDPPPPT-AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKDP      Q +   +     D+ + E N A+ASV   +  E      P  +G
Sbjct  359  SLCCLLQKDPATAWDLQAKSLSYLDVDHDRRINETNSATASVCQGKFVE----GFPPPEG  414

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFN  281
               ++   KQ  +MSRKDSVG+LLLNLP I SLPQ LFN
Sbjct  415  EASNVFICKQAPAMSRKDSVGELLLNLPSIASLPQLLFN  453



>ref|XP_007023516.1| Uncharacterized protein TCM_027550 [Theobroma cacao]
 gb|EOY26138.1| Uncharacterized protein TCM_027550 [Theobroma cacao]
Length=526

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 106/174 (61%), Gaps = 20/174 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS     S+++ Q  ++LEEI + L +D+ +  +ASDE+ LM+RVN
Sbjct  368  DLVNHIGNCISEQMTS-----SNDDLQGQDILEEITQYLLNDSLHA-SASDEQCLMARVN  421

Query  574  SLCCLLQKD----PPPPTAQRRE-NFHEPAMGDKGVGEFNFASASVVSERNYEENRpptp  410
            SLCCLLQKD    P  PT +    + H     D G    N   +SV +     +     P
Sbjct  422  SLCCLLQKDSAVAPDFPTKKDVAVDVH-----DHGK---NVEGSSVSAAARESKTAESFP  473

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                  +D++ SK+  +MSRKDSVGDLLLNLPRI SLPQFLFNI EDSD  QAR
Sbjct  474  VSMDESNDVSNSKRPQAMSRKDSVGDLLLNLPRIASLPQFLFNIMEDSDI-QAR  526



>ref|XP_010655141.1| PREDICTED: uncharacterized protein LOC100262159 isoform X2 [Vitis 
vinifera]
Length=501

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 100/168 (60%), Gaps = 23/168 (14%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ +S +    S+E  + ++LE+I + +F+D Q + +ASDE+S+MSRVN
Sbjct  348  DLVSHIGHCLSEQTSSCNPIFPSDEPLNQDILEQITQYMFNDAQ-LSSASDEQSIMSRVN  406

Query  574  SLCCLLQKDPPPPT--AQRRENFHEPAMGDKGVGEFNFASASVVSER-------NYEENR  422
            SLCCLLQ  P        + EN  + A GD  +GE N  +AS  S+        N E N 
Sbjct  407  SLCCLLQNKPAAVQNFQVKSENGTDTA-GDGSIGELNPIAASCESKTAGDFPTPNDETND  465

Query  421  pptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
              +             KQ  +MSRKDSVG+LL+NLPRI SLPQFLFN+
Sbjct  466  VSS------------CKQPPAMSRKDSVGELLVNLPRIASLPQFLFNM  501



>ref|XP_011034581.1| PREDICTED: uncharacterized protein LOC105132669 isoform X1 [Populus 
euphratica]
Length=512

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+ +   +SEQ TS +F+LS  + +S ++L+EI + L  D+Q M +ASDE+S+MS VN
Sbjct  358  DLVNQIGHCISEQMTSGNFSLSGGDIKSSDILDEITQYLLGDSQAM-SASDEQSVMSSVN  416

Query  574  SLCCLLQKDPPPPT-AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKDP      Q +   +     D+ + E N A+ASV   +  E      P  +G
Sbjct  417  SLCCLLQKDPATAWDLQAKSLSYLDVDHDRRINETNSATASVCQGKFVE----GFPPPEG  472

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFN  281
               ++   KQ  +MSRKDSVG+LLLNLP I SLPQ LFN
Sbjct  473  EASNVFICKQAPAMSRKDSVGELLLNLPSIASLPQLLFN  511



>gb|KDO55394.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55395.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55396.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=291

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    +S ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  131  DLMNHIGNCISERRTSGTSMISDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  189

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  190  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  243

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +L  NLPRI SLPQFLFNI+
Sbjct  244  GDPSDTSGCKPAPGMSRKDSIAELFHNLPRIASLPQFLFNIS  285



>ref|XP_004954196.1| PREDICTED: uncharacterized protein LOC101774512 isoform X1 [Setaria 
italica]
Length=504

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 99/164 (60%), Gaps = 17/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL   + EQ+++ D  L++ E QS E+LE + + LFSDTQ +PA SD+K LM+RV+
Sbjct  358  DLVNHLGDCIGEQRSAGDPPLANNEGQSKEVLEGLVQYLFSDTQGLPA-SDDKYLMARVD  416

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL  LL+KD  P T  +      P   D G    N     V S+ + EE       +   
Sbjct  417  SLYSLLEKDTAPSTIPK------PECSDGG----NIGVIQVDSDGSDEE------LNSSP  460

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              +   S ++ ++SRKDS G+LLLNLPRI S+PQFLF+I EDSD
Sbjct  461  ARNTAGSTERPAISRKDSFGELLLNLPRIASIPQFLFHIPEDSD  504



>ref|XP_010655140.1| PREDICTED: uncharacterized protein LOC100262159 isoform X1 [Vitis 
vinifera]
Length=531

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 9/161 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ +S +    S+E  + ++LE+I + +F+D Q + +ASDE+S+MSRVN
Sbjct  378  DLVSHIGHCLSEQTSSCNPIFPSDEPLNQDILEQITQYMFNDAQ-LSSASDEQSIMSRVN  436

Query  574  SLCCLLQKDPPPPT--AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQ  P        + EN  + A GD  +GE N  +AS  S+   +        +D
Sbjct  437  SLCCLLQNKPAAVQNFQVKSENGTDTA-GDGSIGELNPIAASCESKTAGD----FPTPND  491

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
               D  +C KQ  +MSRKDSVG+LL+NLPRI SLPQFLFN+
Sbjct  492  ETNDVSSC-KQPPAMSRKDSVGELLVNLPRIASLPQFLFNM  531



>ref|XP_010268524.1| PREDICTED: uncharacterized protein LOC104605439 [Nelumbo nucifera]
Length=560

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 101/179 (56%), Gaps = 17/179 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS +   S EE Q+ ++LEEI +CL  D+Q + + SD++SLMSRVN
Sbjct  389  DLVNHIGNCLSEQMTSGNSLFSDEELQNRDVLEEIAQCLLGDSQ-LASGSDDQSLMSRVN  447

Query  574  ---------SLCCLLQKDPP-PPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN  425
                     S CCLLQKDP      Q  ++   P  G  G       S    +  N    
Sbjct  448  SQSLISRVDSFCCLLQKDPAFAQNNQGNDDLDGPDDGKDG----QPISVPDSTCENKVLG  503

Query  424  RpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                       D   C KQ+ S+SRKDSVGDLLLNLPRI SLPQFLF+I+ED + +QAR
Sbjct  504  DDTPATKGESNDVSGC-KQQPSISRKDSVGDLLLNLPRIASLPQFLFHISEDGE-NQAR  560



>ref|XP_010111118.1| hypothetical protein L484_008495 [Morus notabilis]
 gb|EXC30164.1| hypothetical protein L484_008495 [Morus notabilis]
Length=534

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 100/172 (58%), Gaps = 31/172 (18%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL+SH+E  +SEQ TS + + ++++ +  +MLE+I + L SD Q +  ASDE SLM+RVN
Sbjct  389  DLMSHIENCISEQITSGNPSSANQQSEYQDMLEDIAQYLLSDNQ-LTTASDENSLMTRVN  447

Query  574  SLCCLLQKDPPPPTAQRR----ENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpd  407
            SLCCLLQKDP   T Q+     E+  E   G KG+            E + ++N      
Sbjct  448  SLCCLLQKDPS--TLQQSQADGESCVEGPAGGKGI----------APEEDVKDNLN----  491

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQA  251
                       KQ   MSRKDS G+LLL+LPRI SLP+FLFNI+E+    Q+
Sbjct  492  ----------GKQAQGMSRKDSFGELLLHLPRIASLPKFLFNISEEDGESQS  533



>ref|XP_008452508.1| PREDICTED: uncharacterized protein LOC103493516 [Cucumis melo]
Length=532

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 97/162 (60%), Gaps = 11/162 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ T+ + + +++  +  ++LE+I + L +D Q     SDEKSLM RVN
Sbjct  378  DLVNHIGHCISEQMTAANPSFANQGPEYQDILEDITQYLLNDNQS--TTSDEKSLMKRVN  435

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP  PT Q    F++ + G+   G  N    +++        R         
Sbjct  436  SLCCLLQKDPTNPTTQNSL-FNDESRGEGPDGRKNDKVGNIL--------RGDIKAFGED  486

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
              D + +KQ   MSRKDS G+LLL+LPRI S+P+FLFNI+E+
Sbjct  487  VKDNSGTKQAVGMSRKDSFGELLLHLPRIASIPKFLFNISEE  528



>ref|XP_009418539.1| PREDICTED: uncharacterized protein LOC103998710 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=479

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 93/164 (57%), Gaps = 17/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+ +  R+SEQ +  +  LS       EMLEE+ +CLFSD+Q   + SDEKS+MS+VN
Sbjct  328  DFVNQIGHRISEQISLGNPQLSGSVIPDKEMLEELAQCLFSDSQM--STSDEKSVMSKVN  385

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            S CCLLQKD     +Q+ +       G     E  F +   +SE++    +    D  G 
Sbjct  386  SFCCLLQKDVGTVDSQQTDG------GGPAANENGFCNN--ISEKHTSITKGEINDVPG-  436

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                   K  ASMSRKDS  DLL+ LPRI SLPQFLFNIAED D
Sbjct  437  ------PKAVASMSRKDSFSDLLMQLPRIASLPQFLFNIAEDED  474



>gb|KDO55392.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55393.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=340

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    +S ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  180  DLMNHIGNCISERRTSGTSMISDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  238

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  239  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  292

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +L  NLPRI SLPQFLFNI+
Sbjct  293  GDPSDTSGCKPAPGMSRKDSIAELFHNLPRIASLPQFLFNIS  334



>ref|XP_009418538.1| PREDICTED: uncharacterized protein LOC103998710 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 93/164 (57%), Gaps = 17/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+ +  R+SEQ +  +  LS       EMLEE+ +CLFSD+Q   + SDEKS+MS+VN
Sbjct  380  DFVNQIGHRISEQISLGNPQLSGSVIPDKEMLEELAQCLFSDSQM--STSDEKSVMSKVN  437

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            S CCLLQKD     +Q+ +       G     E  F +   +SE++    +    D  G 
Sbjct  438  SFCCLLQKDVGTVDSQQTDG------GGPAANENGFCNN--ISEKHTSITKGEINDVPG-  488

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                   K  ASMSRKDS  DLL+ LPRI SLPQFLFNIAED D
Sbjct  489  ------PKAVASMSRKDSFSDLLMQLPRIASLPQFLFNIAEDED  526



>gb|KDO55371.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55372.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55373.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55374.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55375.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55376.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55377.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55378.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55379.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55380.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55381.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55382.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55383.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55384.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55385.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55386.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=460

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    +S ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  300  DLMNHIGNCISERRTSGTSMISDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  358

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  359  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  412

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +L  NLPRI SLPQFLFNI+
Sbjct  413  GDPSDTSGCKPAPGMSRKDSIAELFHNLPRIASLPQFLFNIS  454



>gb|KDO55369.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55370.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=459

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    +S ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  299  DLMNHIGNCISERRTSGTSMISDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  357

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  358  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  411

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +L  NLPRI SLPQFLFNI+
Sbjct  412  GDPSDTSGCKPAPGMSRKDSIAELFHNLPRIASLPQFLFNIS  453



>gb|KDO55387.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55388.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55389.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55390.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55391.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=378

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    +S ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  218  DLMNHIGNCISERRTSGTSMISDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  276

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  277  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  330

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +L  NLPRI SLPQFLFNI+
Sbjct  331  GDPSDTSGCKPAPGMSRKDSIAELFHNLPRIASLPQFLFNIS  372



>ref|XP_006493461.1| PREDICTED: uncharacterized protein LOC102624004 isoform X1 [Citrus 
sinensis]
Length=510

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 93/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    ++ ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  350  DLMNHIGNCISERRTSGTSMITDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  408

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  409  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  462

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +LL NLPRI SLPQFLFNI+
Sbjct  463  GDPSDISGCKPAPGMSRKDSIAELLHNLPRIASLPQFLFNIS  504



>ref|XP_006427676.1| hypothetical protein CICLE_v10027000mg [Citrus clementina]
 gb|ESR40916.1| hypothetical protein CICLE_v10027000mg [Citrus clementina]
Length=510

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SE++TS    +S ++ Q+ E+L+EI + L SD Q+  AASDEKSLMSRVN
Sbjct  350  DLMNHIGNCISERRTSGTSMISDDDLQAKEILDEITQYLLSDAQFT-AASDEKSLMSRVN  408

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ        Q + N      GD  + E N +S S        EN+         
Sbjct  409  SLCCLLQDSTVAQNTQAQSNEGINIHGDGNIRETNSSSVSAC------ENKVGKGFCGPN  462

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
             D    S  K    MSRKDS+ +L  NLPRI SLPQFLFNI+
Sbjct  463  GDPSDTSGCKPAPGMSRKDSIAELFHNLPRIASLPQFLFNIS  504



>gb|EMT26553.1| hypothetical protein F775_08200 [Aegilops tauschii]
Length=471

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 96/166 (58%), Gaps = 21/166 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHL   +SEQ TS + ++++ E  + E LEEI + L  D Q   A + ++ LM+RV+
Sbjct  324  DLVSHLGNCISEQITSGNPSMANNEVPTKESLEEIAQYLLGDAQGPQAPASDERLMARVD  383

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG--DKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD  P +  + E     ++G  D    +  F+SAS  + +  + N        
Sbjct  384  SLCCLLQKDTAPVSQPKPEPNDSGSIGGVDSEGSDDEFSSAS--TRKTADAN--------  433

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                     +Q  +MSRKDS GDLL+NLPRI S+PQFLF I EDS+
Sbjct  434  ---------QQPPAMSRKDSFGDLLMNLPRIASIPQFLFKIPEDSE  470



>ref|XP_010094072.1| hypothetical protein L484_018088 [Morus notabilis]
 gb|EXB55162.1| hypothetical protein L484_018088 [Morus notabilis]
Length=518

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 100/173 (58%), Gaps = 20/173 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SE+ TS +     +++    +LE+I + LFSD+Q+    SDE+SL+SRVN
Sbjct  362  DLVSHIGHCLSEKITSSNLVFPGKQQNERGVLEDITQYLFSDSQHS-WPSDEQSLVSRVN  420

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGD----KGVGEFNFASASVVSERNYEENRpptpd  407
            SLCCLLQ+DP   ++Q  +   E  +GD     G G        +   +    N      
Sbjct  421  SLCCLLQRDPS--SSQLCKLNPEEKIGDINSISGSGNEGKGLQGIPESKRMNSN------  472

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                 D   C KQ   MSRKDS GDLLL+LPRI SLPQFLFN+++DS  +QAR
Sbjct  473  -----DVSDC-KQAQVMSRKDSFGDLLLSLPRIASLPQFLFNLSQDS-ANQAR  518



>ref|XP_002299157.1| hypothetical protein POPTR_0001s03330g [Populus trichocarpa]
 gb|EEE83962.1| hypothetical protein POPTR_0001s03330g [Populus trichocarpa]
Length=510

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 102/160 (64%), Gaps = 7/160 (4%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS +  LS  + +S ++L+EI + L  D+Q M +ASDE+S++S VN
Sbjct  357  DLVNHIGHCISEQMTSGNSILSGGDIKSSDILDEITQYLLGDSQVM-SASDEQSVVSTVN  415

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG-DKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKDP      + ++  +  +  D+ + E N ++AS    +  E      P  +G
Sbjct  416  SLCCLLQKDPATARDLQAKSLSDLDVDHDRRINETN-STASACQSKFIES----FPAPEG  470

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
               +++  KQ  +MSRKDSVG+LLLNLP I SLPQFLFNI
Sbjct  471  EASNVSICKQAPAMSRKDSVGELLLNLPSIASLPQFLFNI  510



>ref|XP_002309367.2| hypothetical protein POPTR_0006s19420g [Populus trichocarpa]
 gb|EEE92890.2| hypothetical protein POPTR_0006s19420g [Populus trichocarpa]
Length=539

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 97/169 (57%), Gaps = 25/169 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   +SEQ TS +   S+ E +  ++LE+I +CL SDTQ    +SDEK +M+RVN
Sbjct  392  DLMNHIGNCISEQMTSGNQLFSANESECRDILEDIAQCLLSDTQQT-TSSDEKRIMARVN  450

Query  574  SLCCLLQKDPPPP--TAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKDP          E+F E +   KG+ + N  +                    
Sbjct  451  SLCCLLQKDPASTQNLEVNGESFFEESNNGKGL-QLNCTN--------------------  489

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQ  254
                D++ SKQ   MSRKDS GDLLL+LPRI SLP+ LFNI+E+   +Q
Sbjct  490  -DIKDVSGSKQALGMSRKDSFGDLLLHLPRIASLPKLLFNISEEDGDNQ  537



>ref|XP_008342829.1| PREDICTED: uncharacterized protein LOC103405596 [Malus domestica]
 ref|XP_008362425.1| PREDICTED: uncharacterized protein LOC103426114 [Malus domestica]
Length=496

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 83/141 (59%), Gaps = 7/141 (5%)
 Frame = -1

Query  694  LSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPP-TAQRRE  518
            +S +E+ S +MLEEI + LFSD+Q +P  SDE+SLMSRVNSL CLLQKDP      Q R 
Sbjct  362  ISGKEQPSSDMLEEITQYLFSDSQ-LPLPSDEQSLMSRVNSLYCLLQKDPSADLNLQARS  420

Query  517  NFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSV  338
            +       D+   E N ASAS      YE                +  KQ+ +M R+DS 
Sbjct  421  DDWSNGSNDRKAAETNSASASA-----YESKPVEGFPAPKGEPKDSDGKQEPTMPRRDSF  475

Query  337  GDLLLNLPRITSLPQFLFNIA  275
            G+LLLNLPRI SLP FLFN++
Sbjct  476  GELLLNLPRIASLPHFLFNLS  496



>ref|XP_004144718.1| PREDICTED: uncharacterized protein LOC101216574 [Cucumis sativus]
 gb|KGN61066.1| hypothetical protein Csa_2G036640 [Cucumis sativus]
Length=532

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 96/162 (59%), Gaps = 11/162 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ T+ + + +++  +  ++LE+I + L +D Q     SDEKSLM RVN
Sbjct  378  DLVNHIGHCISEQMTAANSSFANQGPEYQDILEDITQYLLNDNQS--TTSDEKSLMKRVN  435

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP  PT Q    F++ +  +      N    +++        R         
Sbjct  436  SLCCLLQKDPANPTTQNSL-FNDESRVEGPDSRKNDKVGNIL--------RGDVKAFGED  486

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
              D + +KQ   MSRKDS G+LLL+LPRITS+P+FLFNI+E+
Sbjct  487  VKDNSGTKQAVGMSRKDSFGELLLHLPRITSIPKFLFNISEE  528



>ref|XP_002437983.1| hypothetical protein SORBIDRAFT_10g005890 [Sorghum bicolor]
 gb|EER89350.1| hypothetical protein SORBIDRAFT_10g005890 [Sorghum bicolor]
Length=472

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 93/165 (56%), Gaps = 19/165 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP-AASDEKSLMSRV  578
            DLVSHL   +SEQ TS +  L++ E  + E LE I + L  DTQ  P +ASDE+SLM+RV
Sbjct  325  DLVSHLGNCISEQITSGNPALANNEVPTKETLEGIAQYLLGDTQGPPVSASDERSLMARV  384

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            +SLCCL+QKD  P    + E     ++G         A AS  S+  +       P D  
Sbjct  385  DSLCCLIQKDTVPVAKPKPEPNDSDSIG---------AEASDGSDEEFSSAPTGKPTD--  433

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                   +    +MSRKDS G+LL NLPRI SLPQFLF I ED++
Sbjct  434  -------ATNPPAMSRKDSFGELLTNLPRIASLPQFLFKIPEDTE  471



>gb|ADB08053.1| putative protein [Triticum aestivum]
Length=530

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 21/166 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHL   +SEQ TS + ++++ E  + E LEEI + L  D Q   A + ++ LM+RV+
Sbjct  383  DLVSHLGNCISEQITSGNPSMANNEVPTKESLEEIAQYLLGDVQGPQAPASDERLMARVD  442

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMG--DKGVGEFNFASASVVSERNYEENRpptpddd  401
            SLCCLLQKD  P +  + E  +  ++G  D    +  F+SAS  + +  + N+P      
Sbjct  443  SLCCLLQKDTAPTSQPKSELNNSDSIGGVDSEGSDDEFSSAS--TRKTADANQP------  494

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                         +MSRKDS GDLL+NLPRI S+PQFLF I EDS+
Sbjct  495  -----------PPAMSRKDSFGDLLMNLPRIASIPQFLFKIPEDSE  529



>ref|XP_009354222.1| PREDICTED: uncharacterized protein LOC103945389 [Pyrus x bretschneideri]
Length=497

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 89/142 (63%), Gaps = 8/142 (6%)
 Frame = -1

Query  694  LSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPT--AQRR  521
            +S +E+ S +MLEEI + LFSD+Q +P  SDE+SLMSRVNSL CLLQKDP        R 
Sbjct  362  ISGKEQPSSDMLEEITQYLFSDSQ-LPLPSDEQSLMSRVNSLYCLLQKDPSTDLNLQARS  420

Query  520  ENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDS  341
            +++   + G K   E N ASAS    +  E      P   G P D +  KQ+ +M R+DS
Sbjct  421  DDWSNGSNGRKAA-ETNSASASAYESKQVE----GFPAPKGEPKDDSGDKQEVTMPRRDS  475

Query  340  VGDLLLNLPRITSLPQFLFNIA  275
             GDLLLNLPRI SLP FLFN++
Sbjct  476  FGDLLLNLPRIASLPHFLFNLS  497



>gb|EMS68538.1| hypothetical protein TRIUR3_33455 [Triticum urartu]
Length=532

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 93/164 (57%), Gaps = 17/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHL   +SEQ TS + ++++ E  + E LEEI + L  D Q   A + ++ LM+RV+
Sbjct  385  DLVSHLGNCISEQITSGNPSMANNEVPTKESLEEIAQYLLGDAQGPQAPASDERLMARVD  444

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD   PTAQ +     P   D G      +   V SE + +E           
Sbjct  445  SLCCLLQKD-TAPTAQPK-----PEPNDSG------SIGGVDSEGSDDE-----FSSAST  487

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                  ++   +MSRKDS GDLL+NLPRI S+PQFLF I EDS+
Sbjct  488  RKTADANQPPPAMSRKDSFGDLLMNLPRIASIPQFLFKIPEDSE  531



>dbj|BAJ98844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 92/164 (56%), Gaps = 17/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSHL   +SEQ TS + ++++    + E LEEI + L  D Q   A + ++ LM+RV+
Sbjct  382  DLVSHLGNCISEQITSGNPSMANNVVPTKESLEEIAQYLLGDAQGPQAPASDERLMARVD  441

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD   PTAQ +    EP       GE +  S    S  +  EN          
Sbjct  442  SLCCLLQKD-AAPTAQPKP---EPNNSGSIGGEDSEGSDDEFSSASTREN----------  487

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                  ++   +MSRKDS GDLL+NLPRI S+PQFLF I EDS+
Sbjct  488  ---ADANQPPPAMSRKDSFGDLLMNLPRIASIPQFLFKIPEDSE  528



>ref|XP_010687332.1| PREDICTED: uncharacterized protein LOC104901445 [Beta vulgaris 
subsp. vulgaris]
Length=524

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 92/159 (58%), Gaps = 9/159 (6%)
 Frame = -1

Query  757  GDLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            GDLV+H+   +SEQ  S   NLS +E Q  E+LE+I + L +D+Q +  +SDEKS+MSRV
Sbjct  363  GDLVNHIGDCISEQMRSDHPNLSIDETQKWEILEDITQYLLNDSQTL-TSSDEKSIMSRV  421

Query  577  NSLCCLLQKDPPPPTAQR--RENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            NSLCCLLQK+       R   EN  +PA G   + E    +  +  +R  +         
Sbjct  422  NSLCCLLQKEDTGVQHARFSSENVPDPAAG--SIQEDMNPANQLCGKRTAK----SVYAT  475

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFL  287
                     S+Q  SMSRKDS+ +LLL+LPRI SLPQFL
Sbjct  476  GTEIGLSNDSQQGTSMSRKDSIDELLLHLPRIASLPQFL  514



>ref|XP_010927930.1| PREDICTED: uncharacterized protein LOC105049857 isoform X3 [Elaeis 
guineensis]
Length=505

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ  S +  L  +   + ++LEEI + L SD+Q + ++SDE+SLMSRVN
Sbjct  327  DLVNHIGYCISEQINSGNPLLYGDNLATKDVLEEITQYLLSDSQIL-SSSDERSLMSRVN  385

Query  574  SLCCLLQKDPPPPTAQRRE-NFHEPAMGDKGVGE-------------FNFASASVVSERN  437
            SLCCL+QKD    TAQ  + N  + A GD                  F+F + S     +
Sbjct  386  SLCCLIQKDAG--TAQSLQINNGDSAAGDDVTDNASKPGSTSERKPLFDFPATSKSGSTS  443

Query  436  YEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              +     P  +   +D +  KQ+ ++SRK+S G+LL++LPRI SLPQFLFNI+EDS+
Sbjct  444  ERKPLFDLPATEEESNDASGCKQQVNISRKESFGELLMHLPRIASLPQFLFNISEDSE  501



>ref|XP_008443833.1| PREDICTED: uncharacterized protein LOC103487331 isoform X4 [Cucumis 
melo]
Length=534

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 99/164 (60%), Gaps = 15/164 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKD---FNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLV+H+   ++EQ  S      +  SEE Q+  ML++I + L SD Q + A SDE SLMS
Sbjct  377  DLVNHIGHHITEQMASTKTPFVDDGSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMS  433

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQK+P   +    EN+ E    +K   +  + +A +   +N EE+       
Sbjct  434  RVNSLCCLLQKEPVQSSQTNGENYDE-GPNNKDDTQLKY-TAELRDGKNIEEH-------  484

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
              +    + S Q +SMSRKDS G+LLL+LPRI SLP+FLF+I++
Sbjct  485  INIQPTDSGSIQASSMSRKDSYGELLLHLPRIASLPKFLFDISD  528



>ref|XP_008462951.1| PREDICTED: uncharacterized protein LOC103501212 [Cucumis melo]
Length=516

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 92/165 (56%), Gaps = 17/165 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+H+E  +S+Q T      S E +QS E LE I + LF D+Q  P+ SDE+++M+RVN
Sbjct  364  DFVNHIEHCLSQQMTPNGSMFSEENQQSREALEGITQYLFGDSQN-PSDSDEQTIMARVN  422

Query  574  SLCCLLQKDP-PPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKD     T Q +        G+  +    + + +   E    E  P       
Sbjct  423  SLCCLLQKDSCMAKTLQTK-------AGNNSLDVNTYPTTASEYEIMSREGLPAHDGFQ-  474

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                   S +  +MSR DSVG+LLLNLPRI SLPQFLFN+ +DSD
Sbjct  475  -------SSKHIAMSRNDSVGELLLNLPRIASLPQFLFNLFDDSD  512



>ref|XP_008443832.1| PREDICTED: uncharacterized protein LOC103487331 isoform X3 [Cucumis 
melo]
Length=536

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 15/164 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNL---SSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLV+H+   ++EQ  S         SEE Q+  ML++I + L SD Q + A SDE SLMS
Sbjct  379  DLVNHIGHHITEQMASTKTPFVDDGSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMS  435

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQK+P   +    EN+ E    +K   +  + +A +   +N EE+       
Sbjct  436  RVNSLCCLLQKEPVQSSQTNGENYDE-GPNNKDDTQLKY-TAELRDGKNIEEH-------  486

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
              +    + S Q +SMSRKDS G+LLL+LPRI SLP+FLF+I++
Sbjct  487  INIQPTDSGSIQASSMSRKDSYGELLLHLPRIASLPKFLFDISD  530



>ref|XP_008443831.1| PREDICTED: uncharacterized protein LOC103487331 isoform X2 [Cucumis 
melo]
Length=548

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 15/164 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNL---SSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLV+H+   ++EQ  S         SEE Q+  ML++I + L SD Q + A SDE SLMS
Sbjct  391  DLVNHIGHHITEQMASTKTPFVDDGSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMS  447

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQK+P   +    EN+ E    +K   +  + +A +   +N EE+       
Sbjct  448  RVNSLCCLLQKEPVQSSQTNGENYDE-GPNNKDDTQLKY-TAELRDGKNIEEH-------  498

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
              +    + S Q +SMSRKDS G+LLL+LPRI SLP+FLF+I++
Sbjct  499  INIQPTDSGSIQASSMSRKDSYGELLLHLPRIASLPKFLFDISD  542



>ref|XP_008443830.1| PREDICTED: uncharacterized protein LOC103487331 isoform X1 [Cucumis 
melo]
Length=549

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 15/164 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNL---SSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLV+H+   ++EQ  S         SEE Q+  ML++I + L SD Q + A SDE SLMS
Sbjct  392  DLVNHIGHHITEQMASTKTPFVDDGSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMS  448

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQK+P   +    EN+ E    +K   +  + +A +   +N EE+       
Sbjct  449  RVNSLCCLLQKEPVQSSQTNGENYDE-GPNNKDDTQLKY-TAELRDGKNIEEH-------  499

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
              +    + S Q +SMSRKDS G+LLL+LPRI SLP+FLF+I++
Sbjct  500  INIQPTDSGSIQASSMSRKDSYGELLLHLPRIASLPKFLFDISD  543



>ref|XP_003525940.1| PREDICTED: uncharacterized protein LOC100792008 [Glycine max]
Length=533

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 21/169 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D +  +E  ++EQ TS +   S    +  E+LE+I + L +D Q + A SDEKSLMSRVN
Sbjct  386  DFIGQIELCLTEQITSGNPPFSDGGSEYKEILEDIAQHLLNDNQ-VAATSDEKSLMSRVN  444

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP        +N H           F   S++V    + ++ +P   +    
Sbjct  445  SLCCLLQKDP-----VTVQNSH-----------FTEDSSTVEGPHDGKDVKPGAEEPKDT  488

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                   KQ   MSRKDS  DLLL+LPRITSLP+FLFNI+E+ D   A+
Sbjct  489  SG----GKQALGMSRKDSFSDLLLHLPRITSLPKFLFNISEEDDDSHAK  533



>ref|XP_004137649.1| PREDICTED: uncharacterized protein LOC101216149 [Cucumis sativus]
 ref|XP_004161411.1| PREDICTED: uncharacterized protein LOC101227277 [Cucumis sativus]
 gb|KGN58644.1| hypothetical protein Csa_3G710230 [Cucumis sativus]
Length=516

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 89/164 (54%), Gaps = 15/164 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+H+E  +S+Q T      S E +QS E LE I + LF D+Q  P+ SDE+++MSRVN
Sbjct  364  DFVNHIEHCLSQQMTPNGSMFSEENQQSREALEGITQYLFGDSQN-PSDSDEQTIMSRVN  422

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD          +     +  K        +    +   YE        +   
Sbjct  423  SLCCLLQKD----------SCMAKTLQTKAANNSLDVNTYPTTASEYE----TMSREGLP  468

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              D   S +  +MSR DSVG+LLLNLPRI SLPQFLFN+ +DSD
Sbjct  469  AHDGFQSSKHIAMSRNDSVGELLLNLPRIASLPQFLFNLFDDSD  512



>ref|XP_004146718.1| PREDICTED: uncharacterized protein LOC101219584 [Cucumis sativus]
Length=534

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 95/164 (58%), Gaps = 16/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNL---SSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLV+H+   ++EQ  S         SEE Q+  ML++I + L SD Q + A SDE SLMS
Sbjct  378  DLVNHIGHHITEQMASTKTPFVDDGSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMS  434

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQK+P   +    EN+  P   D    + N   A +   +N EE        
Sbjct  435  RVNSLCCLLQKEPVQSSQTNGENYDGPNNKDDAQLKDN---AELRDGKNIEEQ-------  484

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
              +    + S Q ++MSRKDS G+LLL+LPRI SLP+FLF+I++
Sbjct  485  THIQPTDSGSIQASAMSRKDSYGELLLHLPRIASLPKFLFDISD  528



>ref|XP_010927928.1| PREDICTED: uncharacterized protein LOC105049857 isoform X1 [Elaeis 
guineensis]
Length=572

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ  S +  L  +   + ++LEEI + L SD+Q + ++SDE+SLMSRVN
Sbjct  394  DLVNHIGYCISEQINSGNPLLYGDNLATKDVLEEITQYLLSDSQIL-SSSDERSLMSRVN  452

Query  574  SLCCLLQKDPPPPTAQRRE-NFHEPAMGDKGVGE-------------FNFASASVVSERN  437
            SLCCL+QKD    TAQ  + N  + A GD                  F+F + S     +
Sbjct  453  SLCCLIQKDAG--TAQSLQINNGDSAAGDDVTDNASKPGSTSERKPLFDFPATSKSGSTS  510

Query  436  YEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              +     P  +   +D +  KQ+ ++SRK+S G+LL++LPRI SLPQFLFNI+EDS+
Sbjct  511  ERKPLFDLPATEEESNDASGCKQQVNISRKESFGELLMHLPRIASLPQFLFNISEDSE  568



>ref|XP_010927929.1| PREDICTED: uncharacterized protein LOC105049857 isoform X2 [Elaeis 
guineensis]
Length=565

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ  S +  L  +   + ++LEEI + L SD+Q + ++SDE+SLMSRVN
Sbjct  387  DLVNHIGYCISEQINSGNPLLYGDNLATKDVLEEITQYLLSDSQIL-SSSDERSLMSRVN  445

Query  574  SLCCLLQKDPPPPTAQRRE-NFHEPAMGDKGVGE-------------FNFASASVVSERN  437
            SLCCL+QKD    TAQ  + N  + A GD                  F+F + S     +
Sbjct  446  SLCCLIQKDAG--TAQSLQINNGDSAAGDDVTDNASKPGSTSERKPLFDFPATSKSGSTS  503

Query  436  YEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              +     P  +   +D +  KQ+ ++SRK+S G+LL++LPRI SLPQFLFNI+EDS+
Sbjct  504  ERKPLFDLPATEEESNDASGCKQQVNISRKESFGELLMHLPRIASLPQFLFNISEDSE  561



>ref|XP_008223604.1| PREDICTED: uncharacterized protein LOC103323388 isoform X1 [Prunus 
mume]
Length=551

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 100/175 (57%), Gaps = 15/175 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ TS + + + ++ +  +MLE+I + L SD Q+  AASDEKSLMSRVN
Sbjct  386  DLVSHIGNCISEQMTSGNPSSADQQSEYQDMLEDIAQYLLSDNQFT-AASDEKSLMSRVN  444

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP   + Q   +      G  G       S + ++     ++   T D +  
Sbjct  445  SLCCLLQKDPG--SVQNMVDGESSGEGQDG------GSDAQLNHTPDNKSGANTKDPEDD  496

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRIT------SLPQFLFNIAEDSDYHQAR  248
              D +  K+   MSRKDS G+LL +LPRI       SLP+ LFNI+E+    QAR
Sbjct  497  TKDASGGKKATGMSRKDSFGELLFHLPRIASLPSLPSLPKVLFNISEEDCESQAR  551



>gb|KHN24188.1| hypothetical protein glysoja_042005 [Glycine soja]
Length=530

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 21/169 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D +  +E  ++EQ TS +   S    +  E+LE+I + L +D Q + A SDEKSLMSRVN
Sbjct  383  DFIGQIELCLTEQITSGNPPFSDGGSEYKEILEDIAQHLLNDNQ-VAATSDEKSLMSRVN  441

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP        +N H           F   S++V    + ++ +P   +    
Sbjct  442  SLCCLLQKDP-----VTVQNSH-----------FTEDSSTVEGPHDGKDVKPGAEEPKDT  485

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                   KQ   MSRKDS  DLLL+LPRITSLP+FLFNI+E+ D   A+
Sbjct  486  SG----GKQALGMSRKDSFSDLLLHLPRITSLPKFLFNISEEDDDSHAK  530



>ref|XP_008223605.1| PREDICTED: uncharacterized protein LOC103323388 isoform X2 [Prunus 
mume]
Length=543

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 100/175 (57%), Gaps = 15/175 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ TS + + + ++ +  +MLE+I + L SD Q+  AASDEKSLMSRVN
Sbjct  378  DLVSHIGNCISEQMTSGNPSSADQQSEYQDMLEDIAQYLLSDNQFT-AASDEKSLMSRVN  436

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP   + Q   +      G  G       S + ++     ++   T D +  
Sbjct  437  SLCCLLQKDPG--SVQNMVDGESSGEGQDG------GSDAQLNHTPDNKSGANTKDPEDD  488

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRIT------SLPQFLFNIAEDSDYHQAR  248
              D +  K+   MSRKDS G+LL +LPRI       SLP+ LFNI+E+    QAR
Sbjct  489  TKDASGGKKATGMSRKDSFGELLFHLPRIASLPSLPSLPKVLFNISEEDCESQAR  543



>ref|XP_006343599.1| PREDICTED: uncharacterized protein LOC102599998 [Solanum tuberosum]
Length=533

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 93/170 (55%), Gaps = 18/170 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+E  +S+Q  S     S E  +   MLE+I +   SDTQ  PA SDEKSLM +VN
Sbjct  381  DLVSHIEICISQQINSGSLQ-SDEALECKGMLEDIAQMWLSDTQCTPA-SDEKSLMKKVN  438

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVV-SERNYEENRpptpdddg  398
            SLCCLLQ     P A    + +      K V   +  S+S   ++RN EEN         
Sbjct  439  SLCCLLQD----PIASHEPHLNGENHLQKPVQSTDACSSSACENDRNNEENAKDFVG---  491

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                    K   S+ R DS GDLLL+LPRI SLP+FLFNI ED D +Q+R
Sbjct  492  -------GKLTPSIPRIDSFGDLLLHLPRIASLPKFLFNIVED-DENQSR  533



>ref|XP_007223233.1| hypothetical protein PRUPE_ppa003793mg [Prunus persica]
 gb|EMJ24432.1| hypothetical protein PRUPE_ppa003793mg [Prunus persica]
Length=548

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 100/172 (58%), Gaps = 12/172 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL+SH+   +SEQ TS + + + ++ +  +MLE+I + L SD Q+  AASDEKSLMSRVN
Sbjct  386  DLMSHIGNCISEQMTSGNPSSADQQSEYQDMLEDIAQYLLSDNQFT-AASDEKSLMSRVN  444

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP   + Q   +      G  G       S + ++     ++   T D +  
Sbjct  445  SLCCLLQKDPG--SVQNMVDGESSGEGQDG------GSDAQLNHTPDNKSGANTKDPEDD  496

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAEDSDYHQAR  248
              D +  K+   MSRKDS G+LL +LPRI    SLP+ LFNI+E+    QAR
Sbjct  497  TKDASGGKKATGMSRKDSFGELLFHLPRIASLPSLPKVLFNISEEDCESQAR  548



>gb|KHN30277.1| hypothetical protein glysoja_042437 [Glycine soja]
Length=535

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +SEQ TS + +      +  EMLEEI + L +D + +   SDEKSLM+RVN
Sbjct  376  DFIGHIEHCLSEQITSGNPSFCGGRPEFQEMLEEIAQHLLNDNKVI-TTSDEKSLMTRVN  434

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP        ++ H+    D+G  +      S   E + + N+         
Sbjct  435  SLCCLLQKDP-----AALQSSHDKESADEGPADGKSIQLSHDLE-SMQNNKIKMDVKASE  488

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
             +    S  KQ   M RKDS+G+LLL LPRI SL +FLF+I+EDSD
Sbjct  489  EEFRDVSRGKQTLGMPRKDSLGELLLQLPRIASLSKFLFDISEDSD  534



>ref|XP_009336665.1| PREDICTED: uncharacterized protein LOC103929234 isoform X2 [Pyrus 
x bretschneideri]
Length=553

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 93/172 (54%), Gaps = 15/172 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D++SH+   +SEQ TS +   + ++ +  +MLE I + L SDTQ+   ASDEKSLMSRVN
Sbjct  394  DIMSHIGNCISEQMTSGNLPSADQQSEYQDMLEGIAQYLLSDTQFT-TASDEKSLMSRVN  452

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP     Q   + H    G+           S V      +N+      D  
Sbjct  453  SLCCLLQKDPAAAQTQVDGDSHVEGSGN----------GSDVRPIYTPDNKSGADVKDSE  502

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAEDSDYHQAR  248
                   K+ + MSRKDS  +LL +LPRI    SLP+ LFNI+E+    QAR
Sbjct  503  EGVSD-GKKASGMSRKDSFAELLFHLPRIASLPSLPKVLFNISEEDCESQAR  553



>ref|XP_006575320.1| PREDICTED: uncharacterized protein LOC100794550 isoform X2 [Glycine 
max]
Length=535

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +SEQ TS + +      +  EMLEEI + L +D + +   SDEKSLM+RVN
Sbjct  376  DFIGHIEHCLSEQITSGNPSFCGGRPEFQEMLEEIAQHLLNDNKVI-TTSDEKSLMTRVN  434

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP        ++ H+    D+G  +      S   E + + N+         
Sbjct  435  SLCCLLQKDP-----AALQSSHDKESADEGPADGKSIQLSHDLE-SMQNNKIKMDVKASE  488

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
             +    S  KQ   M RKDS+G+LLL LPRI SL +FLF+I+EDSD
Sbjct  489  EEFRDVSRGKQTLGMPRKDSLGELLLQLPRIASLSKFLFDISEDSD  534



>ref|XP_009336666.1| PREDICTED: uncharacterized protein LOC103929234 isoform X3 [Pyrus 
x bretschneideri]
Length=539

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 93/172 (54%), Gaps = 15/172 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D++SH+   +SEQ TS +   + ++ +  +MLE I + L SDTQ+   ASDEKSLMSRVN
Sbjct  380  DIMSHIGNCISEQMTSGNLPSADQQSEYQDMLEGIAQYLLSDTQFT-TASDEKSLMSRVN  438

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP     Q   + H    G+           S V      +N+      D  
Sbjct  439  SLCCLLQKDPAAAQTQVDGDSHVEGSGN----------GSDVRPIYTPDNKSGADVKDSE  488

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAEDSDYHQAR  248
                   K+ + MSRKDS  +LL +LPRI    SLP+ LFNI+E+    QAR
Sbjct  489  EGVSD-GKKASGMSRKDSFAELLFHLPRIASLPSLPKVLFNISEEDCESQAR  539



>ref|XP_009336662.1| PREDICTED: uncharacterized protein LOC103929234 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336663.1| PREDICTED: uncharacterized protein LOC103929234 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336664.1| PREDICTED: uncharacterized protein LOC103929234 isoform X1 [Pyrus 
x bretschneideri]
Length=555

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 93/172 (54%), Gaps = 15/172 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D++SH+   +SEQ TS +   + ++ +  +MLE I + L SDTQ+   ASDEKSLMSRVN
Sbjct  396  DIMSHIGNCISEQMTSGNLPSADQQSEYQDMLEGIAQYLLSDTQFT-TASDEKSLMSRVN  454

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP     Q   + H    G+           S V      +N+      D  
Sbjct  455  SLCCLLQKDPAAAQTQVDGDSHVEGSGN----------GSDVRPIYTPDNKSGADVKDSE  504

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAEDSDYHQAR  248
                   K+ + MSRKDS  +LL +LPRI    SLP+ LFNI+E+    QAR
Sbjct  505  EGVSD-GKKASGMSRKDSFAELLFHLPRIASLPSLPKVLFNISEEDCESQAR  555



>ref|XP_004964644.1| PREDICTED: uncharacterized protein LOC101773914 [Setaria italica]
Length=541

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 90/169 (53%), Gaps = 27/169 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP-AASDEKSLMSRV  578
            DLV+HL   +SE  TS +  L+  E  + E LEEI + L  D Q  P +AS+E+SLM+RV
Sbjct  394  DLVNHLGNCISEHITSGNTALAKNEVPTKETLEEIAQYLLGDAQGPPVSASEERSLMARV  453

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMG----DKGVGEFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD  P    + E      +G    D    EF+ A     ++           
Sbjct  454  DSLCCLIQKDTVPVAKPKPEPNDSGGIGVDASDGSDEEFSSAPTGKTTD-----------  502

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                       + +  +MSRKDS G+LL NLPRI SLPQFLF I ED++
Sbjct  503  -----------AAELPAMSRKDSFGELLTNLPRIASLPQFLFKIPEDTE  540



>ref|XP_006575319.1| PREDICTED: uncharacterized protein LOC100794550 isoform X1 [Glycine 
max]
Length=565

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +SEQ TS + +      +  EMLEEI + L +D + +   SDEKSLM+RVN
Sbjct  406  DFIGHIEHCLSEQITSGNPSFCGGRPEFQEMLEEIAQHLLNDNKVI-TTSDEKSLMTRVN  464

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP        ++ H+    D+G  +      S   E + + N+         
Sbjct  465  SLCCLLQKDP-----AALQSSHDKESADEGPADGKSIQLSHDLE-SMQNNKIKMDVKASE  518

Query  394  pddlTCS--KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
             +    S  KQ   M RKDS+G+LLL LPRI SL +FLF+I+EDSD
Sbjct  519  EEFRDVSRGKQTLGMPRKDSLGELLLQLPRIASLSKFLFDISEDSD  564



>gb|KGN65185.1| hypothetical protein Csa_1G257910 [Cucumis sativus]
Length=651

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 95/164 (58%), Gaps = 16/164 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNL---SSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLV+H+   ++EQ  S         SEE Q+  ML++I + L SD Q + A SDE SLMS
Sbjct  495  DLVNHIGHHITEQMASTKTPFVDDGSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMS  551

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RVNSLCCLLQK+P   +    EN+  P   D    + N   A +   +N EE        
Sbjct  552  RVNSLCCLLQKEPVQSSQTNGENYDGPNNKDDAQLKDN---AELRDGKNIEEQ-------  601

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
              +    + S Q ++MSRKDS G+LLL+LPRI SLP+FLF+I++
Sbjct  602  THIQPTDSGSIQASAMSRKDSYGELLLHLPRIASLPKFLFDISD  645



>ref|XP_007138292.1| hypothetical protein PHAVU_009G196100g [Phaseolus vulgaris]
 gb|ESW10286.1| hypothetical protein PHAVU_009G196100g [Phaseolus vulgaris]
Length=534

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 93/167 (56%), Gaps = 23/167 (14%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D +  +E  +SEQ TS +   S    +  E+LE+I + L +D Q   A SDEKSLMSRVN
Sbjct  388  DFIGQIELCLSEQITSGNPPFSDGGTEYKEILEDIAQHLLNDNQAA-ATSDEKSLMSRVN  446

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P T Q   N H             FA  S V   +  ++       +  
Sbjct  447  SLCCLLQKD--PVTVQ---NSH-------------FAEDSTVEGPDEGKD---VKPAEEE  485

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA-EDSDYH  257
              D++  KQ   MSRKDS  DLLL+LPRITSLP+FLFNI+ ED D H
Sbjct  486  LRDVSGGKQALGMSRKDSFSDLLLHLPRITSLPKFLFNISEEDGDSH  532



>ref|XP_010687648.1| PREDICTED: uncharacterized protein LOC104901744 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 96/180 (53%), Gaps = 35/180 (19%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQS-LEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DLV+H+   +SEQ +S++   +    +S  +MLE+I + L  D Q+ P  SDEKSLMSRV
Sbjct  391  DLVNHIGNCISEQMSSENPECTEGGSESHTKMLEDIAQHLLGDVQFTPC-SDEKSLMSRV  449

Query  577  NSLCCLLQKDPPPPTA--------QRRENFHEPAMGDKGV--GEFNFASASVVSERNYEE  428
            NSLC LLQKD  P  +          +   HEP + D+ +  G+   A  SV        
Sbjct  450  NSLCSLLQKDGTPVQSFEVTDEAKDLKTTSHEPELMDQNINKGDIIAAEGSV--------  501

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                              KQ  SM R DS GDLL +LPRI SLP+FLF+I+ED D +QAR
Sbjct  502  --------------RDVCKQAPSMPRIDSFGDLLHHLPRIASLPKFLFDISEDGD-NQAR  546



>gb|AFW85535.1| hypothetical protein ZEAMMB73_400214 [Zea mays]
Length=532

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 91/169 (54%), Gaps = 27/169 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP-AASDEKSLMSRV  578
            D V+HL   +SEQ TS +  L++ E  + E LE I + L  DTQ  P +ASDE+SLM+RV
Sbjct  385  DFVNHLGNCISEQITSGNPALANNEVPTKETLEGIAQYLLGDTQGPPVSASDERSLMARV  444

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMG----DKGVGEFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD  P T  + E     ++G    D    EF+ A     ++           
Sbjct  445  DSLCCLIQKDTVPVTKPKPEPNDSDSIGVEASDGSDEEFSSAPTGKPTD-----------  493

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                       +    +MSRKDS G+LL NLPRI SLPQFLF I E ++
Sbjct  494  -----------ATNLPAMSRKDSFGELLTNLPRIASLPQFLFKIPEGTE  531



>ref|NP_001143180.1| uncharacterized protein LOC100275680 [Zea mays]
 gb|ACG29566.1| hypothetical protein [Zea mays]
Length=532

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 91/169 (54%), Gaps = 27/169 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP-AASDEKSLMSRV  578
            D V+HL   +SEQ TS +  L++ E  + E LE I + L  DTQ  P +ASDE+SLM+RV
Sbjct  385  DFVNHLGNCISEQITSGNPALANNEVPTKETLEGIAQYLLGDTQGPPVSASDERSLMARV  444

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMG----DKGVGEFNFASASVVSERNYEENRpptp  410
            +SLCCL+QKD  P T  + E     ++G    D    EF+ A     ++           
Sbjct  445  DSLCCLIQKDTVPVTKPKPEPNDSDSIGVEASDGSDEEFSSAPTGKPTD-----------  493

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                       +    +MSRKDS G+LL NLPRI SLPQFLF I E ++
Sbjct  494  -----------ATNLPAMSRKDSFGELLTNLPRIASLPQFLFKIPEGTE  531



>gb|KHN02051.1| hypothetical protein glysoja_045196 [Glycine soja]
Length=349

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 90/170 (53%), Gaps = 24/170 (14%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D +  +E  +SEQ TS +   S    +  E+LE+I + L +D Q + A SDEKSLMSRVN
Sbjct  203  DFIGQIELCLSEQITSGNPPFSDGGSEYKEILEDIAQHLLNDNQ-VAATSDEKSLMSRVN  261

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGV-GEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKD   P   +  +F E    D  V G  +        E + + +         
Sbjct  262  SLCCLLQKD---PVTVQNSHFTE----DNTVEGPDDGKDVKPAVEESKDASG--------  306

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                    KQ   MSRKDS  DLLL+LPRI SLP+FLFNI+E+     AR
Sbjct  307  -------GKQALGMSRKDSFSDLLLHLPRIASLPKFLFNISEEDGNSHAR  349



>ref|XP_002304738.2| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
 gb|EEE79717.2| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
Length=467

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 87/159 (55%), Gaps = 32/159 (20%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS +  L   + +S ++L+EI + L  D+Q + +ASDE+SLM+RVN
Sbjct  341  DLVNHIGHCISEQMTSGNSILCGGDIKSSDILDEITQYLLGDSQ-VTSASDEQSLMTRVN  399

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD  P TA   +         K     +      V E N              
Sbjct  400  SLCCLLQKD--PGTAWDLQG--------KCRDNLDMDHGGRVDETN--------------  435

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
                    Q  +M+RKDSVG+L+LNLPRI SLP FLFN+
Sbjct  436  -------SQAPAMTRKDSVGELMLNLPRIASLPHFLFNV  467



>ref|XP_008647634.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR36410.1| unknown [Zea mays]
 gb|AFW76591.1| hypothetical protein ZEAMMB73_647105 [Zea mays]
Length=539

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 92/165 (56%), Gaps = 19/165 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPA-ASDEKSLMSRV  578
            DLV+HL   +SEQ TS D  L++ E  + E LE I + L  DTQ  P  A+ E+SLM+RV
Sbjct  392  DLVNHLGNCISEQITSGDPALANNEVPTKETLEGIAQYLLGDTQGPPVTAAVERSLMARV  451

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            +SLCCL+QKD    TA   +   EP  GD  +G      AS  S+  +       P D  
Sbjct  452  DSLCCLIQKD----TAPVAKPKPEPNDGDS-IG----VEASDGSDEEFTSAPTGKPTD--  500

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                   +    +MSRKDS G+LL NLPRI SLPQFLF I E ++
Sbjct  501  -------ATNPPAMSRKDSFGELLTNLPRIASLPQFLFKIPEGTE  538



>ref|NP_001143086.1| hypothetical protein [Zea mays]
 gb|ACG28854.1| hypothetical protein [Zea mays]
 gb|AFW76590.1| hypothetical protein ZEAMMB73_647105 [Zea mays]
Length=535

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 92/165 (56%), Gaps = 19/165 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPA-ASDEKSLMSRV  578
            DLV+HL   +SEQ TS D  L++ E  + E LE I + L  DTQ  P  A+ E+SLM+RV
Sbjct  388  DLVNHLGNCISEQITSGDPALANNEVPTKETLEGIAQYLLGDTQGPPVTAAVERSLMARV  447

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            +SLCCL+QKD    TA   +   EP  GD  +G      AS  S+  +       P D  
Sbjct  448  DSLCCLIQKD----TAPVAKPKPEPNDGDS-IG----VEASDGSDEEFTSAPTGKPTD--  496

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                   +    +MSRKDS G+LL NLPRI SLPQFLF I E ++
Sbjct  497  -------ATNPPAMSRKDSFGELLTNLPRIASLPQFLFKIPEGTE  534



>ref|XP_009800570.1| PREDICTED: uncharacterized protein LOC104246459 [Nicotiana sylvestris]
Length=532

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 99/173 (57%), Gaps = 25/173 (14%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLE---MLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLVSH+E  +SEQ +S   NL S+  Q+LE   +LE+I     SDTQ   A SDEKSL+ 
Sbjct  381  DLVSHIENCISEQISSG--NLPSD--QALECKGILEDIAHVWLSDTQC--ATSDEKSLLK  434

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVV-SERNYEENRpptpd  407
            +VNSLCCLLQ     P+A    +F+      K +   +  S+S   S+ N EE+      
Sbjct  435  KVNSLCCLLQD----PSASHESHFNGENHLQKPIQSNDACSSSACESKGNGEEDAKDFAG  490

Query  406  ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                       K   S+ R+DS GDLLL+LPRI SLP+FLF+IAED D +Q R
Sbjct  491  ----------GKLTPSIPRRDSFGDLLLHLPRIASLPKFLFDIAED-DENQTR  532



>ref|XP_004303224.1| PREDICTED: uncharacterized protein LOC101296120 [Fragaria vesca 
subsp. vesca]
Length=512

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 91/161 (57%), Gaps = 16/161 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+H+   ++E K S     + +E+ S  +LEEI + LF+D+Q +   SDE+SLMSRVN
Sbjct  367  DFVNHIGHCITE-KMSGTPVFAGKEQPSSNILEEITQYLFNDSQ-LTLPSDEQSLMSRVN  424

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKG-VGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKD   PTAQ   N H  A  D G + E N ASAS      Y+           
Sbjct  425  SLCCLLQKD---PTAQ---NLH--ARRDDGRMAETNSASAS-----GYQSKIGEGFVTPK  471

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
            +         +  + R+DS G+ LLN+PRI SLPQFLFN +
Sbjct  472  VESTDASDDTQLGIPRRDSFGEFLLNMPRIASLPQFLFNFS  512



>ref|XP_006453555.1| hypothetical protein CICLE_v10007906mg [Citrus clementina]
 gb|ESR66795.1| hypothetical protein CICLE_v10007906mg [Citrus clementina]
Length=552

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 98/174 (56%), Gaps = 9/174 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP--AASDEKSLMSR  581
            DL++H+   +SEQ TS +  LS E     + L+ I +CLFSDTQ        DEK LMSR
Sbjct  383  DLMNHIGNCISEQMTSGNQPLSEEGSDYRKFLD-IAQCLFSDTQAAADDGVDDEKFLMSR  441

Query  580  VNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENR---pptp  410
            VNSL CLLQ D P    Q  +   E +  D    + N  S  + +  +  +N+      P
Sbjct  442  VNSLYCLLQMDQPD-VGQNSQVIGETS--DGRPDDVNGKSVQLNTMESTHDNKMRDNIKP  498

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +     D++ SK    MSRKDS G+LLL+LPRITSLP+FLFNI+E+    QAR
Sbjct  499  SEGDNAKDVSGSKPTTGMSRKDSFGELLLHLPRITSLPKFLFNISEEDGDSQAR  552



>ref|XP_009375478.1| PREDICTED: uncharacterized protein LOC103964285 [Pyrus x bretschneideri]
Length=494

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 86/138 (62%), Gaps = 6/138 (4%)
 Frame = -1

Query  694  LSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPP-TAQRRE  518
            +S +E+ S +MLEEI + LFSD+Q +   SDE+SLM+RVNSLCCLLQKDP      Q R 
Sbjct  362  ISGKEQPSTDMLEEITQYLFSDSQ-ITLPSDEQSLMTRVNSLCCLLQKDPSTELNLQVRS  420

Query  517  NFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSV  338
            +       D+   E N ASAS    +  E      P   G P+D +  KQ+ +M R+DS 
Sbjct  421  DEWLNGSNDRKAAETNSASASAHESKPVE----GFPAPKGEPNDDSHDKQELTMPRRDSF  476

Query  337  GDLLLNLPRITSLPQFLF  284
            G+LLLN+PRI SLPQFLF
Sbjct  477  GELLLNIPRIASLPQFLF  494



>gb|KDP41944.1| hypothetical protein JCGZ_26962 [Jatropha curcas]
Length=507

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 95/159 (60%), Gaps = 4/159 (3%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+ Q ++EQ    +   S  + ++  +L+EI + L SD+Q + + SDE+SLMSRVN
Sbjct  353  DLVNHIGQCITEQMAFDNSTSSDSDPKNNSILDEITQYLLSDSQ-LTSDSDEQSLMSRVN  411

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ+DP   +A+  +   +  +   G    N   ++  +    +        +D  
Sbjct  412  SLCCLLQRDPG--SARNLQAMGQIDLELDGNVRINETKSNTAAACQSKVVEGFPVPEDQS  469

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
             +  +C KQ  SMSRKDSVG+LLLNLPRI SLP FL+NI
Sbjct  470  NNVSSC-KQAPSMSRKDSVGELLLNLPRIASLPHFLYNI  507



>ref|XP_004242622.1| PREDICTED: uncharacterized protein LOC101251694 [Solanum lycopersicum]
Length=533

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 93/172 (54%), Gaps = 22/172 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH E  +S+Q  S     S E  +   MLE+I +   SDTQ  PA SDEKSLM +VN
Sbjct  381  DLVSHFEICISQQINSGSLQ-SDEALECKGMLEDIAQMWLSDTQCTPA-SDEKSLMKKVN  438

Query  574  SLCCLLQKDPPP---PTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            SLCCLLQ DP     P      +   P   +        +S++  ++ N +EN   +   
Sbjct  439  SLCCLLQ-DPIASHEPQLNGENHLQNPVQSNDAC-----SSSACENDGNNKENTKDSVG-  491

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                     SK   S+ R DS GDLLL+LPRI SLP+FLFNI ED D +Q+R
Sbjct  492  ---------SKPTPSIPRIDSFGDLLLHLPRIASLPKFLFNIVED-DENQSR  533



>ref|XP_003522941.1| PREDICTED: uncharacterized protein LOC100807349 [Glycine max]
Length=533

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 92/169 (54%), Gaps = 22/169 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D +  +E  +SEQ TS +   S    +  E+LE+I + L +D Q + A SDEKSLMSRVN
Sbjct  387  DFIGQIELCLSEQITSGNPPFSDGGSEYKEILEDIAQHLLNDNQ-VAATSDEKSLMSRVN  445

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD   P   +  +F E    + G  +      +V      EE++  +      
Sbjct  446  SLCCLLQKD---PVTVQNSHFTEDNTVE-GPDDGKDVKPAV------EESKDASG-----  490

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                   KQ   MSRKDS  DLLL+LPRI SLP+FLFNI+E+     AR
Sbjct  491  ------GKQALGMSRKDSFSDLLLHLPRIASLPKFLFNISEEDGNSHAR  533



>ref|XP_011069649.1| PREDICTED: uncharacterized protein LOC105155471 [Sesamum indicum]
Length=512

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 96/169 (57%), Gaps = 10/169 (6%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ TS    L  +  +  +MLE I + + SD  +     DEKSLM +VN
Sbjct  349  DLVNHIGNCISEQMTSGSLPLE-KASECQDMLENIAQVMLSDN-HCATGLDEKSLMKKVN  406

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ DP   ++ + +  +   + D+G   +      +V++  +E+        +G 
Sbjct  407  SLCCLLQ-DPAIASSSQVDGENRLEVADRGKNVY----FDLVNDSTHEKANNIIQAPEGN  461

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSL---PQFLFNIAEDSDYH  257
              D +  KQ  SM+RKDS GDLLL+LPRI SL   P+FLF IAED +Y 
Sbjct  462  FKDGSGCKQAPSMARKDSFGDLLLHLPRIASLPKFPKFLFGIAEDDEYQ  510



>ref|XP_009396243.1| PREDICTED: uncharacterized protein LOC103981292 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 93/162 (57%), Gaps = 18/162 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D VS +E  +SEQ +S +  L        +MLEE+ +CLFSD+Q MP  SDEK++M++VN
Sbjct  392  DFVSQIENCISEQISSGNPQLPGTIPDK-KMLEELAQCLFSDSQ-MPT-SDEKTVMTKVN  448

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            S CCLLQKD    + Q  +      M   G    +  S   VSE++         +  GL
Sbjct  449  SFCCLLQKDAA--SVQSHQ------MNAGGTSADDSGSQDGVSEKHTHSLEDEFDNTSGL  500

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                   K  A++SRKDS G+LL++LPR+ SLPQFLFNI ED
Sbjct  501  -------KTLANISRKDSFGELLMHLPRVASLPQFLFNITED  535



>ref|XP_006474053.1| PREDICTED: uncharacterized protein LOC102622246 isoform X2 [Citrus 
sinensis]
 gb|KDO62296.1| hypothetical protein CISIN_1g008832mg [Citrus sinensis]
Length=544

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 97/174 (56%), Gaps = 9/174 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP--AASDEKSLMSR  581
            DL++H+   +SEQ TS +  LS E     + L+ I +CLFSDTQ        DEK LMSR
Sbjct  375  DLMNHIGNCISEQMTSGNQPLSEEGSDYRKFLD-IAQCLFSDTQAAADDGVDDEKFLMSR  433

Query  580  VNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRp---ptp  410
            VNSL CLLQ D P    Q  +   E +  D    + N  S  + +  +  +N+      P
Sbjct  434  VNSLYCLLQMDQPD-VGQNSQVIGETS--DGRPDDVNGKSVQLNTMESTHDNKMRDNIKP  490

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +     D++ SK    MSRKDS G+LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  491  SEGDNAKDVSGSKPTTGMSRKDSFGELLLHLPRIASLPKFLFNISEEDGDSQAR  544



>ref|XP_006474052.1| PREDICTED: uncharacterized protein LOC102622246 isoform X1 [Citrus 
sinensis]
 gb|KDO62297.1| hypothetical protein CISIN_1g008832mg [Citrus sinensis]
Length=552

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 97/174 (56%), Gaps = 9/174 (5%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMP--AASDEKSLMSR  581
            DL++H+   +SEQ TS +  LS E     + L+ I +CLFSDTQ        DEK LMSR
Sbjct  383  DLMNHIGNCISEQMTSGNQPLSEEGSDYRKFLD-IAQCLFSDTQAAADDGVDDEKFLMSR  441

Query  580  VNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENR---pptp  410
            VNSL CLLQ D P    Q  +   E +  D    + N  S  + +  +  +N+      P
Sbjct  442  VNSLYCLLQMDQPD-VGQNSQVIGETS--DGRPDDVNGKSVQLNTMESTHDNKMRDNIKP  498

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
             +     D++ SK    MSRKDS G+LLL+LPRI SLP+FLFNI+E+    QAR
Sbjct  499  SEGDNAKDVSGSKPTTGMSRKDSFGELLLHLPRIASLPKFLFNISEEDGDSQAR  552



>ref|XP_011034584.1| PREDICTED: uncharacterized protein LOC105132669 isoform X3 [Populus 
euphratica]
Length=506

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+ +   +SEQ TS +F+LS  + +S ++L+EI + L  D+Q M +ASDE+S+MS VN
Sbjct  358  DLVNQIGHCISEQMTSGNFSLSGGDIKSSDILDEITQYLLGDSQAM-SASDEQSVMSSVN  416

Query  574  SLCCLLQKDPPPPT-AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKDP      Q +   +     D+ + E N A+ASV   +  E      P  +G
Sbjct  417  SLCCLLQKDPATAWDLQAKSLSYLDVDHDRRINETNSATASVCQGKFVE----GFPPPEG  472

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPR  311
               ++   KQ  +MSRKDSVG+LLLNLPR
Sbjct  473  EASNVFICKQAPAMSRKDSVGELLLNLPR  501



>ref|XP_004507763.1| PREDICTED: uncharacterized protein LOC101495701 isoform X1 [Cicer 
arietinum]
 ref|XP_004507764.1| PREDICTED: uncharacterized protein LOC101495701 isoform X2 [Cicer 
arietinum]
Length=544

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 86/154 (56%), Gaps = 13/154 (8%)
 Frame = -1

Query  721  EQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPP  542
            E+  S + +L+ ++ +  +MLEEI + L +D Q +   SDEKSLMSRVNSLCCLLQKDP 
Sbjct  400  EEIISGNSSLTDDKLECQQMLEEIAQHLLNDNQ-VAITSDEKSLMSRVNSLCCLLQKDPA  458

Query  541  PPTAQRRENFHEPAMGDKGVGEFNFASASVVSE--RNYEENRpptpdddglpddlTCS--  374
                        P  G   V   N   +S +S    + + N+          +    S  
Sbjct  459  A--------VPNPHDGSSSVYGPNDGKSSQLSHDFESMQANKFKIDIKAAEEESRDVSGG  510

Query  373  KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
            KQ   MSRKDS G+LLLNLPRI SLP+FLFNI+E
Sbjct  511  KQAPGMSRKDSFGELLLNLPRIASLPKFLFNISE  544



>gb|KEH28578.1| hypothetical protein MTR_4g007710 [Medicago truncatula]
Length=525

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 100/171 (58%), Gaps = 21/171 (12%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAA---SDEKSLMS  584
            DLV+H+E  +SEQ   ++ + +++      +LEE  + LF+D+ + P +   SDE+++MS
Sbjct  369  DLVNHIEHCISEQMGPENSSFTNDR----AVLEEFTQYLFNDSIFPPVSDEQSDEQNVMS  424

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHE--PAMGDKGVGEFNFASASVVSERNYEENRpptp  410
            RVNSL CLLQKDP  P  ++ +N +    A  D+ V E      S + +  ++++     
Sbjct  425  RVNSLYCLLQKDPSAPEEKQVQNGNNVFDAAEDRKVDE----GKSKMFDLGFQQD-----  475

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYH  257
                  D     +Q+  +SRK+S GDLLLNLPRI SLP FLF ++EDS  H
Sbjct  476  ---DDDDASGSQQQENGLSRKESAGDLLLNLPRIASLPHFLFPMSEDSGSH  523



>gb|KEH32610.1| hypothetical protein MTR_4g130310 [Medicago truncatula]
Length=495

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 87/163 (53%), Gaps = 22/163 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +S++  S D + S+E  +  +M++ I + L +D Q +   SDEKSLMSRVN
Sbjct  354  DFLGHIEHHISKEMASGDPSFSAERLEYQQMMDGITQHLLNDNQ-VTTDSDEKSLMSRVN  412

Query  574  SLCCLLQKDPPP-PTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SL CLLQ DPP  P +     F E           N A  ++  +   E +R        
Sbjct  413  SLRCLLQMDPPAVPNSHDNTGFIEGP---------NDAKVNIDIKATEENSRDVYG----  459

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                         MSRKDS GDLLL+LPRI SLP+FLF+I+ED
Sbjct  460  -------GNPAPGMSRKDSFGDLLLSLPRIASLPKFLFDISED  495



>ref|XP_003610264.1| hypothetical protein MTR_4g130310 [Medicago truncatula]
 gb|AES92461.1| hypothetical protein MTR_4g130310 [Medicago truncatula]
 gb|AFK36705.1| unknown [Medicago truncatula]
Length=496

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 87/163 (53%), Gaps = 22/163 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +S++  S D + S+E  +  +M++ I + L +D Q +   SDEKSLMSRVN
Sbjct  355  DFLGHIEHHISKEMASGDPSFSAERLEYQQMMDGITQHLLNDNQ-VTTDSDEKSLMSRVN  413

Query  574  SLCCLLQKDPPP-PTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SL CLLQ DPP  P +     F E           N A  ++  +   E +R        
Sbjct  414  SLRCLLQMDPPAVPNSHDNTGFIEGP---------NDAKVNIDIKATEENSRDVYG----  460

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                         MSRKDS GDLLL+LPRI SLP+FLF+I+ED
Sbjct  461  -------GNPAPGMSRKDSFGDLLLSLPRIASLPKFLFDISED  496



>ref|XP_009395482.1| PREDICTED: uncharacterized protein LOC103980727 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 90/170 (53%), Gaps = 38/170 (22%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D V+ +   +SEQ +  +  LS       EMLEE+ + LFSD+Q    ASDEKS+MS+VN
Sbjct  396  DFVNKIGHCISEQISWGNPELSGMVIPDKEMLEELVQSLFSDSQL--PASDEKSVMSKVN  453

Query  574  SLCCLLQKDPPPPTAQRR----ENFHEPAMGDKGV----GEFNFASASVVSERNYEENRp  419
            S C LLQKD     +Q+      +FH+    +K      GEFN  S              
Sbjct  454  SFCSLLQKDVGTVHSQQSNAGDNDFHD-GTSEKHTPPTEGEFNDISG-------------  499

Query  418  ptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                          +K  AS+SRKDS G+LL++LPRI SLPQFLFNIAED
Sbjct  500  --------------AKTAASISRKDSFGELLMHLPRIASLPQFLFNIAED  535



>emb|CDP02853.1| unnamed protein product [Coffea canephora]
Length=535

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 85/161 (53%), Gaps = 14/161 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+ Q +SEQ TS     S +  +   + E I + + SDTQ + AASDEK LM +VN
Sbjct  382  DLVSHIGQHISEQVTSGSIP-SEKASECQNIFENIAQIMLSDTQNV-AASDEK-LMKKVN  438

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQ DP   ++   E        +   G F    A   +E NY  +          
Sbjct  439  SLCCLLQ-DPTVASSAHVEG------ENHSEGPF----AGRDAELNYPSDFMFEMKAHDN  487

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
                   KQ   + R+DS+GDLLLNLPRI S P FLFNIAE
Sbjct  488  VVSSVDPKQTPGIPRRDSLGDLLLNLPRIASFPNFLFNIAE  528



>ref|XP_004161876.1| PREDICTED: uncharacterized LOC101219584 [Cucumis sativus]
Length=497

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 13/140 (9%)
 Frame = -1

Query  691  SSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENF  512
             SEE Q+  ML++I + L SD Q + A SDE SLMSRVNSLCCLLQK+P   +    EN+
Sbjct  365  GSEEYQA--MLDDIAQYLLSDNQ-LSATSDEVSLMSRVNSLCCLLQKEPVQSSQTNGENY  421

Query  511  HEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGD  332
              P   D    + N   A +   +N EE          +    + S Q ++MSRKDS G+
Sbjct  422  DGPNNKDDAQLKDN---AELRDGKNIEEQ-------THIQPTDSGSIQASAMSRKDSYGE  471

Query  331  LLLNLPRITSLPQFLFNIAE  272
            LLL+LPRI SLP+FLF+I++
Sbjct  472  LLLHLPRIASLPKFLFDISD  491



>ref|XP_004166179.1| PREDICTED: uncharacterized LOC101216574 [Cucumis sativus]
Length=540

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 11/155 (7%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ T+ + + +++  +  ++LE+I + L +D Q     SDEKSLM RVN
Sbjct  378  DLVNHIGHCISEQMTAANSSFANQGPEYQDILEDITQYLLNDNQS--TTSDEKSLMKRVN  435

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP  PT Q    F++ +  +      N    +++        R         
Sbjct  436  SLCCLLQKDPANPTTQNSL-FNDESRVEGPDSRKNDKVGNIL--------RGDVKAFGED  486

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQF  290
              D + +KQ   MSRKDS G+LLL+LPRITS+P+F
Sbjct  487  VKDNSGTKQAVGMSRKDSFGELLLHLPRITSIPKF  521



>ref|XP_010047053.1| PREDICTED: uncharacterized protein LOC104436016 [Eucalyptus grandis]
 gb|KCW78805.1| hypothetical protein EUGRSUZ_C00240 [Eucalyptus grandis]
Length=545

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 90/166 (54%), Gaps = 22/166 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   ++EQ  S   N S++     E+LE+I + L SDTQ    ASDEKSLM+RVN
Sbjct  396  DLMNHIGNCITEQMGSG--NSSNDGSGCPEILEDIAQYLLSDTQST-MASDEKSLMARVN  452

Query  574  SLCCLLQKDPPP-PTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKD  P       E+  +     K        S  + + +  EE          
Sbjct  453  SLCCLLQKDTTPVQNLAGGESCEDKPKDTKDAAPSGVNSNPLANFKALEEE---------  503

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA-EDSD  263
                     + A MSRKDS G+LLL+LPRI SLP FLFNI+ EDSD
Sbjct  504  --------SKPAGMSRKDSFGELLLHLPRIASLPNFLFNISEEDSD  541



>gb|KCW78806.1| hypothetical protein EUGRSUZ_C00240 [Eucalyptus grandis]
Length=537

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 90/166 (54%), Gaps = 22/166 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL++H+   ++EQ  S   N S++     E+LE+I + L SDTQ    ASDEKSLM+RVN
Sbjct  388  DLMNHIGNCITEQMGSG--NSSNDGSGCPEILEDIAQYLLSDTQST-MASDEKSLMARVN  444

Query  574  SLCCLLQKDPPP-PTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKD  P       E+  +     K        S  + + +  EE          
Sbjct  445  SLCCLLQKDTTPVQNLAGGESCEDKPKDTKDAAPSGVNSNPLANFKALEEE---------  495

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA-EDSD  263
                     + A MSRKDS G+LLL+LPRI SLP FLFNI+ EDSD
Sbjct  496  --------SKPAGMSRKDSFGELLLHLPRIASLPNFLFNISEEDSD  533



>ref|XP_011034582.1| PREDICTED: uncharacterized protein LOC105132669 isoform X2 [Populus 
euphratica]
Length=508

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 91/148 (61%), Gaps = 6/148 (4%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+ +   +SEQ TS +F+LS  + +S ++L+EI + L  D+Q M +ASDE+S+MS VN
Sbjct  358  DLVNQIGHCISEQMTSGNFSLSGGDIKSSDILDEITQYLLGDSQAM-SASDEQSVMSSVN  416

Query  574  SLCCLLQKDPPPPT-AQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKDP      Q +   +     D+ + E N A+ASV   +  E      P  +G
Sbjct  417  SLCCLLQKDPATAWDLQAKSLSYLDVDHDRRINETNSATASVCQGKFVE----GFPPPEG  472

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLP  314
               ++   KQ  +MSRKDSVG+LLLNLP
Sbjct  473  EASNVFICKQAPAMSRKDSVGELLLNLP  500



>ref|XP_009623108.1| PREDICTED: uncharacterized protein LOC104114385 [Nicotiana tomentosiformis]
Length=532

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 94/172 (55%), Gaps = 23/172 (13%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLE---MLEEINRCLFSDTQYMPAASDEKSLMS  584
            DLVSH+E  +SEQ +    NL S+  Q+LE   MLE+I     SDTQ     SDEKSL+ 
Sbjct  381  DLVSHIENCISEQISFG--NLPSD--QALECKGMLEDIAHVWLSDTQC--TTSDEKSLLK  434

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            +VNSLCCLLQ     P+A    +F+      K +   +  S+S    +  +         
Sbjct  435  KVNSLCCLLQD----PSASHESHFNGENHLQKPIQSNDACSSSACESKGND---------  481

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                 D    K   S+ R+DS GDLLL+LPRI SLP+FLF+IAED D +Q R
Sbjct  482  AEDAKDFAGGKLTPSIPRRDSFGDLLLHLPRIASLPKFLFDIAED-DENQTR  532



>ref|XP_010655142.1| PREDICTED: uncharacterized protein LOC100262159 isoform X3 [Vitis 
vinifera]
Length=499

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  673  SLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPT--AQRRENFHEPA  500
            S+ M + I + +F+D Q + +ASDE+S+MSRVNSLCCLLQ  P        + EN  + A
Sbjct  373  SMSMSDLITQYMFNDAQ-LSSASDEQSIMSRVNSLCCLLQNKPAAVQNFQVKSENGTDTA  431

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
             GD  +GE N  +AS  S+   +        +D   D  +C KQ  +MSRKDSVG+LL+N
Sbjct  432  -GDGSIGELNPIAASCESKTAGD----FPTPNDETNDVSSC-KQPPAMSRKDSVGELLVN  485

Query  319  LPRITSLPQFLFNI  278
            LPRI SLPQFLFN+
Sbjct  486  LPRIASLPQFLFNM  499



>gb|KHN17516.1| hypothetical protein glysoja_005713 [Glycine soja]
Length=476

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 89/165 (54%), Gaps = 5/165 (3%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +SEQ TS + +      +  EMLEEI + L +D Q +   SDE SLM+RVN
Sbjct  315  DFIGHIEHCLSEQITSGNPSFCGGRSELQEMLEEIAQHLLNDNQVI-TTSDEISLMTRVN  373

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP      +  +  E A+ +    E     +  +      + +      +  
Sbjct  374  SLCCLLQKDP---AGLQSSHDKESAVAEGPDDEKRIQLSHDLESMQNNKIKMDVKPAEED  430

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA-EDSD  263
              D + SKQ   MSRKDS  +LL  LPRI SL +FLF+I+ EDSD
Sbjct  431  FRDASGSKQTLGMSRKDSFAELLHQLPRIASLSKFLFDISEEDSD  475



>ref|XP_008228846.1| PREDICTED: uncharacterized protein LOC103328229 [Prunus mume]
Length=523

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 92/165 (56%), Gaps = 13/165 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D VSH+ Q +S +       +S +E+ S ++LEEI + +F+D+Q+    SDE+ +MSRVN
Sbjct  367  DFVSHIGQCISGK-------ISGKEQPSRDVLEEITQNMFNDSQFT-LPSDEQYVMSRVN  418

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKG-VGEFNFASASV----VSERNYEENRpptp  410
            SL CLLQKDP      + +      + D G   E N ASAS     VS+           
Sbjct  419  SLYCLLQKDPSTTLNLQAKTDDCFDVNDNGKTAETNSASASAYGSKVSDGFLAPKDESNE  478

Query  409  dddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA  275
                   +   +KQ+ +M R+DS G+LLLN+PRI SLPQFLFN +
Sbjct  479  GKSSAVPNDDDNKQELTMPRRDSFGELLLNIPRIASLPQFLFNWS  523



>ref|XP_008789898.1| PREDICTED: uncharacterized protein LOC103707259 [Phoenix dactylifera]
Length=564

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 107/179 (60%), Gaps = 20/179 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ  S +  L+ +   + ++LEEI + L SD+Q + + SDE SLM   N
Sbjct  387  DLVNHIGHCISEQINSGNPLLAGDGLPTKDVLEEITQYL-SDSQ-ISSTSDENSLMLNFN  444

Query  574  SLCCLLQKDPPPPTAQRRE-NFHEPAMGDKGVGE--------------FNFASASVVSER  440
            SLCCL+QKD    TAQ  + N  + A GD GV +              F+F + S +   
Sbjct  445  SLCCLIQKDGG--TAQSLQINNGDNAAGD-GVTDNASKPGSTSERKPLFDFPATSKLGST  501

Query  439  NYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
            +  +     P  +G  +D +  KQ+A++SRK+S G+LL++LPRI SLPQFLFNI+ED++
Sbjct  502  SERKPLFDFPATEGESNDASGCKQQANISRKESFGELLMHLPRIDSLPQFLFNISEDAE  560



>ref|XP_006600521.1| PREDICTED: uncharacterized protein LOC100791924 [Glycine max]
Length=493

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 89/165 (54%), Gaps = 5/165 (3%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  +SEQ TS + +      +  EMLEEI + L +D Q +   SDE SLM+RVN
Sbjct  332  DFIGHIEHCLSEQITSGNPSFCGGRSELQEMLEEIAQHLLNDNQVI-TTSDEISLMTRVN  390

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKDP      +  +  E A+ +    E     +  +      + +      +  
Sbjct  391  SLCCLLQKDP---AGLQSSHDKESAVAEGPDDEKRIQLSHDLESMQNNKIKMDVKPAEED  447

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIA-EDSD  263
              D + SKQ   MSRKDS  +LL  LPRI SL +FLF+I+ EDSD
Sbjct  448  FRDASGSKQTLGMSRKDSFAELLHQLPRIASLSKFLFDISEEDSD  492



>ref|XP_002452970.1| hypothetical protein SORBIDRAFT_04g035716 [Sorghum bicolor]
 gb|EES05946.1| hypothetical protein SORBIDRAFT_04g035716 [Sorghum bicolor]
Length=178

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (57%), Gaps = 26/164 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL    ++Q++  D  L+  + +S E+LE++ + LFSDT  +P ASD+K LM+RV+
Sbjct  40   DLVNHLGNCRADQRSVSDPPLTINDGKSKEVLEDLVQYLFSDTHSLP-ASDDKYLMARVD  98

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL  LL+KD  P    + E        D G+   NF          +EE    +      
Sbjct  99   SLYSLLEKDTVPAAICKPE-----CSDDIGI---NF--------DGFEEELNSSLAG---  139

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                  +K+  ++SRKDS G+LLLNLP   S+PQFLFN+AE+S+
Sbjct  140  ------AKEPLTISRKDSFGELLLNLPPEPSIPQFLFNLAENSE  177



>gb|KHG24428.1| Pesticidal crystal cry1Fa [Gossypium arboreum]
Length=488

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 85/164 (52%), Gaps = 49/164 (30%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV H+   ++EQ T+      S E Q++  LEEI + L +D+Q+   ASDEKSLMSRVN
Sbjct  363  DLVDHIGNCITEQMTA------SVESQNI--LEEITQYLLNDSQHT-TASDEKSLMSRVN  413

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL CLLQKD                          + S+ V  +                
Sbjct  414  SLYCLLQKD----------------------SATEYGSSLVPMD----------------  435

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
              D+  SK    MSRKDS+GDLLLNLPRI S+P+FLFN  EDSD
Sbjct  436  --DVAGSKLSHPMSRKDSIGDLLLNLPRIASMPKFLFNTLEDSD  477



>ref|XP_009345909.1| PREDICTED: uncharacterized protein LOC103937692, partial [Pyrus 
x bretschneideri]
Length=512

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 91/167 (54%), Gaps = 15/167 (9%)
 Frame = -1

Query  742  HLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCC  563
            H+   +SEQ TS +   + ++ +   MLE+I + L SDTQ+   ASDEKSLMSRVNSLCC
Sbjct  357  HIGNCISEQMTSGNPPSADQQSEYQYMLEDIAQYLLSDTQFT-TASDEKSLMSRVNSLCC  415

Query  562  LLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddl  383
            LLQKDP           H    GD  V E + +   V  + N+  +           D +
Sbjct  416  LLQKDP--------AAAHTQVDGDSYV-EGSGSGRDV--QPNHTPDNKSGAVIKDPEDGV  464

Query  382  TCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAEDSDYHQA  251
            +  K+   MSRKDS  +LL +LPRI    SLP+ LFNI+E+    QA
Sbjct  465  SNRKKAPGMSRKDSFAELLFHLPRIASLPSLPKVLFNISEEDCKSQA  511



>ref|XP_009360003.1| PREDICTED: uncharacterized protein LOC103950506 [Pyrus x bretschneideri]
Length=553

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 91/167 (54%), Gaps = 15/167 (9%)
 Frame = -1

Query  742  HLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCC  563
            H+   +SEQ TS +   + ++ +   MLE+I + L SDTQ+   ASDEKSLMSRVNSLCC
Sbjct  398  HIGNCISEQMTSGNPPSADQQSEYQYMLEDIAQYLLSDTQFT-TASDEKSLMSRVNSLCC  456

Query  562  LLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddl  383
            LLQKDP           H    GD  V E + +   V  + N+  +           D +
Sbjct  457  LLQKDP--------AAAHTQVDGDSYV-EGSGSGRDV--QPNHTPDNKSGAVIKDPEDGV  505

Query  382  TCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAEDSDYHQA  251
            +  K+   MSRKDS  +LL +LPRI    SLP+ LFNI+E+    QA
Sbjct  506  SDRKKAPGMSRKDSFAELLFHLPRIASLPSLPKVLFNISEEDCKSQA  552



>ref|XP_009399571.1| PREDICTED: uncharacterized protein LOC103983938 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399572.1| PREDICTED: uncharacterized protein LOC103983938 [Musa acuminata 
subsp. malaccensis]
Length=517

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 90/162 (56%), Gaps = 31/162 (19%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+HL Q +SEQ TS + +L S+   + E+LE+I + L +D+Q   A SDE+S++SRVN
Sbjct  381  DLVNHLGQHISEQMTSVNPSLPSDALPNKEVLEDIAQYLLNDSQ-CSATSDEQSIISRVN  439

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD    T Q  +               + A A V +  + E            
Sbjct  440  SLCCLLQKDNRTGTTQNSQT-------------KDSAEAQVDAGSDDE------------  474

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                     +  ++RK+S G+LL+ LPRI S+P+FLFNI+ED
Sbjct  475  ----LVDAAQPPITRKESFGELLI-LPRIASMPKFLFNISED  511



>gb|KJB68963.1| hypothetical protein B456_011G001000 [Gossypium raimondii]
Length=488

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 82/164 (50%), Gaps = 49/164 (30%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV H+   ++EQ T+      S E Q++  LEEI + L +D+Q+   AS+EKSLMSRVN
Sbjct  363  DLVDHIGNCITEQMTA------SVESQNI--LEEITQYLLNDSQHT-TASEEKSLMSRVN  413

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL CLLQKD         E+       D   G                            
Sbjct  414  SLYCLLQKD------SATEDGSSLVPMDDVAG----------------------------  439

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                  SK    MSRKDS+GDLLLNLPRI S+P+FLFN  EDSD
Sbjct  440  ------SKLSHPMSRKDSIGDLLLNLPRIASMPKFLFNTLEDSD  477



>gb|KJB68964.1| hypothetical protein B456_011G001000 [Gossypium raimondii]
Length=474

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 82/164 (50%), Gaps = 49/164 (30%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV H+   ++EQ T+      S E Q++  LEEI + L +D+Q+   AS+EKSLMSRVN
Sbjct  349  DLVDHIGNCITEQMTA------SVESQNI--LEEITQYLLNDSQHT-TASEEKSLMSRVN  399

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL CLLQKD         E+       D   G                            
Sbjct  400  SLYCLLQKD------SATEDGSSLVPMDDVAG----------------------------  425

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                  SK    MSRKDS+GDLLLNLPRI S+P+FLFN  EDSD
Sbjct  426  ------SKLSHPMSRKDSIGDLLLNLPRIASMPKFLFNTLEDSD  463



>ref|XP_004309859.1| PREDICTED: uncharacterized protein LOC101299924 [Fragaria vesca 
subsp. vesca]
Length=547

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 89/166 (54%), Gaps = 15/166 (9%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPA-ASDEKSLMSRV  578
            D +SH+   +SEQ TS +   + ++ +  ++LE+I + L SDTQ   A  S E SLMSRV
Sbjct  387  DFMSHIGNCISEQMTSGNPPSADQQSEYQDILEDIAQYLLSDTQLTAADESHETSLMSRV  446

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            NSLCCLLQKD  P + Q  +   E   G + +        +  +     E          
Sbjct  447  NSLCCLLQKD--PASLQNSQIEVEETDGGRDIHPNQTPVGTSGTHMQAPEE---------  495

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRIT---SLPQFLFNIAED  269
               D++  K+   MSRKDS G+LL +LPRI    SLP+ LFNI+ED
Sbjct  496  DMKDVSGGKKAPGMSRKDSFGELLFHLPRIASLPSLPKVLFNISED  541



>ref|XP_004507038.1| PREDICTED: uncharacterized protein LOC101500032 [Cicer arietinum]
Length=516

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 89/163 (55%), Gaps = 17/163 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLV+H+   +SEQ      N +        MLEE  + LF+D+Q M  ASDE  +MSRVN
Sbjct  366  DLVNHIGHCISEQMGPDSSNFADRS-----MLEEFTQYLFADSQLM-QASDEPYVMSRVN  419

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL CLLQKDP     +   N  +    D+ V   N ++       + E  +    DD G 
Sbjct  420  SLYCLLQKDPSTTEDKTVHNTDD----DRKVDASNNSTRCETKMVDLESEQRDDDDDSG-  474

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                  ++Q+  +SRK+S G+LL+NLPRI S+P FLF ++EDS
Sbjct  475  ------NQQEIGLSRKESAGELLMNLPRIASMPHFLFPMSEDS  511



>ref|XP_010235910.1| PREDICTED: uncharacterized protein LOC100824406 isoform X2 [Brachypodium 
distachyon]
Length=465

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 99/172 (58%), Gaps = 15/172 (9%)
 Frame = -1

Query  763  VDGDLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            +DG L++HL   ++EQ+ + +  L + E  S E L+ I +CL SDTQ  P +SDEK LM+
Sbjct  308  MDG-LLNHLGNCITEQQAAGNPPLPNTEAPSKEFLD-IAQCLLSDTQ-GPPSSDEKYLMA  364

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RV+SL  LL+KD  P T    +       GD  VGE +F        R+  E++   P  
Sbjct  365  RVDSLYSLLEKDTAPSTISMPDQ-----NGDIAVGEMSFEE----ELRSCLEDKELGPAP  415

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                 D+T   + A++SRKDS  +LL NLPRI S+ Q+LF+I EDS+   +R
Sbjct  416  ATKTADVT---EPAALSRKDSFEELLENLPRIASISQYLFDIEEDSENSGSR  464



>ref|XP_010235909.1| PREDICTED: uncharacterized protein LOC100824406 isoform X1 [Brachypodium 
distachyon]
Length=484

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 99/172 (58%), Gaps = 15/172 (9%)
 Frame = -1

Query  763  VDGDLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMS  584
            +DG L++HL   ++EQ+ + +  L + E  S E L+ I +CL SDTQ  P +SDEK LM+
Sbjct  327  MDG-LLNHLGNCITEQQAAGNPPLPNTEAPSKEFLD-IAQCLLSDTQ-GPPSSDEKYLMA  383

Query  583  RVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdd  404
            RV+SL  LL+KD  P T    +       GD  VGE +F        R+  E++   P  
Sbjct  384  RVDSLYSLLEKDTAPSTISMPDQ-----NGDIAVGEMSFEE----ELRSCLEDKELGPAP  434

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
                 D+T   + A++SRKDS  +LL NLPRI S+ Q+LF+I EDS+   +R
Sbjct  435  ATKTADVT---EPAALSRKDSFEELLENLPRIASISQYLFDIEEDSENSGSR  483



>ref|XP_006845397.1| hypothetical protein AMTR_s00019p00062450 [Amborella trichopoda]
 gb|ERN07072.1| hypothetical protein AMTR_s00019p00062450 [Amborella trichopoda]
Length=557

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 93/171 (54%), Gaps = 27/171 (16%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DL  H+    SEQ+ S   N S+ ++   E+L+++ + LF D+Q +   SDEKSLM+RVN
Sbjct  397  DLAHHIGLCFSEQRESG--NPSALDK---EVLDDLTQHLFGDSQ-LSLVSDEKSLMARVN  450

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpd----  407
            SLCCLLQKD  P       NF  P    + + E  F     V++ + E +          
Sbjct  451  SLCCLLQKDGNP-------NFQFP----QSISEDEFRVDGKVNDESVEGSAITLTLDDKC  499

Query  406  ------ddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAE  272
                   +    D++  KQ A+MSRK+SVGDLLL++PRI S P+ LF + E
Sbjct  500  SLGLLPGEAQNTDISFYKQPATMSRKESVGDLLLHIPRIASHPKMLFGLQE  550



>gb|EYU37144.1| hypothetical protein MIMGU_mgv1a006661mg [Erythranthe guttata]
Length=436

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 86/170 (51%), Gaps = 26/170 (15%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSE-ERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DLV+ +E  +SEQ TS   NL SE   +  +MLE I + L SD        DEKSLM +V
Sbjct  288  DLVNQIENCISEQMTSG--NLPSETASECHDMLENIAQVLLSDNNCA-TGLDEKSLMKKV  344

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGE-FNFASASVVSERNYEENRpptpddd  401
            NSLCCLLQ    P TA      H     ++G    F+F S S  +E+  + N  P     
Sbjct  345  NSLCCLLQD---PVTASNDGENHYKTADNRGKNACFDFVSDSCTNEKVSDGNLKPAA---  398

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITS---LPQFLFNIAEDSDY  260
                          ++RKDS+ DLL +LP I S   LP+FLF I ED +Y
Sbjct  399  ------------PGLTRKDSLSDLLSHLPSIASLPKLPKFLFGIEEDGEY  436



>ref|XP_010525794.1| PREDICTED: uncharacterized protein LOC104803550 isoform X4 [Tarenaya 
hassleriana]
Length=519

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 84/162 (52%), Gaps = 13/162 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D ++HLEQ +S+     +    SE R+    + +I + LFS+TQ +   SDEKSLMSRVN
Sbjct  364  DFMNHLEQYISDPAPGNE----SERRE----IRDIAQHLFSETQ-LTTLSDEKSLMSRVN  414

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD            +E + G  G          V+ +R   + R  +  +   
Sbjct  415  SLCCLLQKD---GITAANSQLNEESAGFPGKYSQPNGLKGVLHDRGTRDERKVSDPEATE  471

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                + S  +  M R DS  ++LL LPRI SLPQFL  IAED
Sbjct  472  DASGSKSPARG-MQRIDSYNEILLQLPRIASLPQFLSFIAED  512



>ref|XP_010525792.1| PREDICTED: uncharacterized protein LOC104803550 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 84/162 (52%), Gaps = 13/162 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D ++HLEQ +S+     +    SE R+    + +I + LFS+TQ +   SDEKSLMSRVN
Sbjct  371  DFMNHLEQYISDPAPGNE----SERRE----IRDIAQHLFSETQ-LTTLSDEKSLMSRVN  421

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD            +E + G  G          V+ +R   + R  +  +   
Sbjct  422  SLCCLLQKD---GITAANSQLNEESAGFPGKYSQPNGLKGVLHDRGTRDERKVSDPEATE  478

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                + S  +  M R DS  ++LL LPRI SLPQFL  IAED
Sbjct  479  DASGSKSPARG-MQRIDSYNEILLQLPRIASLPQFLSFIAED  519



>ref|XP_010525793.1| PREDICTED: uncharacterized protein LOC104803550 isoform X3 [Tarenaya 
hassleriana]
Length=525

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 84/162 (52%), Gaps = 13/162 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D ++HLEQ +S+     +    SE R+    + +I + LFS+TQ +   SDEKSLMSRVN
Sbjct  370  DFMNHLEQYISDPAPGNE----SERRE----IRDIAQHLFSETQ-LTTLSDEKSLMSRVN  420

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD            +E + G  G          V+ +R   + R  +  +   
Sbjct  421  SLCCLLQKD---GITAANSQLNEESAGFPGKYSQPNGLKGVLHDRGTRDERKVSDPEATE  477

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                + S  +  M R DS  ++LL LPRI SLPQFL  IAED
Sbjct  478  DASGSKSPARG-MQRIDSYNEILLQLPRIASLPQFLSFIAED  518



>ref|XP_010525791.1| PREDICTED: uncharacterized protein LOC104803550 isoform X1 [Tarenaya 
hassleriana]
Length=527

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 84/162 (52%), Gaps = 13/162 (8%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D ++HLEQ +S+     +    SE R+    + +I + LFS+TQ +   SDEKSLMSRVN
Sbjct  372  DFMNHLEQYISDPAPGNE----SERRE----IRDIAQHLFSETQ-LTTLSDEKSLMSRVN  422

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLCCLLQKD            +E + G  G          V+ +R   + R  +  +   
Sbjct  423  SLCCLLQKD---GITAANSQLNEESAGFPGKYSQPNGLKGVLHDRGTRDERKVSDPEATE  479

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
                + S  +  M R DS  ++LL LPRI SLPQFL  IAED
Sbjct  480  DASGSKSPARG-MQRIDSYNEILLQLPRIASLPQFLSFIAED  520



>ref|XP_010063615.1| PREDICTED: uncharacterized protein LOC104450653 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010063616.1| PREDICTED: uncharacterized protein LOC104450653 isoform X2 [Eucalyptus 
grandis]
Length=423

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 17/157 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   ++E++ + D  +S E+ QS +++E++ R LFSD+Q  P  SDE++ +SRVN
Sbjct  276  DLVSHIGHCITERRAAGDPLISGEQLQSTDIMEDLTRYLFSDSQVSP--SDERAFLSRVN  333

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLC LLQKD           + +    D  +   N ++A        EE           
Sbjct  334  SLCSLLQKD------DTTAGYVQTTKKDDDMDVQNDSTAPAHEVAITEEQ---------C  378

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLF  284
                  + +     R DSVG+LLL+LPRI SLP  L+
Sbjct  379  GSGAEPTNESTLPKRHDSVGELLLDLPRIASLPHILW  415



>ref|XP_010063614.1| PREDICTED: uncharacterized protein LOC104450653 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70847.1| hypothetical protein EUGRSUZ_F03986 [Eucalyptus grandis]
Length=506

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 17/157 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   ++E++ + D  +S E+ QS +++E++ R LFSD+Q  P  SDE++ +SRVN
Sbjct  359  DLVSHIGHCITERRAAGDPLISGEQLQSTDIMEDLTRYLFSDSQVSP--SDERAFLSRVN  416

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SLC LLQKD           + +    D  +   N ++A        EE           
Sbjct  417  SLCSLLQKD------DTTAGYVQTTKKDDDMDVQNDSTAPAHEVAITEEQ---------C  461

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLF  284
                  + +     R DSVG+LLL+LPRI SLP  L+
Sbjct  462  GSGAEPTNESTLPKRHDSVGELLLDLPRIASLPHILW  498



>ref|XP_010526305.1| PREDICTED: uncharacterized protein LOC104803910 [Tarenaya hassleriana]
Length=538

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 90/168 (54%), Gaps = 16/168 (10%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            + ++HLEQ +S+     +    SE ++ L+    I + LFS+TQ+    SDEKSLM+RVN
Sbjct  383  NFMNHLEQCLSDPARGNE----SERKEILD----IAQLLFSETQFT-TLSDEKSLMTRVN  433

Query  574  SLCCLLQKDPPPPTAQRRENFH-EPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
            SLCCLLQKD    TA      + E ++G    G+F+  +      R+  ENR      D 
Sbjct  434  SLCCLLQKD---GTAAGNSQLNEESSVGCPDTGKFSQPNDLRKGLRD-NENRDEHKVSDP  489

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFL-FNIAEDSDYH  257
                 + SK    + R DS  ++LL LPRI SLPQFL F   ED D H
Sbjct  490  EATGASSSKPPG-IPRIDSYNEILLQLPRIASLPQFLPFITGEDGDAH  536



>ref|XP_008381124.1| PREDICTED: uncharacterized protein LOC103443996 [Malus domestica]
Length=500

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 6/129 (5%)
 Frame = -1

Query  694  LSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPP-TAQRRE  518
            +S +E+ S +MLEEI + LFSD+Q +   SDE+SLM+RVNSLCCLLQKDP      Q R 
Sbjct  362  ISGKEQPSTDMLEEITQYLFSDSQ-ITLPSDEQSLMTRVNSLCCLLQKDPSTELNLQVRS  420

Query  517  NFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSV  338
            +       D+   E N A AS    +  +      P   G P+D +  KQ+ +M R+DS 
Sbjct  421  DEWLNGSDDRKAAETNSAFASARESKPVQ----GFPVPKGEPNDDSADKQELTMRRRDSF  476

Query  337  GDLLLNLPR  311
            G+LLLN+PR
Sbjct  477  GELLLNIPR  485



>ref|XP_009396105.1| PREDICTED: uncharacterized protein LOC103981195 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=525

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 35/167 (21%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D ++ L   +S+Q  S++   S    +  E+LE +   LF+D+Q MPA SDE+S+MS+VN
Sbjct  385  DFINQLGYCISDQFASRNPLSSGTVIRDQEILELV-ESLFTDSQ-MPA-SDERSIMSKVN  441

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGV---GEFNFASASVVSERNYEENRpptpdd  404
            S CCLLQ                    D G+    + N+   S        E        
Sbjct  442  SFCCLLQ--------------------DAGMVQSQQMNWGGTSTTGNGFDPEEESNEASG  481

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                      +  A++SRKDS G+LL++LPRI SLPQFLF+IAED +
Sbjct  482  R---------RTAANISRKDSFGELLMHLPRIASLPQFLFDIAEDGE  519



>ref|XP_009396106.1| PREDICTED: uncharacterized protein LOC103981195 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=524

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 35/167 (21%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D ++ L   +S+Q  S++   S    +  E+LE +   LF+D+Q MPA SDE+S+MS+VN
Sbjct  384  DFINQLGYCISDQFASRNPLSSGTVIRDQEILELV-ESLFTDSQ-MPA-SDERSIMSKVN  440

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGV---GEFNFASASVVSERNYEENRpptpdd  404
            S CCLLQ                    D G+    + N+   S        E        
Sbjct  441  SFCCLLQ--------------------DAGMVQSQQMNWGGTSTTGNGFDPEEESNEASG  480

Query  403  dglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                      +  A++SRKDS G+LL++LPRI SLPQFLF+IAED +
Sbjct  481  R---------RTAANISRKDSFGELLMHLPRIASLPQFLFDIAEDGE  518



>gb|KHN04197.1| hypothetical protein glysoja_032693 [Glycine soja]
Length=599

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN  425
            +MSRVNSL CLLQKDP       T  R  N  +   G K VG     S S ++E +    
Sbjct  487  VMSRVNSLYCLLQKDPYTAEDTNTMTRNGNGLDADEGGK-VG----VSNSNITELSQPCK  541

Query  424  RpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
               +  +    D   C +    MSRK+S GDLLLNLPR+ SLPQFLFN++EDS
Sbjct  542  TKVSDLEVQADDASGCKQGGTGMSRKESAGDLLLNLPRVASLPQFLFNMSEDS  594


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + N   + + S  +LEE  + LF+D+Q+    SDE+ +MS+VN
Sbjct  371  DLVSHIGHCISEQMGSDNPNFVGDNQYSRSILEEFTQYLFNDSQHA-TTSDEQRVMSKVN  429

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  430  SLYCLLQKDP  439



>ref|XP_003530210.1| PREDICTED: uncharacterized protein LOC100808320 isoform X1 [Glycine 
max]
Length=599

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN  425
            +MSRVNSL CLLQKDP       T  R  N  +   G K VG     S S ++E +    
Sbjct  487  VMSRVNSLYCLLQKDPYTAEDTNTMTRNGNGLDADEGGK-VG----VSNSNITELSQPCK  541

Query  424  RpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
               +  +    D   C +    MSRK+S GDLLLNLPR+ SLPQFLFN++EDS
Sbjct  542  TKVSDLEVQADDASGCKQGGTGMSRKESAGDLLLNLPRVASLPQFLFNMSEDS  594


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + N + + + S  +LEE  + LF+D+Q+    SDE+ +MS+VN
Sbjct  371  DLVSHIGHCISEQMGSDNPNFAGDNQYSRSILEEFTQYLFNDSQHA-TTSDEQRVMSKVN  429

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  430  SLYCLLQKDP  439



>ref|XP_006583081.1| PREDICTED: uncharacterized protein LOC100808320 isoform X2 [Glycine 
max]
Length=600

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEEN  425
            +MSRVNSL CLLQKDP       T  R  N  +   G K VG     S S ++E +    
Sbjct  488  VMSRVNSLYCLLQKDPYTAEDTNTMTRNGNGLDADEGGK-VG----VSNSNITELSQPCK  542

Query  424  RpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
               +  +    D   C +    MSRK+S GDLLLNLPR+ SLPQFLFN++EDS
Sbjct  543  TKVSDLEVQADDASGCKQGGTGMSRKESAGDLLLNLPRVASLPQFLFNMSEDS  595


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + N + + + S  +LEE  + LF+D+Q+    SDE+ +MS+VN
Sbjct  372  DLVSHIGHCISEQMGSDNPNFAGDNQYSRSILEEFTQYLFNDSQHA-TTSDEQRVMSKVN  430

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  431  SLYCLLQKDP  440



>ref|XP_002878722.1| hypothetical protein ARALYDRAFT_481267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54981.1| hypothetical protein ARALYDRAFT_481267 [Arabidopsis lyrata subsp. 
lyrata]
Length=457

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 69/132 (52%), Gaps = 23/132 (17%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             EE+ + L SDTQ  P  SDEKS+MS+VNS C LLQ            N H         
Sbjct  347  FEEMKQILLSDTQTDP--SDEKSVMSKVNSFCNLLQS---------AANSH---------  386

Query  481  GEFNFASASVVSERNYEEN-RpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRIT  305
               N  +A    E   + N R  T     + D  + SK    MSRKDS  DLL++LPRIT
Sbjct  387  --LNIENADTGKEIGVDNNSRHMTEGGKRVVDPASSSKPLQGMSRKDSFSDLLVHLPRIT  444

Query  304  SLPQFLFNIAED  269
            SLP+FLFNI+E+
Sbjct  445  SLPKFLFNISEE  456



>ref|XP_003538884.1| PREDICTED: uncharacterized protein LOC100809148 [Glycine max]
Length=431

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 61/114 (54%), Gaps = 12/114 (11%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDK-GVGEFNFASASVVSERNYEE  428
            +MSRVNSL CLLQKDP       T  R +N  +   G K GV   N    S    +    
Sbjct  321  VMSRVNSLYCLLQKDPSTAEDTNTMTRNDNGLDADEGGKVGVSNSNTTELSPCKIK----  376

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                   +    D   C +  + MSRK+S GDLLLNLPRI SLPQFLFN++EDS
Sbjct  377  ---VPDLEVQPDDASGCKQGVSGMSRKESAGDLLLNLPRIASLPQFLFNMSEDS  427


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + +L+ +   S  +LEE ++ LF+D+Q+    SDE+ +MSRVN
Sbjct  202  DLVSHIGHCISEQMGSDNPSLAGDSLYSRSILEEFSQYLFNDSQH-ATTSDEQRVMSRVN  260

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  261  SLYCLLQKDP  270



>gb|KHN38060.1| hypothetical protein glysoja_007102 [Glycine soja]
Length=601

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 60/114 (53%), Gaps = 12/114 (11%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDK-GVGEFNFASASVVSERNYEE  428
            +MSRVNSL CLLQKDP       T  R  N  +   G K GV   N    S    +    
Sbjct  490  VMSRVNSLYCLLQKDPSTAEDTDTMTRNGNGLDADEGGKVGVSNSNTTELSACKIK----  545

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                   +    D   C +  + MSRK+S GDLLLNLPRI SLPQFLFN++EDS
Sbjct  546  ---VPDLEVQPDDASGCKQGVSGMSRKESAGDLLLNLPRIASLPQFLFNMSEDS  596


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + +L+ + + S  +LEE ++ LF+D+Q+    SDE+ +MSRVN
Sbjct  371  DLVSHIGHCISEQMGSDNPSLAGDSQYSRSILEEFSQYLFNDSQHA-TTSDEQRVMSRVN  429

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  430  SLYCLLQKDP  439



>ref|XP_003531752.1| PREDICTED: uncharacterized protein LOC100808512 isoform X1 [Glycine 
max]
Length=603

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 60/114 (53%), Gaps = 12/114 (11%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDK-GVGEFNFASASVVSERNYEE  428
            +MSRVNSL CLLQKDP       T  R  N  +   G K GV   N    S    +    
Sbjct  492  VMSRVNSLYCLLQKDPSTAEDTDTMTRNGNGLDADEGGKVGVSNSNTTELSACKIK----  547

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                   +    D   C +  + MSRK+S GDLLLNLPRI SLPQFLFN++EDS
Sbjct  548  ---VPDLEVQPDDASGCKQGVSGMSRKESAGDLLLNLPRIASLPQFLFNMSEDS  598


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + +L+ + + S  +LEE ++ LF+D+Q+    SDE+ +MSRVN
Sbjct  373  DLVSHIGHCISEQMGSDNPSLAGDSQYSRSILEEFSQYLFNDSQHA-TTSDEQRVMSRVN  431

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  432  SLYCLLQKDP  441



>ref|XP_006585654.1| PREDICTED: uncharacterized protein LOC100808512 isoform X2 [Glycine 
max]
Length=604

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 60/114 (53%), Gaps = 12/114 (11%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPP----TAQRRENFHEPAMGDK-GVGEFNFASASVVSERNYEE  428
            +MSRVNSL CLLQKDP       T  R  N  +   G K GV   N    S    +    
Sbjct  493  VMSRVNSLYCLLQKDPSTAEDTDTMTRNGNGLDADEGGKVGVSNSNTTELSACKIK----  548

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                   +    D   C +  + MSRK+S GDLLLNLPRI SLPQFLFN++EDS
Sbjct  549  ---VPDLEVQPDDASGCKQGVSGMSRKESAGDLLLNLPRIASLPQFLFNMSEDS  599


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + +L+ + + S  +LEE ++ LF+D+Q+    SDE+ +MSRVN
Sbjct  374  DLVSHIGHCISEQMGSDNPSLAGDSQYSRSILEEFSQYLFNDSQHA-TTSDEQRVMSRVN  432

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  433  SLYCLLQKDP  442



>gb|AAD03372.2| expressed protein [Arabidopsis thaliana]
Length=463

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 71/132 (54%), Gaps = 23/132 (17%)
 Frame = -1

Query  661  LEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKG  485
             EE+ + L SD TQ  P  SDEKS+MS+VNS C LLQ       A  + N  E A  ++ 
Sbjct  353  FEEMKQLLLSDNTQTDP--SDEKSVMSKVNSFCNLLQS-----AANSQLNI-ETADTERV  404

Query  484  VGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRIT  305
            VG               + NR        + D  + SK    MSRKDS  DLL++LPRIT
Sbjct  405  VG--------------VDNNRHMPEGGKRVVDPASSSKPLQGMSRKDSFSDLLVHLPRIT  450

Query  304  SLPQFLFNIAED  269
            SLP+FLFNI+E+
Sbjct  451  SLPKFLFNISEE  462



>ref|NP_565562.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK68836.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL06884.1| At2g24100/F27D4.1 [Arabidopsis thaliana]
 gb|AAP49526.1| At2g24100 [Arabidopsis thaliana]
 gb|AEC07529.1| uncharacterized protein AT2G24100 [Arabidopsis thaliana]
Length=466

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 71/132 (54%), Gaps = 23/132 (17%)
 Frame = -1

Query  661  LEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKG  485
             EE+ + L SD TQ  P  SDEKS+MS+VNS C LLQ       A  + N  E A  ++ 
Sbjct  356  FEEMKQLLLSDNTQTDP--SDEKSVMSKVNSFCNLLQS-----AANSQLNI-ETADTERV  407

Query  484  VGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRIT  305
            VG               + NR        + D  + SK    MSRKDS  DLL++LPRIT
Sbjct  408  VG--------------VDNNRHMPEGGKRVVDPASSSKPLQGMSRKDSFSDLLVHLPRIT  453

Query  304  SLPQFLFNIAED  269
            SLP+FLFNI+E+
Sbjct  454  SLPKFLFNISEE  465



>ref|XP_010544349.1| PREDICTED: uncharacterized protein LOC104816994 [Tarenaya hassleriana]
Length=448

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 75/165 (45%), Gaps = 43/165 (26%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDT--QYMPAASDEKSLMSR  581
            DL+S +   +S++  S +   S +  Q  +++ E   CL +DT  Q   +A+DE+ +MSR
Sbjct  325  DLLSRIGHCISQEMASGNLMFSPDNLQGRDIMGEFAHCLLNDTTPQLASSATDEQ-IMSR  383

Query  580  VNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpddd  401
            VNSLCCLLQ D                                 SE  Y EN        
Sbjct  384  VNSLCCLLQMD-----------------------------GCSSSEARYGENPQDKQQLG  414

Query  400  glpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                        A++SR +S+ DLLL LPRI SLPQFL  I+E S
Sbjct  415  I-----------AAISRNESLSDLLLTLPRIASLPQFLPTISEGS  448



>ref|XP_006294201.1| hypothetical protein CARUB_v10023197mg [Capsella rubella]
 gb|EOA27099.1| hypothetical protein CARUB_v10023197mg [Capsella rubella]
Length=451

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 65/131 (50%), Gaps = 29/131 (22%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             EE+ + L SDT  +P  SDEKS+MS+VNS C LLQ       A  + N       D G 
Sbjct  349  FEEMKQLLLSDT--LPDTSDEKSVMSKVNSFCNLLQS-----AANSQLNIE---TADTGK  398

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
              +      VV   +                    SK    MSRKDS  DLL++LPRITS
Sbjct  399  DIWIEGGKRVVDPAS-------------------SSKPLQGMSRKDSFSDLLVHLPRITS  439

Query  301  LPQFLFNIAED  269
            LP+FLFNI+E+
Sbjct  440  LPKFLFNISEE  450



>ref|XP_007142109.1| hypothetical protein PHAVU_008G253300g [Phaseolus vulgaris]
 gb|ESW14103.1| hypothetical protein PHAVU_008G253300g [Phaseolus vulgaris]
Length=597

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDPPPPTAQRRE----NFHEPAMGDKGVGEFNFASASVVSERNYEEN  425
            +MSRVNSL CLLQKDP   TA+       N H     + G    N ++++ +S    +  
Sbjct  486  VMSRVNSLYCLLQKDPS--TAEESNTMAGNGHGLGADESGKVGVNNSNSTQLSPGKIK--  541

Query  424  RpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                  +    D   C +    +SRK+S GDLLLNLPRI SLPQFLF+++EDS
Sbjct  542  --VADLESQPDDASGCKQGGTGISRKESSGDLLLNLPRIASLPQFLFHMSEDS  592


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + N + + + S  +LEE  + LF+D+Q+    SDE+ +MSRVN
Sbjct  367  DLVSHIGHCISEQMGSDNPNFAGDVQYSRSILEEFTQYLFNDSQHA-TTSDEQRVMSRVN  425

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  426  SLYCLLQKDP  435



>emb|CDP19452.1| unnamed protein product [Coffea canephora]
Length=91

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = -1

Query  373  KQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSDYHQAR  248
            KQ   MSRKDSVGDLLLNLPRI SLPQF FNI+ED D +QAR
Sbjct  51   KQPPPMSRKDSVGDLLLNLPRIASLPQFSFNISEDVD-NQAR  91



>ref|XP_008679230.1| PREDICTED: uncharacterized protein LOC103654180 [Zea mays]
Length=488

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (50%), Gaps = 26/163 (16%)
 Frame = -1

Query  751  LVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNS  572
            +V  LE    +++++    L++ +  S +  E++ + LFSDT  +PA  D+ +L SRV+S
Sbjct  351  IVPGLEALQGDERSAGGPPLTTNDAISKKAWEDLVQHLFSDTPSLPAL-DDNNLTSRVDS  409

Query  571  LCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglp  392
            L  LL+KD  PP  +  E   +   GD G        A  V    ++             
Sbjct  410  LYSLLEKDTAPPAMRDPECSSD--GGDIG--------AIQVDSDGFK-------------  446

Query  391  ddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                       +SR DS+ +LLLNLP+I S+PQFLFN  EDSD
Sbjct  447  --GRLDPSPPGISRNDSLDELLLNLPKIASIPQFLFNRTEDSD  487



>gb|AFW64169.1| hypothetical protein ZEAMMB73_443308 [Zea mays]
Length=596

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 79/164 (48%), Gaps = 28/164 (17%)
 Frame = -1

Query  751  LVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNS  572
            +V  LE    +++++    L++ +  S +  E++ + LFSDT  +PA  D+ +L SRV+S
Sbjct  459  IVPGLEALQGDERSAGGPPLTTNDAISKKAWEDLVQHLFSDTPSLPAL-DDNNLTSRVDS  517

Query  571  LCCLLQKDPPPPTAQRRENFHEPAMGDKG-VGEFNFASASVVSERNYEENRpptpdddgl  395
            L  LL+KD  PP  +  E        D G +G     S       +              
Sbjct  518  LYSLLEKDTAPPAMRDPE-----CSSDGGDIGAIQVDSDGFKGRLD--------------  558

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                        +SR DS+ +LLLNLP+I S+PQFLFN  EDSD
Sbjct  559  -------PSPPGISRNDSLDELLLNLPKIASIPQFLFNRTEDSD  595



>ref|XP_006412670.1| hypothetical protein EUTSA_v10024775mg [Eutrema salsugineum]
 gb|ESQ54123.1| hypothetical protein EUTSA_v10024775mg [Eutrema salsugineum]
Length=578

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 73/136 (54%), Gaps = 18/136 (13%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            +++E  E + + L SD      A DEKSLM RVNSL  LL KDP    A   +   E ++
Sbjct  454  ENVEKFENMKQQLLSDNIQFDTA-DEKSLMPRVNSLFNLLYKDPN--VAANSQLNTEISV  510

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E N     V    N             + D  +CSK +  MSRKDS GDLLL+L
Sbjct  511  GLKS--EPNDLKGIVSDSSN------------RVLDPASCSKPQG-MSRKDSFGDLLLHL  555

Query  316  PRITSLPQFLFNIAED  269
            PRITSLP+FL NI+E+
Sbjct  556  PRITSLPKFLSNISEE  571



>ref|XP_006580837.1| PREDICTED: uncharacterized protein LOC102669004 [Glycine max]
Length=522

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  + EQ TS + +      +  EMLEEI + L +D + +   SDEKSLM+RVN
Sbjct  430  DFIGHIEHCLFEQITSGNPSFCGGRLEFQEMLEEIAQHLLNDNKVI-TTSDEKSLMTRVN  488

Query  574  SLCCLLQKDP  545
            SLCCLLQKDP
Sbjct  489  SLCCLLQKDP  498



>gb|KHN25903.1| hypothetical protein glysoja_018757 [Glycine soja]
Length=503

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D + H+E  + EQ TS + +      +  EMLEEI + L +D + +   SDEKSLM+RVN
Sbjct  383  DFIGHIEHCLFEQITSGNPSFCGGRLEFQEMLEEIAQHLLNDNKVI-TTSDEKSLMTRVN  441

Query  574  SLCCLLQKDP  545
            SLCCLLQKDP
Sbjct  442  SLCCLLQKDP  451



>ref|XP_009127531.1| PREDICTED: uncharacterized protein LOC103852376 [Brassica rapa]
 emb|CDY28214.1| BnaA01g06350D [Brassica napus]
Length=572

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 75/143 (52%), Gaps = 19/143 (13%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + LE  E + + L SD  Q+     DEKSLM RVNSL  LL KDP    A   +   E  
Sbjct  447  EHLEKFESLKQQLLSDNIQF--DTPDEKSLMPRVNSLFNLLYKDPN--VAANSQLNTEIP  502

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K   E N  + +V +  N   NR   P           SK +  M RKDS  DLLL+
Sbjct  503  VGLKS--ELNDLNGTVSANNN---NRVLDPASS--------SKPQGGMLRKDSFSDLLLH  549

Query  319  LPRITSLPQFLFNIA-EDSDYHQ  254
            LPRITSLP+FL NI+ ED D ++
Sbjct  550  LPRITSLPKFLSNISEEDGDAYK  572



>ref|XP_009771706.1| PREDICTED: uncharacterized protein LOC104222210 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009771707.1| PREDICTED: uncharacterized protein LOC104222210 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009771708.1| PREDICTED: uncharacterized protein LOC104222210 isoform X1 [Nicotiana 
sylvestris]
Length=135

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 17/100 (17%)
 Frame = -1

Query  748  VSHLEQRM-SEQKTSKDFNLSSEERQSLEM------------LEEINRCLFSDTQYMPAA  608
            V HL+  + S    +   N+  EE +SL +            L+ I  CLFS+TQ M A 
Sbjct  39   VRHLKNSLLSGHYENSLINIGIEEDESLVLDSDFLVPMKGCQLKRIWNCLFSNTQNMSA-  97

Query  607  SDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDK  488
             DEKSL +RVNSLCCLLQKD  P T  + EN  + A+G K
Sbjct  98   -DEKSLWTRVNSLCCLLQKD--PITVNKSENCVDVAVGGK  134



>gb|AGV54845.1| hypothetical protein [Phaseolus vulgaris]
Length=597

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            DLVSH+   +SEQ  S + N + + + S  +LEE  + LF+D+Q+    SDE+ +MSRVN
Sbjct  367  DLVSHIGHCISEQMGSDNPNFAGDVQYSRSILEEFTQYLFNDSQHA-TTSDEQRVMSRVN  425

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  426  SLYCLLQKDP  435


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 54/114 (47%), Gaps = 12/114 (11%)
 Frame = -1

Query  592  LMSRVNSLCCLLQKDP-----PPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEE  428
            +MSRVNSL CLLQKDP       P A           G  GV   N    S    +    
Sbjct  486  VMSRVNSLYCLLQKDPFTAEESNPMAGNGHGLGADESGKVGVNNSNSTQLSPGKIK----  541

Query  427  NRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDS  266
                   +    D   C +    +SRK+S GDLL NLPRI  LPQFLF+++EDS
Sbjct  542  ---VADLESQPDDASGCKQGGTGISRKESSGDLLFNLPRIAFLPQFLFHMSEDS  592



>ref|XP_009771709.1| PREDICTED: uncharacterized protein LOC104222210 isoform X2 [Nicotiana 
sylvestris]
Length=123

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDK  488
            L+ I  CLFS+TQ M A  DEKSL +RVNSLCCLLQKD  P T  + EN  + A+G K
Sbjct  69   LKRIWNCLFSNTQNMSA--DEKSLWTRVNSLCCLLQKD--PITVNKSENCVDVAVGGK  122



>gb|KFK41359.1| hypothetical protein AALP_AA2G119900 [Arabis alpina]
Length=468

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 66/136 (49%), Gaps = 29/136 (21%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             EE+ + L +DTQ  P  SDEKS+MS+VNS   LL       +A  + N      G    
Sbjct  359  FEEMKQLLLTDTQ--PNTSDEKSVMSKVNSFNNLLDS-----SANSQLNTKNSDRGPNNA  411

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
             E               +NR          DD   S +   MSRKDS  DL ++LPRITS
Sbjct  412  KEIGL------------DNR---------VDDPASSSKSHGMSRKDSFSDLFVHLPRITS  450

Query  301  LPQFLFNIA-EDSDYH  257
            LP+F+FNI+ ED D H
Sbjct  451  LPKFVFNISEEDGDAH  466



>gb|KFK41360.1| hypothetical protein AALP_AA2G119900 [Arabis alpina]
Length=443

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 66/136 (49%), Gaps = 29/136 (21%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             EE+ + L +DTQ  P  SDEKS+MS+VNS   LL       +A  + N      G    
Sbjct  334  FEEMKQLLLTDTQ--PNTSDEKSVMSKVNSFNNLLDS-----SANSQLNTKNSDRGPNNA  386

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
             E               +NR          DD   S +   MSRKDS  DL ++LPRITS
Sbjct  387  KEIGL------------DNR---------VDDPASSSKSHGMSRKDSFSDLFVHLPRITS  425

Query  301  LPQFLFNIA-EDSDYH  257
            LP+F+FNI+ ED D H
Sbjct  426  LPKFVFNISEEDGDAH  441



>ref|XP_006404909.1| hypothetical protein EUTSA_v10000158mg [Eutrema salsugineum]
 gb|ESQ46362.1| hypothetical protein EUTSA_v10000158mg [Eutrema salsugineum]
Length=459

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 62/138 (45%), Gaps = 35/138 (25%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             EE+ + L SDT      SDEKS+MS+VNS   LLQ                        
Sbjct  356  FEEMKQLLLSDTHPENNTSDEKSVMSKVNSFYNLLQ------------------------  391

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
               + A+ +   E   E N                S +   MSRKDS  DLL++LPRITS
Sbjct  392  ---SAANTNDGKETGVEGNNRVLDPAS-------SSSKTQGMSRKDSFTDLLVHLPRITS  441

Query  301  LPQFLFNIA-EDSDYHQA  251
            LP+FLFNI+ ED D H  
Sbjct  442  LPKFLFNISEEDGDVHTG  459



>ref|XP_010472409.1| PREDICTED: uncharacterized protein LOC104752037 [Camelina sativa]
Length=457

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 66/131 (50%), Gaps = 22/131 (17%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             EE+ + L SDT  +P  SDEKS+MS+VNS C LLQ       A  + N  E    DK +
Sbjct  348  FEEMKQLLLSDT--LPDTSDEKSVMSKVNSFCNLLQS-----AANSQLNI-ETTDTDKEI  399

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
            G               + NR  T     + D  + SK    MSRKDS  DL  +LPRI S
Sbjct  400  G--------------VDRNRHMTEGGKRVVDLASSSKPLQGMSRKDSFSDLSGHLPRIAS  445

Query  301  LPQFLFNIAED  269
            L +FL NI+E+
Sbjct  446  LTKFLSNISEE  456



>ref|XP_002869363.1| hypothetical protein ARALYDRAFT_491676 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45622.1| hypothetical protein ARALYDRAFT_491676 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 71/137 (52%), Gaps = 20/137 (15%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + +E  E + + L SD  Q+   A DEKSLM RVNSL  LL KDP    A   +   E +
Sbjct  463  EHMEKFEIMKQQLLSDNIQF--EAPDEKSLMPRVNSLFNLLYKDPN--VAANSQLNTEMS  518

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K           +VS+ N   +R   P           S +   M RKDS  DLLL+
Sbjct  519  VGLKS------EPKGIVSDNNNNNDRVLDPA---------SSSKPQGMLRKDSFSDLLLH  563

Query  319  LPRITSLPQFLFNIAED  269
            LPRITSLP+FL NI+E+
Sbjct  564  LPRITSLPKFLSNISEE  580



>emb|CAN68794.1| hypothetical protein VITISV_016174 [Vitis vinifera]
Length=1017

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 57/175 (33%), Positives = 80/175 (46%), Gaps = 24/175 (14%)
 Frame = -1

Query  757   GDLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
             GD  S LE    ++  S DF L  EE  S   L++    +          S        +
Sbjct  852   GDTDSVLED--PDESKSHDFGLKREEDSSFSGLQDAPSRVMDTHVIEENGSIGTEGPKWL  909

Query  577   NSLCCLLQKDPPPPTAQRRENFHEPAM---------------GDKGVGEFNFASASVVSE  443
             N+LC +  K P   ++    + +EPA                GD  +GE N  +AS  S+
Sbjct  910   NNLCQI--KVPGLHSSMSMSDLNEPAAVQNFQVKSENGTDTAGDGSIGELNPIAASCESK  967

Query  442   RNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNI  278
                       P  +   +D++  KQ  +MSRKDSVG+LL+NLPRI SLPQFLFN+
Sbjct  968   -----TAGDFPTPNDETNDVSSCKQPPAMSRKDSVGELLVNLPRIASLPQFLFNM  1017



>ref|XP_010438134.1| PREDICTED: uncharacterized protein LOC104721765 [Camelina sativa]
Length=587

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 71/137 (52%), Gaps = 20/137 (15%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + +E  E + + L SD  Q+   A DE+SLM RVNSL  LL KDP  P   +     E +
Sbjct  463  EHMEKFEIMKQQLLSDNIQF--EAPDERSLMPRVNSLFNLLYKDPNVPVNSQPNT--EIS  518

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K           ++S+ N   N            D   S +   M RKDS GDLLL+
Sbjct  519  VGLKSEPS---DPKGILSDNNNRVN------------DPASSSKPQGMLRKDSFGDLLLH  563

Query  319  LPRITSLPQFLFNIAED  269
            LPRITSLP+FL NI+E+
Sbjct  564  LPRITSLPKFLANISEE  580



>ref|XP_010432947.1| PREDICTED: uncharacterized protein LOC104717115 [Camelina sativa]
Length=591

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + +E  E + + L SD      A DE+SLM RVNSL  LL KDP  P   +     E ++
Sbjct  463  EHMEKFEIMKQQLLSDN-IQSEAPDERSLMPRVNSLFNLLYKDPNVPVNSQPNT--EISV  519

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E N     V    N   NR   P           S +   M RKDS GDLLL+L
Sbjct  520  GLKS--EPNDPKGIVSDNNNNNNNRVIDPA---------SSSKPQGMLRKDSFGDLLLHL  568

Query  316  PRITSLPQFLFNIAED  269
            PRITSLP+FL NI+E+
Sbjct  569  PRITSLPKFLSNISEE  584



>ref|XP_006283391.1| hypothetical protein CARUB_v10004435mg [Capsella rubella]
 gb|EOA16289.1| hypothetical protein CARUB_v10004435mg [Capsella rubella]
Length=586

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 73/137 (53%), Gaps = 18/137 (13%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + +E  E + + L SD  Q+   A DE+SLM RVNSL  LL KDP  P   +     E +
Sbjct  460  EHMEKFEIMKQQLLSDNIQF--EAPDERSLMPRVNSLFNLLYKDPNVPANSQLNT--EIS  515

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K   E N     +VS+ N   NR   P           S +   M RKDS  DLLL+
Sbjct  516  VGLKS--EPNDLKG-IVSDNN-NNNRVLDPA---------SSSKPQGMLRKDSFSDLLLH  562

Query  319  LPRITSLPQFLFNIAED  269
            LPRITSLP+FL NI+E+
Sbjct  563  LPRITSLPKFLSNISEE  579



>ref|XP_010447673.1| PREDICTED: uncharacterized protein LOC104730227 [Camelina sativa]
Length=587

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 21/137 (15%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + +E  E + + L SD  Q+   A DE+SLM RVNSL  LL KDP    + +     E +
Sbjct  464  EHVEKFEIMKQQLLSDNIQF--EAPDERSLMPRVNSLFNLLYKDPNVTVSSQPNT--EIS  519

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K   E N     +VS+ N                D   S +   M RKDS GDLLL+
Sbjct  520  VGLKS--EPNDPKG-IVSDHN-------------RGIDPASSSKPQGMLRKDSFGDLLLH  563

Query  319  LPRITSLPQFLFNIAED  269
            LPRITSLP+FL NI+E+
Sbjct  564  LPRITSLPKFLSNISEE  580



>ref|NP_001173180.1| Os02g0793800 [Oryza sativa Japonica Group]
 gb|EAZ24916.1| hypothetical protein OsJ_08696 [Oryza sativa Japonica Group]
 dbj|BAH91909.1| Os02g0793800 [Oryza sativa Japonica Group]
Length=492

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 75/165 (45%), Gaps = 35/165 (21%)
 Frame = -1

Query  754  DLVSHLEQRMSEQK-TSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL+SHL+  + EQK    + +L   E  S E+LE+I + L SD+   PA SDEK +M+RV
Sbjct  361  DLLSHLDDCIVEQKPAGNNPSLPISEASSNELLEKITQQLLSDSHVAPA-SDEKRVMARV  419

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
             SL  LLQKD  P    +   F     G  GV E   +SA  +   N             
Sbjct  420  GSLLSLLQKDAVPANLPK---FEPNDSGKIGVVEVGISSALDMGIAN-------------  463

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                         +SRKDS  +LL N          LFNI+ED D
Sbjct  464  -------GTNPPGISRKDSYEELLSN----------LFNISEDFD  491



>dbj|BAD19195.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD19663.1| hypothetical protein [Oryza sativa Japonica Group]
Length=523

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 75/165 (45%), Gaps = 35/165 (21%)
 Frame = -1

Query  754  DLVSHLEQRMSEQK-TSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRV  578
            DL+SHL+  + EQK    + +L   E  S E+LE+I + L SD+   PA SDEK +M+RV
Sbjct  392  DLLSHLDDCIVEQKPAGNNPSLPISEASSNELLEKITQQLLSDSHVAPA-SDEKRVMARV  450

Query  577  NSLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddg  398
             SL  LLQKD  P    +   F     G  GV E   +SA  +   N             
Sbjct  451  GSLLSLLQKDAVPANLPK---FEPNDSGKIGVVEVGISSALDMGIAN-------------  494

Query  397  lpddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                         +SRKDS  +LL N          LFNI+ED D
Sbjct  495  -------GTNPPGISRKDSYEELLSN----------LFNISEDFD  522



>emb|CDX68693.1| BnaC01g07600D [Brassica napus]
Length=555

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 73/143 (51%), Gaps = 18/143 (13%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + LE  E + + L SD  Q+     DEKSLM RVNSL  LL KDP    A   +   E +
Sbjct  429  EHLEKFESLKQQLLSDNIQF--DTPDEKSLMPRVNSLFNLLYKDPN--VAANSQLNTETS  484

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K   E N  + +V +  N                D   S +   M RKDS  DLLL+
Sbjct  485  VGLKS--ELNDLNGTVSANNNNNNR----------VLDPASSSKPQGMLRKDSFSDLLLH  532

Query  319  LPRITSLPQFLFNIA-EDSDYHQ  254
            LPRITSLP+FL NI+ ED D ++
Sbjct  533  LPRITSLPKFLSNISEEDGDAYK  555



>ref|XP_007217228.1| hypothetical protein PRUPE_ppa005301mg [Prunus persica]
 gb|EMJ18427.1| hypothetical protein PRUPE_ppa005301mg [Prunus persica]
Length=468

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 8/70 (11%)
 Frame = -1

Query  754  DLVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            D VSH+ Q +S +       +S +E+ S ++LEEI + LF+D+Q+    SDE+ +MSRVN
Sbjct  367  DFVSHIGQCISGK-------ISGKEQPSRDVLEEITQYLFNDSQFT-LPSDEQYVMSRVN  418

Query  574  SLCCLLQKDP  545
            SL CLLQKDP
Sbjct  419  SLYCLLQKDP  428



>ref|XP_009137965.1| PREDICTED: uncharacterized protein LOC103862001 [Brassica rapa]
Length=568

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 69/136 (51%), Gaps = 17/136 (13%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + LE  E + + L SD        DEKSLM RVNSL  LL KDP    A   +   E + 
Sbjct  443  EHLEKFEILKQQLLSDNIQFDTP-DEKSLMPRVNSLFNLLYKDPS--VAANSQLNTEVSG  499

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E +  + +V +  N   NR   P           S +   M RKDS  DLLL+L
Sbjct  500  GFKS--ELHDLNGTVSANNN---NRVLDPA---------SSSKPQGMLRKDSFSDLLLHL  545

Query  316  PRITSLPQFLFNIAED  269
            PRITSLP+FL NI+E+
Sbjct  546  PRITSLPKFLSNISEE  561



>gb|EAY87838.1| hypothetical protein OsI_09259 [Oryza sativa Indica Group]
Length=492

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 75/164 (46%), Gaps = 35/164 (21%)
 Frame = -1

Query  751  LVSHLEQRMSEQK-TSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVN  575
            L+SHL+  + EQK    + +L   E  S E+LE+I + L SD+   PA SDEK +M+RV 
Sbjct  362  LLSHLDDCIVEQKPAGNNPSLPISEASSNELLEKITQQLLSDSHVAPA-SDEKRVMARVG  420

Query  574  SLCCLLQKDPPPPTAQRRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddgl  395
            SL  LLQKD  P    +   F    +G  GV E   +SA  +   N              
Sbjct  421  SLLSLLQKDAVPANLPK---FEPNDIGKIGVVEVGISSALDMGIAN--------------  463

Query  394  pddlTCSKQKASMSRKDSVGDLLLNLPRITSLPQFLFNIAEDSD  263
                        +SRKDS  +LL N          LFNI+ED D
Sbjct  464  ------GTNPPGISRKDSYEELLSN----------LFNISEDFD  491



>ref|XP_009117249.1| PREDICTED: uncharacterized protein LOC103842383 [Brassica rapa]
Length=429

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 61/131 (47%), Gaps = 30/131 (23%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             E++ + L SDTQ     SDEKS+MS+VNS   LL                E A  D   
Sbjct  325  FEDMKQLLLSDTQ--AETSDEKSVMSKVNSFYNLL----------------ETAANDGKE  366

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
               +  + S       EE              +      +SMSRKDS  DLL +LPRITS
Sbjct  367  IGLDNNNNSNKRHNKTEEG------------SIVLDHASSSMSRKDSFSDLLAHLPRITS  414

Query  301  LPQFLFNIAED  269
            LP+FLFNI+E+
Sbjct  415  LPKFLFNISEE  425



>emb|CDY34799.1| BnaA09g41660D [Brassica napus]
Length=429

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 61/131 (47%), Gaps = 30/131 (23%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             E++ + L SDTQ     SDEKS+MS+VNS   LL                E A  D   
Sbjct  325  FEDMKQLLLSDTQT--ETSDEKSVMSKVNSFYNLL----------------ETAANDGKE  366

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
               +  + S       EE              +      +SMSRKDS  DLL +LPRITS
Sbjct  367  IGLDNNNNSNKRHNKTEEG------------SIVLDHASSSMSRKDSFTDLLAHLPRITS  414

Query  301  LPQFLFNIAED  269
            LP+FLFNI+E+
Sbjct  415  LPKFLFNISEE  425



>emb|CDY39241.1| BnaA03g50530D [Brassica napus]
Length=567

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 69/136 (51%), Gaps = 17/136 (13%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + LE  E + + L SD        DEKSLM RVNSL  LL K+P    A   +   E + 
Sbjct  442  EHLEKFEILKQQLLSDNIQFDTP-DEKSLMPRVNSLFNLLYKEPN--VAANSQLNTEVSG  498

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E +  + +V +  N   NR   P           S +   M RKDS  DLLL+L
Sbjct  499  GFKS--ELHDLNGTVSANNN---NRVLDPA---------SSSKPQGMLRKDSFSDLLLHL  544

Query  316  PRITSLPQFLFNIAED  269
            PRITSLP+FL NI+E+
Sbjct  545  PRITSLPKFLSNISEE  560



>ref|NP_194807.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB52451.1| putative protein [Arabidopsis thaliana]
 emb|CAB79796.1| putative protein [Arabidopsis thaliana]
 gb|AAO42289.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63938.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85808.1| uncharacterized protein AT4G30780 [Arabidopsis thaliana]
Length=589

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 70/137 (51%), Gaps = 17/137 (12%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSD-TQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPA  500
            + +E  E + + L SD  Q+   A DEKSLM RVNSL  LL KDP    A   +   E +
Sbjct  462  EHMEKFEIMKQQLLSDNIQF--EAPDEKSLMPRVNSLFNLLYKDPN--VAANSQLNTEMS  517

Query  499  MGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLN  320
            +G K           +VS+ N   N      D         S +   M RKDS  DLLL+
Sbjct  518  VGLKS------EPKGIVSDNNNNNNNNNRVLDTA------SSSKPQGMLRKDSFSDLLLH  565

Query  319  LPRITSLPQFLFNIAED  269
            LPRITSLP+FL NI+E+
Sbjct  566  LPRITSLPKFLSNISEE  582



>emb|CDX72268.1| BnaC07g42900D [Brassica napus]
Length=566

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 73/142 (51%), Gaps = 17/142 (12%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + +E  E + + L SD        DEKSLM RVNSL  LL K+P    A   +   E ++
Sbjct  441  EDMEKFEILKQQLLSDNIQFDTP-DEKSLMPRVNSLFNLLYKEPN--VAANSQVNTEVSV  497

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E +  + +V +  N   NR   P           S +   + RKDS  DLLL+L
Sbjct  498  GFKS--ELHDLNGTVSANSN--SNRVVDPA---------SSSKPQGLLRKDSFSDLLLHL  544

Query  316  PRITSLPQFLFNIA-EDSDYHQ  254
            PRITSLP+FL NI+ ED D ++
Sbjct  545  PRITSLPKFLSNISEEDGDAYK  566



>ref|XP_009771711.1| PREDICTED: uncharacterized protein LOC104222210 isoform X4 [Nicotiana 
sylvestris]
Length=103

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = -1

Query  751  LVSHLEQRMSEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNS  572
            L+ HL     ++ +  +   S        +L E +  L  D+ ++    DEKSL +RVNS
Sbjct  17   LILHLGSNWFDKSSPINLPHSKVRHLKNSLLSEEDESLVLDSDFLVPMKDEKSLWTRVNS  76

Query  571  LCCLLQKDPPPPTAQRRENFHEPAMGDK  488
            LCCLLQKD  P T  + EN  + A+G K
Sbjct  77   LCCLLQKD--PITVNKSENCVDVAVGGK  102



>emb|CBI25264.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = -1

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            GD  +GE N  +AS  S+   +        +D   D  +C KQ  +MSRKDSVG+LL+NL
Sbjct  380  GDGSIGELNPIAASCESKTAGD----FPTPNDETNDVSSC-KQPPAMSRKDSVGELLVNL  434

Query  316  PRITSLPQFLFNI  278
            PRI SLPQFLFN+
Sbjct  435  PRIASLPQFLFNM  447



>ref|XP_010655143.1| PREDICTED: uncharacterized protein LOC100262159 isoform X4 [Vitis 
vinifera]
Length=467

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -1

Query  526  RRENFHEPAMGDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRK  347
            + EN  + A GD  +GE N  +AS  S+   +        +D   D  +C KQ  +MSRK
Sbjct  391  KSENGTDTA-GDGSIGELNPIAASCESKTAGD----FPTPNDETNDVSSC-KQPPAMSRK  444

Query  346  DSVGDLLLNLPRITSLPQFLFNI  278
            DSVG+LL+NLPRI SLPQFLFN+
Sbjct  445  DSVGELLVNLPRIASLPQFLFNM  467



>ref|XP_009771710.1| PREDICTED: uncharacterized protein LOC104222210 isoform X3 [Nicotiana 
sylvestris]
Length=115

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 13/88 (15%)
 Frame = -1

Query  748  VSHLEQRM-SEQKTSKDFNLSSEERQSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNS  572
            V HL+  + S    +   N+  EE +SL +          D+ ++    DEKSL +RVNS
Sbjct  39   VRHLKNSLLSGHYENSLINIGIEEDESLVL----------DSDFLVPMKDEKSLWTRVNS  88

Query  571  LCCLLQKDPPPPTAQRRENFHEPAMGDK  488
            LCCLLQKD  P T  + EN  + A+G K
Sbjct  89   LCCLLQKD--PITVNKSENCVDVAVGGK  114



>ref|XP_003610268.1| hypothetical protein MTR_4g130350 [Medicago truncatula]
 gb|AES92465.1| hypothetical protein MTR_4g130350 [Medicago truncatula]
Length=77

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  367  KASMSRKDSVGDLLLNLPRITSLPQFLFNIAED  269
            ++ M RKDS GDLL NLPRI SLP+FLFN+++D
Sbjct  45   ESGMFRKDSFGDLLFNLPRIASLPKFLFNMSQD  77



>emb|CDX76839.1| BnaC08g34250D [Brassica napus]
Length=428

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 59/131 (45%), Gaps = 31/131 (24%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             E++ + L SD Q     SDEK +MS+VNS   LLQ                        
Sbjct  325  FEDMKQLLLSDAQ--AETSDEKCVMSKVNSFYNLLQ------------------------  358

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRITS  302
                  +A+   E   + N      +      +      +SMSRKDS  DLL +LPRITS
Sbjct  359  -----TAANDGKEIGLDNNNNNKRYNKTEEGGIVLDHASSSMSRKDSFSDLLAHLPRITS  413

Query  301  LPQFLFNIAED  269
            LP+FLFNI+E+
Sbjct  414  LPKFLFNISEE  424



>gb|EEE69217.1| hypothetical protein OsJ_28438 [Oryza sativa Japonica Group]
Length=526

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 63/126 (50%), Gaps = 26/126 (21%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             +E+ R L +D+Q   AA DE+ LMSRVNSLC L+Q+D                    G 
Sbjct  426  FDELTRQLLNDSQITNAA-DERMLMSRVNSLCSLIQRD-------------------SGS  465

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMS-RKDSVGDLLLNLPRIT  305
            G+ N  S+S+  +   +E +P         D    S    S+  R++S GDLL +LPRI+
Sbjct  466  GQTN-PSSSIHGDNEMQERKPQPYALPVSAD----SGSNTSLPPRQESFGDLLTHLPRIS  520

Query  304  SLPQFL  287
            S P FL
Sbjct  521  SFPHFL  526



>gb|EEC84117.1| hypothetical protein OsI_30449 [Oryza sativa Indica Group]
Length=526

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 63/126 (50%), Gaps = 26/126 (21%)
 Frame = -1

Query  661  LEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKGV  482
             +E+ R L +D+Q   AA DE+ LMSRVNSLC L+Q+D                    G 
Sbjct  426  FDELTRQLLNDSQITNAA-DERMLMSRVNSLCSLIQRD-------------------SGS  465

Query  481  GEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMS-RKDSVGDLLLNLPRIT  305
            G+ N  S+S+  +   +E +P         D    S    S+  R++S GDLL +LPRI+
Sbjct  466  GQTN-PSSSIHGDNEMQERKPQPYALPVSAD----SGSNTSLPPRQESFGDLLTHLPRIS  520

Query  304  SLPQFL  287
            S P FL
Sbjct  521  SFPHFL  526



>emb|CDY23256.1| BnaA08g12900D [Brassica napus]
Length=539

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 69/141 (49%), Gaps = 17/141 (12%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + +E    + + L SD     A  DEKSLM RV+SL  LL KD     A   +   E ++
Sbjct  413  EHMENFNGMKQQLLSDNIQFDAPQDEKSLMPRVDSLFNLLYKDLN--GAANSQLNTEVSV  470

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E +     V    N   NR   P           S +   M RKDS  DLLL+L
Sbjct  471  GLKS--ELSDLKGIVPDNNN---NRVLDPA---------SSSRPQGMLRKDSFSDLLLHL  516

Query  316  PRITSLPQFLFNIA-EDSDYH  257
            PRITSLP+FL NI+ EDSD +
Sbjct  517  PRITSLPKFLSNISEEDSDAY  537



>gb|ABR16502.1| unknown [Picea sitchensis]
Length=592

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 67/132 (51%), Gaps = 1/132 (1%)
 Frame = -1

Query  664  MLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAMGDKG  485
            +L+EI + L  D+  +    DE+++++RVNS+  LLQKD      +  E+     +    
Sbjct  448  ILDEIAQHLLGDS-ILSTTFDEQAILARVNSMYSLLQKDVSKSPGKVEESETGYDLAKNS  506

Query  484  VGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNLPRIT  305
             GE +     + +E +    +        + +    SKQ     RK+S GDLLL+LPRI 
Sbjct  507  QGEDDELGDVINNESSAFSRKCDLVPFQLVENSAMDSKQSTISPRKESSGDLLLHLPRIA  566

Query  304  SLPQFLFNIAED  269
            SLPQF  + +++
Sbjct  567  SLPQFFIHASDE  578



>ref|XP_009108969.1| PREDICTED: uncharacterized protein LOC103834656 [Brassica rapa]
Length=559

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 69/141 (49%), Gaps = 17/141 (12%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + +E    + + L S+     A  DEKSLM RV+SL  LL KD     A   +   E ++
Sbjct  433  EHMENFNGMKQQLLSNNIQFDAPQDEKSLMPRVDSLFNLLYKDLN--GAANSQLNTEVSV  490

Query  496  GDKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSVGDLLLNL  317
            G K   E +     V    N   NR   P           S +   M RKDS  DLLL+L
Sbjct  491  GLKS--ELSDLKGIVPDNNN---NRVLDPAS---------SSRPQGMLRKDSFSDLLLHL  536

Query  316  PRITSLPQFLFNIA-EDSDYH  257
            PRITSLP+FL NI+ EDSD +
Sbjct  537  PRITSLPKFLSNISEEDSDAY  557



>gb|KFK29655.1| hypothetical protein AALP_AA7G161600 [Arabis alpina]
Length=584

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 69/143 (48%), Gaps = 25/143 (17%)
 Frame = -1

Query  676  QSLEMLEEINRCLFSDTQYMPAASDEKSLMSRVNSLCCLLQKDPPPPTAQRRENFHEPAM  497
            + +E  E + + L SD  +     DEKSLM RV+SL  LL K+P    A  + N  E ++
Sbjct  458  EHMEKFELLKQQLLSDN-FQFDTPDEKSLMPRVDSLFNLLYKEPNV-VANSQVN-TEISV  514

Query  496  G-------DKGVGEFNFASASVVSERNYEENRpptpdddglpddlTCSKQKASMSRKDSV  338
            G        KG+   N    +  + R  +                  S +   M RKDS 
Sbjct  515  GLKSEPNEPKGIVSDNNNYNNNSNSRVLDP---------------ASSSKPQGMLRKDSF  559

Query  337  GDLLLNLPRITSLPQFLFNIAED  269
             DLLL+LPRITSLP+FL NI+E+
Sbjct  560  SDLLLHLPRITSLPKFLSNISEE  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680