BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036C03

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007201160.1|  hypothetical protein PRUPE_ppa004290mg             386   2e-128   
ref|XP_010646993.1|  PREDICTED: probable endo-1,4-beta-xylanase C       383   8e-127   Vitis vinifera
ref|XP_007041881.1|  Glycosyl hydrolase family 10 protein isoform 2     377   1e-126   
ref|XP_010090320.1|  Endo-1,4-beta-xylanase A                           382   2e-126   
emb|CBI37893.3|  unnamed protein product                                383   8e-126   Vitis vinifera
ref|XP_008235994.1|  PREDICTED: probable endo-1,4-beta-xylanase C       380   9e-126   Prunus mume [ume]
ref|XP_008349367.1|  PREDICTED: probable endo-1,4-beta-xylanase C       379   1e-125   
ref|XP_011457934.1|  PREDICTED: uncharacterized protein LOC101305...    379   2e-125   Fragaria vesca subsp. vesca
gb|KDP29627.1|  hypothetical protein JCGZ_18789                         375   2e-125   Jatropha curcas
ref|XP_009340235.1|  PREDICTED: probable endo-1,4-beta-xylanase C       379   3e-125   Pyrus x bretschneideri [bai li]
ref|XP_011457932.1|  PREDICTED: uncharacterized protein LOC101305...    377   1e-124   Fragaria vesca subsp. vesca
ref|XP_007041880.1|  Glycosyl hydrolase family 10 protein isoform 1     377   1e-124   
ref|XP_004500734.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    376   2e-124   Cicer arietinum [garbanzo]
ref|XP_009349686.1|  PREDICTED: probable endo-1,4-beta-xylanase C       376   2e-124   
ref|XP_008372900.1|  PREDICTED: probable endo-1,4-beta-xylanase C       375   9e-124   
ref|XP_006577900.1|  PREDICTED: uncharacterized protein LOC100793558    374   4e-123   Glycine max [soybeans]
emb|CDO96932.1|  unnamed protein product                                374   4e-123   Coffea canephora [robusta coffee]
ref|XP_011092889.1|  PREDICTED: endo-1,4-beta-xylanase 1 isoform X2     371   2e-122   
ref|XP_002534153.1|  Endo-1,4-beta-xylanase A precursor, putative       368   4e-122   
ref|XP_011092888.1|  PREDICTED: uncharacterized protein LOC105172...    370   5e-122   Sesamum indicum [beniseed]
gb|KHN20002.1|  Endo-1,4-beta-xylanase A                                370   6e-122   Glycine soja [wild soybean]
ref|XP_006581102.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    369   2e-121   Glycine max [soybeans]
gb|KHG02946.1|  Endo-1,4-beta-xylanase A                                367   6e-121   Gossypium arboreum [tree cotton]
ref|XP_008457673.1|  PREDICTED: uncharacterized protein LOC103497316    368   7e-121   Cucumis melo [Oriental melon]
gb|KDO68006.1|  hypothetical protein CISIN_1g035723mg                   367   9e-121   Citrus sinensis [apfelsine]
ref|XP_006486857.1|  PREDICTED: uncharacterized protein LOC102613106    367   1e-120   
ref|XP_006422632.1|  hypothetical protein CICLE_v10028121mg             367   1e-120   
gb|KEH36385.1|  glycosyl hydrolase family 10 protein                    363   1e-120   Medicago truncatula
ref|XP_010246857.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    361   2e-120   Nelumbo nucifera [Indian lotus]
gb|KEH36384.1|  glycosyl hydrolase family 10 protein                    364   2e-120   Medicago truncatula
ref|XP_011001986.1|  PREDICTED: endo-1,4-beta-xylanase F1-like is...    362   4e-120   Populus euphratica
ref|XP_004169878.1|  PREDICTED: endo-1,4-beta-xylanase C-like           365   5e-120   
ref|XP_010066270.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    359   6e-120   
ref|XP_004147070.1|  PREDICTED: endo-1,4-beta-xylanase C-like           365   6e-120   
ref|XP_011001985.1|  PREDICTED: endo-1,4-beta-xylanase F1-like is...    362   6e-120   Populus euphratica
ref|XP_006359674.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    363   6e-120   
ref|XP_002306176.2|  hypothetical protein POPTR_0004s17900g             365   7e-120   
gb|KGN61918.1|  hypothetical protein Csa_2G264620                       365   1e-119   Cucumis sativus [cucumbers]
gb|AES74285.2|  glycosyl hydrolase family 10 protein                    363   2e-119   Medicago truncatula
ref|XP_003604034.1|  Endo-1,4-beta-xylanase A                           363   2e-119   
ref|XP_007137357.1|  hypothetical protein PHAVU_009G120500g             364   2e-119   Phaseolus vulgaris [French bean]
ref|XP_011013611.1|  PREDICTED: endo-1,4-beta-xylanase A-like           363   3e-119   Populus euphratica
ref|XP_011001984.1|  PREDICTED: endo-1,4-beta-xylanase A-like iso...    363   8e-119   Populus euphratica
ref|XP_011001983.1|  PREDICTED: endo-1,4-beta-xylanase A-like iso...    362   1e-118   Populus euphratica
ref|XP_010315368.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    360   1e-118   
ref|XP_010315367.1|  PREDICTED: endo-1,4-beta-xylanase UM03411 is...    360   3e-118   
ref|XP_004231450.1|  PREDICTED: endo-1,4-beta-xylanase UM03411 is...    360   4e-118   
gb|EYU40424.1|  hypothetical protein MIMGU_mgv1a020606mg                359   4e-118   Erythranthe guttata [common monkey flower]
ref|XP_010066269.1|  PREDICTED: uncharacterized protein LOC104453...    360   7e-118   Eucalyptus grandis [rose gum]
ref|XP_010690393.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    356   1e-117   
ref|XP_010246856.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    359   1e-117   Nelumbo nucifera [Indian lotus]
ref|XP_011088588.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    356   5e-117   Sesamum indicum [beniseed]
gb|KDO68005.1|  hypothetical protein CISIN_1g036715mg                   350   1e-116   Citrus sinensis [apfelsine]
ref|XP_010690392.1|  PREDICTED: endo-1,4-beta-xylanase 5 isoform X1     356   2e-116   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO96931.1|  unnamed protein product                                358   5e-116   Coffea canephora [robusta coffee]
ref|XP_011088587.1|  PREDICTED: uncharacterized protein LOC105169...    354   1e-115   Sesamum indicum [beniseed]
ref|XP_011088586.1|  PREDICTED: uncharacterized protein LOC105169...    354   1e-115   
ref|XP_010920164.1|  PREDICTED: uncharacterized protein LOC105044067    354   2e-115   Elaeis guineensis
ref|NP_001049529.1|  Os03g0243700                                       345   4e-114   
ref|XP_008788407.1|  PREDICTED: endo-1,4-beta-xylanase A-like           349   1e-113   Phoenix dactylifera
gb|ABF94922.1|  Glycosyl hydrolase family 10 protein, expressed         345   3e-113   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA44350.1|  TPA: putative glycosyl hydrolase family 10 protein     345   4e-113   
ref|XP_009761415.1|  PREDICTED: uncharacterized protein LOC104213...    346   7e-113   Nicotiana sylvestris
ref|XP_009761414.1|  PREDICTED: uncharacterized protein LOC104213...    346   1e-112   Nicotiana sylvestris
ref|XP_010934099.1|  PREDICTED: endo-1,4-beta-xylanase-like             347   1e-112   
ref|XP_009761411.1|  PREDICTED: uncharacterized protein LOC104213...    345   4e-112   Nicotiana sylvestris
ref|XP_004985034.1|  PREDICTED: uncharacterized protein LOC101776078    345   9e-112   Setaria italica
gb|ABF94921.1|  Glycosyl hydrolase family 10 protein, expressed         344   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468186.1|  hypothetical protein SORBIDRAFT_01g041310          344   1e-111   Sorghum bicolor [broomcorn]
gb|ABF94920.1|  Glycosyl hydrolase family 10 protein, expressed         344   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140909.1|  uncharacterized protein LOC100272986 precursor     343   2e-111   Zea mays [maize]
ref|XP_009628229.1|  PREDICTED: uncharacterized protein LOC104118...    341   7e-111   Nicotiana tomentosiformis
ref|XP_009628227.1|  PREDICTED: uncharacterized protein LOC104118...    340   2e-110   
ref|XP_009628228.1|  PREDICTED: uncharacterized protein LOC104118...    340   2e-110   Nicotiana tomentosiformis
ref|XP_010313055.1|  PREDICTED: endo-1,4-beta-xylanase C isoform X2     334   3e-110   Solanum lycopersicum
ref|XP_009628223.1|  PREDICTED: uncharacterized protein LOC104118...    340   3e-110   Nicotiana tomentosiformis
gb|EEC74851.1|  hypothetical protein OsI_10717                          344   1e-109   Oryza sativa Indica Group [Indian rice]
gb|EPS72309.1|  hypothetical protein M569_02449                         338   2e-109   Genlisea aurea
ref|XP_006649724.1|  PREDICTED: uncharacterized protein LOC102701898    338   2e-109   Oryza brachyantha
ref|XP_008781049.1|  PREDICTED: endo-1,4-beta-xylanase-like             337   7e-109   
gb|EMS68876.1|  Endo-1,4-beta-xylanase Z                                335   1e-108   Triticum urartu
gb|EMT22806.1|  Endo-1,4-beta-xylanase Z                                336   1e-108   
ref|XP_003558355.1|  PREDICTED: uncharacterized protein LOC100841372    336   2e-108   Brachypodium distachyon [annual false brome]
ref|XP_009400614.1|  PREDICTED: uncharacterized protein LOC103984779    336   3e-108   
ref|XP_004250707.1|  PREDICTED: uncharacterized protein LOC101263...    335   4e-108   Solanum lycopersicum
ref|XP_006343478.1|  PREDICTED: uncharacterized protein LOC102583591    334   6e-108   
emb|CAB37521.1|  putative protein                                       324   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866813.1|  glycosyl hydrolase family 10 protein               324   8e-104   
gb|KJB12083.1|  hypothetical protein B456_002G1956002                   311   2e-103   Gossypium raimondii
ref|NP_195577.2|  glycosyl hydrolase family 10 protein                  323   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006851910.1|  hypothetical protein AMTR_s00041p00160040          320   1e-102   
ref|XP_010531544.1|  PREDICTED: uncharacterized protein LOC104807819    321   1e-102   Tarenaya hassleriana [spider flower]
emb|CDY12095.1|  BnaC03g60110D                                          318   2e-102   Brassica napus [oilseed rape]
ref|XP_010446374.1|  PREDICTED: uncharacterized protein LOC104729170    320   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006411655.1|  hypothetical protein EUTSA_v10024805mg             320   4e-102   Eutrema salsugineum [saltwater cress]
ref|XP_009622124.1|  PREDICTED: LOW QUALITY PROTEIN: probable end...    313   1e-101   Nicotiana tomentosiformis
ref|XP_004969072.1|  PREDICTED: uncharacterized protein LOC101763135    318   1e-101   Setaria italica
ref|XP_010436964.1|  PREDICTED: uncharacterized protein LOC104720...    316   2e-101   
ref|XP_002446197.1|  hypothetical protein SORBIDRAFT_06g003350          317   6e-101   Sorghum bicolor [broomcorn]
ref|XP_006283442.1|  hypothetical protein CARUB_v10004489mg             311   6e-101   
ref|XP_010436963.1|  PREDICTED: uncharacterized protein LOC104720...    316   8e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009615209.1|  PREDICTED: endo-1,4-beta-xylanase A-like           316   1e-100   Nicotiana tomentosiformis
ref|XP_006422633.1|  hypothetical protein CICLE_v10030219mg             313   2e-100   
ref|XP_010431807.1|  PREDICTED: uncharacterized protein LOC104716145    315   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009799022.1|  PREDICTED: endo-1,4-beta-xylanase A-like           313   1e-99    Nicotiana sylvestris
emb|CDX90288.1|  BnaA08g16960D                                          313   2e-99    
ref|XP_006283441.1|  hypothetical protein CARUB_v10004489mg             312   3e-99    Capsella rubella
ref|XP_009109536.1|  PREDICTED: uncharacterized protein LOC103835171    312   4e-99    Brassica rapa
ref|XP_006652135.1|  PREDICTED: uncharacterized protein LOC102708887    312   4e-99    Oryza brachyantha
ref|NP_001055145.1|  Os05g0304900                                       308   1e-98    
ref|XP_003581580.1|  PREDICTED: uncharacterized protein LOC100828464    311   1e-98    Brachypodium distachyon [annual false brome]
ref|XP_006367794.1|  PREDICTED: uncharacterized protein LOC102602944    309   3e-98    
gb|EEC78941.1|  hypothetical protein OsI_19385                          308   3e-98    Oryza sativa Indica Group [Indian rice]
gb|EMT25110.1|  Endo-1,4-beta-xylanase Z                                308   8e-98    
gb|EEE63172.1|  hypothetical protein OsJ_17981                          307   8e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EMS66498.1|  Endo-1,4-beta-xylanase Z                                308   1e-97    Triticum urartu
ref|XP_008661494.1|  PREDICTED: uncharacterized protein LOC100216...    307   5e-97    
ref|NP_001152556.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    306   1e-96    
ref|XP_010327543.1|  PREDICTED: endo-1,4-beta-xylanase A-like           303   1e-96    
ref|XP_002989316.1|  hypothetical protein SELMODRAFT_129690             251   1e-75    
ref|XP_002980942.1|  hypothetical protein SELMODRAFT_420481             233   2e-68    
ref|NP_001173304.1|  Os03g0201901                                       208   8e-61    
ref|XP_004985301.1|  PREDICTED: uncharacterized protein LOC101779072    212   1e-60    Setaria italica
ref|XP_007042651.1|  Glycosyl hydrolase family 10 protein, putative     211   4e-60    
ref|XP_007042652.1|  Glycosyl hydrolase family 10 protein               210   6e-60    
gb|EEC74705.1|  hypothetical protein OsI_10421                          209   1e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_002465685.1|  hypothetical protein SORBIDRAFT_01g043720          209   1e-59    Sorghum bicolor [broomcorn]
gb|ABF94510.1|  1,4-beta-xylanase, putative, expressed                  209   1e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651142.1|  PREDICTED: uncharacterized protein LOC102719572    209   2e-59    
ref|XP_006487065.1|  PREDICTED: uncharacterized protein LOC102624921    209   2e-59    
ref|NP_001169055.1|  putative glycosyl hydrolase family 10 protei...    208   3e-59    Zea mays [maize]
ref|XP_008652268.1|  PREDICTED: uncharacterized protein LOC103632224    208   4e-59    Zea mays [maize]
ref|XP_009783073.1|  PREDICTED: uncharacterized protein LOC104231720    206   2e-58    Nicotiana sylvestris
gb|KCW55100.1|  hypothetical protein EUGRSUZ_I01059                     205   2e-58    Eucalyptus grandis [rose gum]
gb|EMT33548.1|  Endo-1,4-beta-xylanase A                                205   2e-58    
ref|XP_010030622.1|  PREDICTED: endo-1,4-beta-xylanase-like             205   3e-58    Eucalyptus grandis [rose gum]
ref|XP_006422817.1|  hypothetical protein CICLE_v10030382mg             205   6e-58    Citrus clementina [clementine]
ref|XP_003561934.2|  PREDICTED: uncharacterized protein LOC100835383    204   6e-58    Brachypodium distachyon [annual false brome]
gb|EMS46048.1|  Endo-1,4-beta-xylanase C                                205   8e-58    Triticum urartu
gb|EEE58525.1|  hypothetical protein OsJ_09814                          208   9e-58    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94973.1|  predicted protein                                      204   1e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009406783.1|  PREDICTED: endo-1,4-beta-xylanase C-like           202   2e-57    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG02913.1|  endo-1,4-beta-xylanase c                                202   3e-57    Gossypium arboreum [tree cotton]
ref|NP_001173303.1|  Os03g0201400                                       197   3e-57    
gb|KCW55101.1|  hypothetical protein EUGRSUZ_I01060                     201   7e-57    Eucalyptus grandis [rose gum]
ref|XP_008787230.1|  PREDICTED: endo-1,4-beta-xylanase D-like           201   1e-56    Phoenix dactylifera
ref|XP_006841091.1|  hypothetical protein AMTR_s00086p00056140          199   1e-56    
gb|AAN10199.1|  endoxylanase                                            201   1e-56    Carica papaya [mamon]
ref|XP_009406772.1|  PREDICTED: endo-1,4-beta-xylanase C-like           201   1e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010315176.1|  PREDICTED: endo-1,4-beta-xylanase C-like           194   1e-56    Solanum lycopersicum
gb|KJB47306.1|  hypothetical protein B456_008G020100                    201   2e-56    Gossypium raimondii
ref|XP_004983257.1|  PREDICTED: uncharacterized protein LOC101782274    201   2e-56    Setaria italica
ref|XP_009406807.1|  PREDICTED: endo-1,4-beta-xylanase A-like           200   2e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985305.1|  PREDICTED: uncharacterized protein LOC101780535    199   7e-56    
ref|XP_003621871.1|  Endo-1,4-beta-xylanase C                           199   9e-56    Medicago truncatula
gb|KFK30012.1|  hypothetical protein AALP_AA7G206300                    192   1e-55    Arabis alpina [alpine rockcress]
ref|XP_010030623.1|  PREDICTED: uncharacterized protein LOC104420481    200   1e-55    Eucalyptus grandis [rose gum]
emb|CAN61986.1|  hypothetical protein VITISV_034670                     193   1e-55    Vitis vinifera
ref|XP_002461545.1|  hypothetical protein SORBIDRAFT_02g004490          198   2e-55    
ref|XP_008648082.1|  PREDICTED: xylanase1 isoform X1                    197   2e-55    
tpg|DAA46846.1|  TPA: xylanase1                                         198   3e-55    
dbj|BAK07928.1|  predicted protein                                      197   3e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABF94504.1|  Glycosyl hydrolase family 10 protein, expressed         197   3e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010274469.1|  PREDICTED: endo-1,4-beta-xylanase D-like           197   3e-55    Nelumbo nucifera [Indian lotus]
dbj|BAK07199.1|  predicted protein                                      197   4e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY49378.1|  BnaA03g50670D                                          197   5e-55    Brassica napus [oilseed rape]
gb|KEH27913.1|  glycosyl hydrolase family 10 protein                    196   6e-55    Medicago truncatula
ref|XP_010691571.1|  PREDICTED: endo-1,4-beta-xylanase-like             196   9e-55    
ref|XP_006346513.1|  PREDICTED: uncharacterized protein LOC102598712    200   2e-54    
ref|XP_010315494.1|  PREDICTED: uncharacterized protein LOC101254648    196   2e-54    
ref|XP_006285354.1|  hypothetical protein CARUB_v10006745mg             194   2e-54    
gb|KFK30013.1|  hypothetical protein AALP_AA7G206400                    195   2e-54    Arabis alpina [alpine rockcress]
gb|KEH30535.1|  glycosyl hydrolase family 10 protein                    195   2e-54    Medicago truncatula
ref|XP_006651140.1|  PREDICTED: uncharacterized protein LOC102718726    195   2e-54    
ref|XP_006412307.1|  hypothetical protein EUTSA_v10027468mg             195   3e-54    
gb|ACL53900.1|  unknown                                                 192   3e-54    Zea mays [maize]
ref|XP_002532418.1|  Endo-1,4-beta-xylanase C precursor, putative       194   3e-54    Ricinus communis
ref|XP_010647914.1|  PREDICTED: uncharacterized protein LOC100248080    194   3e-54    Vitis vinifera
gb|EMT18410.1|  Endo-1,4-beta-xylanase C                                196   3e-54    
ref|XP_002867151.1|  glycosyl hydrolase family 10 protein               194   4e-54    Arabidopsis lyrata subsp. lyrata
ref|XP_010274480.1|  PREDICTED: endo-1,4-beta-xylanase D-like           194   4e-54    Nelumbo nucifera [Indian lotus]
ref|XP_009138241.1|  PREDICTED: uncharacterized protein LOC103862299    194   4e-54    Brassica rapa
ref|XP_010315175.1|  PREDICTED: endo-1,4-beta-xylanase C-like           191   4e-54    
emb|CDY28323.1|  BnaC03g66360D                                          194   5e-54    Brassica napus [oilseed rape]
gb|KJB32238.1|  hypothetical protein B456_005G231200                    193   1e-53    Gossypium raimondii
ref|XP_002532417.1|  Endo-1,4-beta-xylanase precursor, putative         187   1e-53    
ref|XP_010447186.1|  PREDICTED: uncharacterized protein LOC104729864    193   1e-53    Camelina sativa [gold-of-pleasure]
ref|XP_009758358.1|  PREDICTED: uncharacterized protein LOC104211061    193   1e-53    Nicotiana sylvestris
ref|XP_010436270.1|  PREDICTED: uncharacterized protein LOC104719990    193   1e-53    Camelina sativa [gold-of-pleasure]
ref|XP_002468320.1|  hypothetical protein SORBIDRAFT_01g043760          193   1e-53    
ref|XP_010530701.1|  PREDICTED: uncharacterized protein LOC104807213    192   2e-53    Tarenaya hassleriana [spider flower]
ref|XP_002465686.1|  hypothetical protein SORBIDRAFT_01g043730          192   2e-53    Sorghum bicolor [broomcorn]
gb|EMS62252.1|  Endo-1,4-beta-xylanase C                                194   2e-53    Triticum urartu
emb|CDY28324.1|  BnaC03g66350D                                          192   2e-53    Brassica napus [oilseed rape]
ref|XP_006651141.1|  PREDICTED: uncharacterized protein LOC102719284    192   2e-53    Oryza brachyantha
emb|CDY48434.1|  BnaA08g11430D                                          192   2e-53    Brassica napus [oilseed rape]
gb|EMS55293.1|  Endo-1,4-beta-xylanase C                                192   3e-53    Triticum urartu
ref|XP_008658023.1|  PREDICTED: putative glycosyl hydrolase famil...    192   3e-53    Zea mays [maize]
ref|XP_010111686.1|  Endo-1,4-beta-xylanase C                           192   3e-53    
gb|KHN39897.1|  Endo-1,4-beta-xylanase C                                189   4e-53    Glycine soja [wild soybean]
gb|AAO15029.1|  anther endoxylanase                                     186   4e-53    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010431685.1|  PREDICTED: uncharacterized protein LOC104716033    192   4e-53    Camelina sativa [gold-of-pleasure]
dbj|BAK06950.1|  predicted protein                                      192   4e-53    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008658022.1|  PREDICTED: putative glycosyl hydrolase famil...    192   4e-53    
ref|XP_010437711.1|  PREDICTED: uncharacterized protein LOC104721431    191   5e-53    
emb|CDY69164.1|  BnaAnng29520D                                          191   5e-53    Brassica napus [oilseed rape]
ref|XP_006661710.1|  PREDICTED: uncharacterized protein LOC102721021    191   6e-53    
ref|NP_001130600.1|  putative glycosyl hydrolase family 10 protein      191   7e-53    
ref|XP_009596823.1|  PREDICTED: uncharacterized protein LOC104092845    191   7e-53    
emb|CDY28325.1|  BnaC03g66340D                                          191   7e-53    Brassica napus [oilseed rape]
ref|XP_009406796.1|  PREDICTED: uncharacterized protein LOC103989620    191   7e-53    
gb|KFK40660.1|  hypothetical protein AALP_AA2G025200                    188   7e-53    Arabis alpina [alpine rockcress]
gb|EMT18889.1|  Endo-1,4-beta-xylanase C                                191   8e-53    
gb|AFW89320.1|  putative glycosyl hydrolase family 10 protein           191   9e-53    
ref|XP_003571749.1|  PREDICTED: uncharacterized protein LOC100833088    191   1e-52    Brachypodium distachyon [annual false brome]
gb|EAY88933.1|  hypothetical protein OsI_10417                          190   1e-52    Oryza sativa Indica Group [Indian rice]
emb|CBI22450.3|  unnamed protein product                                194   1e-52    Vitis vinifera
emb|CDY48433.1|  BnaA08g11420D                                          190   1e-52    Brassica napus [oilseed rape]
emb|CDO97285.1|  unnamed protein product                                189   2e-52    Coffea canephora [robusta coffee]
ref|XP_009108857.1|  PREDICTED: uncharacterized protein LOC103834542    190   2e-52    
ref|XP_002867152.1|  glycosyl hydrolase family 10 protein               189   2e-52    
gb|KFK30011.1|  hypothetical protein AALP_AA7G206200                    187   3e-52    Arabis alpina [alpine rockcress]
gb|KCW55102.1|  hypothetical protein EUGRSUZ_I01061                     188   3e-52    Eucalyptus grandis [rose gum]
gb|AHH32689.1|  xylanase 3                                              187   3e-52    Phoenix dactylifera
ref|XP_009108771.1|  PREDICTED: uncharacterized protein LOC103834457    189   3e-52    Brassica rapa
ref|XP_010436271.1|  PREDICTED: uncharacterized protein LOC104719991    189   4e-52    Camelina sativa [gold-of-pleasure]
ref|XP_011459682.1|  PREDICTED: endo-1,4-beta-xylanase 2-like           189   4e-52    Fragaria vesca subsp. vesca
ref|NP_001241765.1|  1,4-beta-xylanase precursor                        189   4e-52    
ref|XP_006590847.1|  PREDICTED: LOW QUALITY PROTEIN: endo-1,4-bet...    189   5e-52    
ref|XP_010451108.1|  PREDICTED: uncharacterized protein LOC104733204    189   6e-52    
ref|XP_010437712.1|  PREDICTED: uncharacterized protein LOC104721432    188   6e-52    Camelina sativa [gold-of-pleasure]
ref|XP_007131684.1|  hypothetical protein PHAVU_011G033100g             188   7e-52    Phaseolus vulgaris [French bean]
ref|XP_010230224.1|  PREDICTED: uncharacterized protein LOC100827817    188   7e-52    
gb|ABF94509.1|  Glycosyl hydrolase family 10 protein, expressed         188   8e-52    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74704.1|  hypothetical protein OsI_10420                          188   8e-52    Oryza sativa Indica Group [Indian rice]
gb|ABF94508.1|  Glycosyl hydrolase family 10 protein, expressed         187   9e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009778566.1|  PREDICTED: probable endo-1,4-beta-xylanase C       188   9e-52    Nicotiana sylvestris
ref|XP_002867153.1|  glycosyl hydrolase family 10 protein               188   1e-51    
ref|XP_008236353.1|  PREDICTED: uncharacterized protein LOC103335128    187   1e-51    Prunus mume [ume]
ref|XP_009108772.1|  PREDICTED: uncharacterized protein LOC103834458    187   1e-51    Brassica rapa
ref|XP_006351853.1|  PREDICTED: uncharacterized protein LOC102605766    187   1e-51    
ref|NP_001049300.1|  Os03g0201800                                       187   1e-51    
ref|XP_006285227.1|  hypothetical protein CARUB_v10006586mg             187   1e-51    
ref|XP_009613540.1|  PREDICTED: uncharacterized protein LOC104106...    187   1e-51    Nicotiana tomentosiformis
ref|XP_010228324.1|  PREDICTED: uncharacterized protein LOC100828321    187   2e-51    Brachypodium distachyon [annual false brome]
emb|CDX72434.1|  BnaC07g44560D                                          190   2e-51    
ref|XP_010030624.1|  PREDICTED: uncharacterized protein LOC104420483    187   2e-51    Eucalyptus grandis [rose gum]
ref|NP_195110.3|  Glycosyl hydrolase family 10 protein                  187   2e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613527.1|  PREDICTED: uncharacterized protein LOC104106...    187   2e-51    Nicotiana tomentosiformis
dbj|BAK06212.1|  predicted protein                                      187   2e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI22449.3|  unnamed protein product                                186   2e-51    Vitis vinifera
ref|XP_009375672.1|  PREDICTED: endo-1,4-beta-xylanase 2-like           187   3e-51    Pyrus x bretschneideri [bai li]
ref|XP_010647973.1|  PREDICTED: uncharacterized protein LOC100265242    186   3e-51    
ref|XP_010451062.1|  PREDICTED: uncharacterized protein LOC104733153    186   3e-51    Camelina sativa [gold-of-pleasure]
gb|EYU39076.1|  hypothetical protein MIMGU_mgv1a0048871mg               180   4e-51    Erythranthe guttata [common monkey flower]
ref|XP_011457855.1|  PREDICTED: uncharacterized protein LOC101310958    187   4e-51    Fragaria vesca subsp. vesca
emb|CAA19865.1|  putative protein                                       186   4e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774985.1|  PREDICTED: uncharacterized protein LOC104224...    186   5e-51    Nicotiana sylvestris
ref|XP_010447185.1|  PREDICTED: uncharacterized protein LOC104729863    186   6e-51    Camelina sativa [gold-of-pleasure]
emb|CAA19866.1|  putative protein                                       187   6e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406758.1|  PREDICTED: uncharacterized protein LOC103989595    186   6e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004986647.1|  PREDICTED: uncharacterized protein LOC101754606    186   7e-51    Setaria italica
ref|XP_009774984.1|  PREDICTED: uncharacterized protein LOC104224...    186   7e-51    Nicotiana sylvestris
gb|KDO57900.1|  hypothetical protein CISIN_1g042396mg                   184   7e-51    Citrus sinensis [apfelsine]
ref|XP_006379283.1|  hypothetical protein POPTR_0009s13520g             181   7e-51    
ref|NP_195109.2|  Glycosyl hydrolase family 10 protein                  185   9e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375682.1|  PREDICTED: uncharacterized protein LOC103964474    185   9e-51    Pyrus x bretschneideri [bai li]
ref|NP_195112.2|  glycosyl hydrolase family 10 protein                  185   1e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345163.1|  PREDICTED: uncharacterized protein LOC103408077    186   1e-50    
emb|CAA19868.1|  putative protein                                       185   1e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432505.1|  PREDICTED: uncharacterized protein LOC104716768    185   1e-50    Camelina sativa [gold-of-pleasure]
gb|KHN39896.1|  Endo-1,4-beta-xylanase C                                184   2e-50    Glycine soja [wild soybean]
ref|XP_008346318.1|  PREDICTED: probable endo-1,4-beta-xylanase C       184   2e-50    Malus domestica [apple tree]
ref|XP_006591552.1|  PREDICTED: uncharacterized protein LOC100775814    184   2e-50    Glycine max [soybeans]
ref|XP_011092706.1|  PREDICTED: uncharacterized protein LOC105172829    184   2e-50    
ref|XP_009607245.1|  PREDICTED: uncharacterized protein LOC104101497    184   3e-50    Nicotiana tomentosiformis
ref|XP_009350581.1|  PREDICTED: endo-1,4-beta-xylanase D-like           183   4e-50    Pyrus x bretschneideri [bai li]
gb|EMT05517.1|  Endo-1,4-beta-xylanase Z                                183   4e-50    
gb|EEE50812.1|  hypothetical protein OsJ_31205                          183   4e-50    Oryza sativa Japonica Group [Japonica rice]
gb|AAM08566.1|AC092749_19  Putative 1,4-beta-xylanase                   183   5e-50    
ref|XP_008236354.1|  PREDICTED: uncharacterized protein LOC103335129    183   5e-50    
gb|EYU39071.1|  hypothetical protein MIMGU_mgv1a003597mg                183   5e-50    
ref|XP_010315121.1|  PREDICTED: uncharacterized protein LOC101251...    183   6e-50    
ref|XP_004230568.2|  PREDICTED: uncharacterized protein LOC101251...    183   7e-50    
ref|XP_010315118.1|  PREDICTED: uncharacterized protein LOC101251...    183   8e-50    
ref|XP_010315117.1|  PREDICTED: uncharacterized protein LOC101251...    183   8e-50    
ref|XP_002313180.2|  glycosyl hydrolase family 10 family protein        182   1e-49    
ref|XP_010315116.1|  PREDICTED: uncharacterized protein LOC101251...    183   1e-49    
emb|CBI22444.3|  unnamed protein product                                182   1e-49    
ref|NP_001064415.1|  Os10g0351700                                       182   1e-49    
gb|EEC66792.1|  hypothetical protein OsI_33191                          182   1e-49    
ref|XP_009791939.1|  PREDICTED: uncharacterized protein LOC104239106    182   1e-49    
ref|XP_010315493.1|  PREDICTED: uncharacterized protein LOC101254346    182   1e-49    
ref|XP_004490332.1|  PREDICTED: endo-1,4-beta-xylanase A-like           182   1e-49    
ref|XP_004296033.1|  PREDICTED: endo-1,4-beta-xylanase D-like           182   1e-49    
ref|XP_002264837.3|  PREDICTED: uncharacterized protein LOC100266982    182   1e-49    
ref|XP_010437710.1|  PREDICTED: uncharacterized protein LOC104721430    182   2e-49    
gb|EMS65807.1|  Endo-1,4-beta-xylanase Z                                182   2e-49    
ref|XP_004987121.1|  PREDICTED: uncharacterized protein LOC101757850    181   2e-49    
ref|XP_006346512.1|  PREDICTED: uncharacterized protein LOC102598373    182   3e-49    
ref|XP_011002001.1|  PREDICTED: endo-1,4-beta-xylanase 2-like           181   4e-49    
ref|XP_007199597.1|  hypothetical protein PRUPE_ppa023031mg             180   4e-49    
ref|XP_008455522.1|  PREDICTED: uncharacterized protein LOC103495673    181   5e-49    
ref|XP_008236311.1|  PREDICTED: uncharacterized protein LOC103335088    180   7e-49    
ref|XP_011002012.1|  PREDICTED: endo-1,4-beta-xylanase 2-like           179   2e-48    
dbj|BAD06323.1|  putative 1,4-beta-xylanase                             179   2e-48    
gb|EMT27631.1|  Endo-1,4-beta-xylanase A                                179   2e-48    
ref|XP_007201537.1|  hypothetical protein PRUPE_ppa016947mg             178   2e-48    
ref|XP_002264605.1|  PREDICTED: uncharacterized protein LOC100242953    179   2e-48    
ref|XP_004137084.1|  PREDICTED: endo-1,4-beta-xylanase Z-like           178   3e-48    
gb|KGN43847.1|  hypothetical protein Csa_7G071360                       178   3e-48    
ref|XP_004169732.1|  PREDICTED: endo-1,4-beta-xylanase Z-like           178   4e-48    
ref|XP_007021527.1|  Glycosyl hydrolase family 10 protein, putative     166   6e-48    
ref|XP_007199168.1|  hypothetical protein PRUPE_ppa021363mg             176   1e-47    
gb|KDO57901.1|  hypothetical protein CISIN_1g008838mg                   176   2e-47    
ref|XP_008372757.1|  PREDICTED: uncharacterized protein LOC103436117    176   3e-47    
gb|EPS58555.1|  hypothetical protein M569_16258                         174   6e-47    
gb|EYU39073.1|  hypothetical protein MIMGU_mgv1a025021mg                174   1e-46    
ref|XP_006422816.1|  hypothetical protein CICLE_v10028089mg             174   1e-46    
ref|XP_006487064.1|  PREDICTED: uncharacterized protein LOC102624641    173   2e-46    
gb|EYU39074.1|  hypothetical protein MIMGU_mgv1a019481mg                173   2e-46    
ref|XP_010065883.1|  PREDICTED: uncharacterized protein LOC104453076    172   2e-46    
gb|KCW63584.1|  hypothetical protein EUGRSUZ_G01206                     172   4e-46    
ref|XP_011088131.1|  PREDICTED: uncharacterized protein LOC105169440    172   4e-46    
ref|XP_010065884.1|  PREDICTED: uncharacterized protein LOC104453...    172   5e-46    
ref|XP_010065885.1|  PREDICTED: uncharacterized protein LOC104453...    172   5e-46    
ref|XP_009375680.1|  PREDICTED: uncharacterized protein LOC103964472    171   6e-46    
ref|XP_006487066.1|  PREDICTED: LOW QUALITY PROTEIN: endo-1,4-bet...    168   7e-46    
gb|EYU39067.1|  hypothetical protein MIMGU_mgv1a004157mg                171   1e-45    
ref|XP_006360395.1|  PREDICTED: putative endoglucanase type F-like      169   1e-45    
ref|XP_011076914.1|  PREDICTED: uncharacterized protein LOC105161047    171   1e-45    
ref|XP_011457852.1|  PREDICTED: uncharacterized protein LOC101309796    171   2e-45    
gb|EYU38257.1|  hypothetical protein MIMGU_mgv1a004760mg                170   2e-45    
gb|KDP44501.1|  hypothetical protein JCGZ_16334                         170   3e-45    
ref|XP_002313181.1|  hypothetical protein POPTR_0009s09090g             170   3e-45    
gb|AAM08565.1|AC092749_18  Putative 1,4-beta-xylanase                   169   4e-45    
ref|XP_011088132.1|  PREDICTED: uncharacterized protein LOC105169441    169   8e-45    
ref|NP_001064414.1|  Os10g0351600                                       169   8e-45    
gb|EEC66791.1|  hypothetical protein OsI_33190                          169   1e-44    
ref|XP_002532419.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    168   1e-44    
ref|XP_010065886.1|  PREDICTED: uncharacterized protein LOC104453...    168   1e-44    
ref|XP_011013782.1|  PREDICTED: endo-1,4-beta-xylanase 2-like           168   1e-44    
ref|XP_010065888.1|  PREDICTED: uncharacterized protein LOC104453...    168   2e-44    
ref|XP_008236310.1|  PREDICTED: uncharacterized protein LOC103335087    167   2e-44    
dbj|BAM05670.1|  endo-1,4-beta-xylanase                                 162   3e-44    
emb|CAE53902.1|  putative anther endoxylanase                           158   3e-44    
dbj|BAM05669.1|  endo-1,4-beta-xylanase                                 162   4e-44    
ref|NP_001104912.1|  xylanase1                                          162   5e-44    
gb|EYU45207.1|  hypothetical protein MIMGU_mgv1a023132mg                162   6e-44    
ref|XP_004240033.1|  PREDICTED: uncharacterized protein LOC101260730    166   1e-43    
ref|XP_009416789.1|  PREDICTED: uncharacterized protein LOC103997336    166   1e-43    
gb|ACN35740.1|  unknown                                                 162   2e-43    
ref|XP_002510026.1|  conserved hypothetical protein                     159   2e-43    
ref|XP_002532422.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    165   2e-43    
ref|XP_010313152.1|  PREDICTED: uncharacterized protein LOC101264695    168   3e-43    
gb|EYU45206.1|  hypothetical protein MIMGU_mgv1a024427mg                163   3e-43    
gb|ABD47727.1|  endo-1,4-beta-xylanase                                  159   4e-43    
gb|EYU39070.1|  hypothetical protein MIMGU_mgv1a0223221mg               163   4e-43    
dbj|BAM05671.1|  endo-1,4-beta-xylanase                                 159   5e-43    
ref|XP_004292120.1|  PREDICTED: uncharacterized protein LOC101310...    164   6e-43    
ref|XP_011013777.1|  PREDICTED: uncharacterized protein LOC105117723    164   6e-43    
ref|XP_007042653.1|  Glycosyl hydrolase family 10 protein, putative     164   7e-43    
dbj|BAJ92092.1|  predicted protein                                      158   7e-43    
gb|EPS62016.1|  hypothetical protein M569_12775                         166   8e-43    
ref|XP_011002043.1|  PREDICTED: uncharacterized protein LOC105109...    163   9e-43    
gb|ACN28310.1|  unknown                                                 163   9e-43    
ref|XP_007143119.1|  hypothetical protein PHAVU_007G045400g             163   9e-43    
gb|EYU18454.1|  hypothetical protein MIMGU_mgv1a021702mg                163   9e-43    
ref|NP_001147907.1|  LOC100281517                                       163   1e-42    
ref|XP_007201097.1|  hypothetical protein PRUPE_ppa024827mg             163   1e-42    
ref|XP_011002036.1|  PREDICTED: uncharacterized protein LOC105109...    163   1e-42    
ref|XP_010059841.1|  PREDICTED: uncharacterized protein LOC104447811    165   1e-42    
gb|KCW66281.1|  hypothetical protein EUGRSUZ_F00109                     165   1e-42    
gb|KHN45114.1|  Endo-1,4-beta-xylanase A                                164   1e-42    
tpg|DAA53586.1|  TPA: putative glycosyl hydrolase family 10 protein     163   1e-42    
gb|KCW63587.1|  hypothetical protein EUGRSUZ_G01210                     162   2e-42    
ref|XP_011013781.1|  PREDICTED: uncharacterized protein LOC105117...    162   2e-42    
ref|XP_002466685.1|  hypothetical protein SORBIDRAFT_01g012210          163   2e-42    
ref|XP_011013779.1|  PREDICTED: uncharacterized protein LOC105117...    162   3e-42    
ref|XP_010068360.1|  PREDICTED: uncharacterized protein LOC104455238    162   3e-42    
ref|XP_004982198.1|  PREDICTED: uncharacterized protein LOC101767839    163   3e-42    
ref|XP_011002023.1|  PREDICTED: uncharacterized protein LOC105109118    162   3e-42    
ref|XP_002979847.1|  hypothetical protein SELMODRAFT_111304             164   4e-42    
ref|XP_009593573.1|  PREDICTED: uncharacterized protein LOC104090...    163   6e-42    
ref|XP_002313182.1|  hypothetical protein POPTR_0009s09080g             160   6e-42    
ref|XP_009593572.1|  PREDICTED: uncharacterized protein LOC104090...    163   7e-42    
ref|XP_004501484.1|  PREDICTED: exoglucanase XynX-like isoform X1       162   7e-42    
ref|XP_007136802.1|  hypothetical protein PHAVU_009G075400g             162   7e-42    
ref|XP_007160967.1|  hypothetical protein PHAVU_001G032300g             163   8e-42    
gb|KCW63583.1|  hypothetical protein EUGRSUZ_G01205                     160   9e-42    
ref|XP_008644608.1|  PREDICTED: uncharacterized protein LOC103625996    161   1e-41    
ref|XP_010065892.1|  PREDICTED: uncharacterized protein LOC104453081    160   1e-41    
ref|XP_010059839.1|  PREDICTED: uncharacterized protein LOC104447...    162   1e-41    
ref|XP_007160968.1|  hypothetical protein PHAVU_001G032300g             162   1e-41    
gb|EYU18055.1|  hypothetical protein MIMGU_mgv1a027071mg                162   1e-41    
ref|XP_010059834.1|  PREDICTED: uncharacterized protein LOC104447...    162   1e-41    
ref|XP_010059836.1|  PREDICTED: uncharacterized protein LOC104447...    162   1e-41    
ref|NP_195543.1|  glycosyl hydrolase family 10 protein                  154   2e-41    
ref|XP_003561399.1|  PREDICTED: uncharacterized protein LOC100831608    160   2e-41    
ref|XP_010068352.1|  PREDICTED: uncharacterized protein LOC104455228    160   2e-41    
ref|XP_009764538.1|  PREDICTED: uncharacterized protein LOC104216...    162   2e-41    
ref|XP_002988417.1|  hypothetical protein SELMODRAFT_183850             161   3e-41    
ref|XP_009764539.1|  PREDICTED: uncharacterized protein LOC104216...    161   3e-41    
gb|KHN29740.1|  Endo-1,4-beta-xylanase A                                159   4e-41    
ref|XP_006578072.1|  PREDICTED: uncharacterized protein LOC100801147    160   4e-41    
ref|XP_006596009.1|  PREDICTED: uncharacterized protein LOC100816...    161   4e-41    
ref|XP_004238054.1|  PREDICTED: uncharacterized protein LOC101247815    161   4e-41    
ref|XP_003545364.1|  PREDICTED: uncharacterized protein LOC100816...    161   4e-41    
ref|XP_010683117.1|  PREDICTED: uncharacterized protein LOC104897858    159   4e-41    
ref|XP_002313183.1|  glycosyl hydrolase family 10 family protein        158   5e-41    
ref|XP_010664468.1|  PREDICTED: uncharacterized protein LOC100253904    160   6e-41    
gb|KCW63590.1|  hypothetical protein EUGRSUZ_G01215                     157   6e-41    
ref|XP_006433689.1|  hypothetical protein CICLE_v10000171mg             160   9e-41    
ref|XP_006386463.1|  hypothetical protein POPTR_0002s11370g             159   1e-40    
ref|XP_002455241.1|  hypothetical protein SORBIDRAFT_03g006950          157   1e-40    
ref|XP_010065894.1|  PREDICTED: uncharacterized protein LOC104453082    157   1e-40    
ref|XP_006356811.1|  PREDICTED: uncharacterized protein LOC102601527    160   1e-40    
ref|XP_007225325.1|  hypothetical protein PRUPE_ppa001089mg             159   2e-40    
dbj|BAD52808.1|  putative (1,4)-beta-xylan endohydrolase                154   2e-40    
ref|XP_010418868.1|  PREDICTED: endo-1,4-beta-xylanase C-like           155   2e-40    
ref|NP_001041947.2|  Os01g0134900                                       154   2e-40    
gb|KJB58736.1|  hypothetical protein B456_009G223600                    157   3e-40    
ref|XP_006472354.1|  PREDICTED: uncharacterized protein LOC102615...    159   3e-40    
ref|XP_010673245.1|  PREDICTED: uncharacterized protein LOC104889668    156   3e-40    
gb|KDO81382.1|  hypothetical protein CISIN_1g002447mg                   158   3e-40    
ref|XP_008377940.1|  PREDICTED: uncharacterized protein LOC103441016    159   4e-40    
ref|XP_006645473.1|  PREDICTED: uncharacterized protein LOC102707730    155   4e-40    
ref|XP_003549366.1|  PREDICTED: uncharacterized protein LOC100818...    158   5e-40    
gb|EAY72426.1|  hypothetical protein OsI_00280                          155   5e-40    
ref|XP_006601252.1|  PREDICTED: uncharacterized protein LOC100818...    158   5e-40    
gb|KHN37003.1|  Endo-1,4-beta-xylanase A                                158   5e-40    
ref|XP_008220426.1|  PREDICTED: uncharacterized protein LOC103320516    158   5e-40    
gb|EPS60186.1|  hypothetical protein M569_14617                         153   5e-40    
gb|KCW63591.1|  hypothetical protein EUGRSUZ_G01217                     155   5e-40    
ref|XP_007143125.1|  hypothetical protein PHAVU_007G045900g             155   6e-40    
ref|XP_010065891.1|  PREDICTED: uncharacterized protein LOC104453...    155   7e-40    
ref|XP_002510024.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    157   7e-40    
ref|XP_010065889.1|  PREDICTED: uncharacterized protein LOC104453...    155   7e-40    
ref|XP_010065890.1|  PREDICTED: uncharacterized protein LOC104453...    155   7e-40    
gb|KDP41561.1|  hypothetical protein JCGZ_15968                         157   8e-40    
emb|CDP00990.1|  unnamed protein product                                157   9e-40    
ref|XP_010314597.1|  PREDICTED: uncharacterized protein LOC101253...    156   1e-39    
gb|EYU39068.1|  hypothetical protein MIMGU_mgv1a003542mg                154   1e-39    
ref|XP_010470261.1|  PREDICTED: uncharacterized protein LOC104750196    157   1e-39    
ref|XP_008452694.1|  PREDICTED: uncharacterized protein LOC103493...    155   2e-39    
ref|XP_010941971.1|  PREDICTED: uncharacterized protein LOC105060078    155   2e-39    
gb|EEE53822.1|  hypothetical protein OsJ_00271                          154   2e-39    
ref|XP_006848863.1|  hypothetical protein AMTR_s00026p00218770          156   2e-39    
ref|XP_002301133.2|  hypothetical protein POPTR_0002s11380g             156   2e-39    
gb|AES62756.2|  glycosyl hydrolase family 10 protein                    154   2e-39    
emb|CDY53797.1|  BnaCnng25660D                                          156   2e-39    
ref|XP_004252731.1|  PREDICTED: uncharacterized protein LOC101253...    156   3e-39    
gb|KJB64010.1|  hypothetical protein B456_010G029100                    155   3e-39    
ref|XP_011017054.1|  PREDICTED: uncharacterized protein LOC105120...    155   3e-39    
ref|XP_008452691.1|  PREDICTED: uncharacterized protein LOC103493...    155   4e-39    
ref|XP_009361446.1|  PREDICTED: uncharacterized protein LOC103951721    156   4e-39    
ref|XP_007018397.1|  Glycosyl hydrolase family 10 protein / carbo...    155   4e-39    
ref|XP_011017053.1|  PREDICTED: uncharacterized protein LOC105120...    155   4e-39    
ref|XP_003555995.1|  PREDICTED: uncharacterized protein LOC100777980    153   4e-39    
ref|XP_007018396.1|  Glycosyl hydrolase family 10 protein / carbo...    155   4e-39    
gb|KEH35867.1|  endo-1,4-beta-xylanase A-like protein                   154   4e-39    
dbj|BAK00748.1|  predicted protein                                      154   5e-39    
emb|CDY48844.1|  BnaA09g14690D                                          155   5e-39    
ref|XP_010511079.1|  PREDICTED: uncharacterized protein LOC104787239    155   6e-39    
gb|EMT29149.1|  Endo-1,4-beta-xylanase C                                153   6e-39    
gb|AAX33301.1|  putative endo-1,4-beta-xylanase                         154   9e-39    
ref|XP_004498933.1|  PREDICTED: uncharacterized protein LOC101490606    154   9e-39    
ref|XP_007143120.1|  hypothetical protein PHAVU_007G045500g             152   1e-38    
ref|XP_009337134.1|  PREDICTED: uncharacterized protein LOC103929637    154   1e-38    
ref|XP_010692661.1|  PREDICTED: uncharacterized protein LOC104905...    154   1e-38    
ref|XP_006300601.1|  hypothetical protein CARUB_v10019737mg             154   1e-38    
ref|XP_003560192.1|  PREDICTED: uncharacterized protein LOC100826187    151   1e-38    
ref|XP_006650398.1|  PREDICTED: uncharacterized protein LOC102709258    153   1e-38    
gb|KHG14523.1|  Endo-1,4-beta-xylanase A                                154   1e-38    
gb|KDP41560.1|  hypothetical protein JCGZ_15967                         152   2e-38    
ref|XP_004141418.1|  PREDICTED: endo-1,4-beta-xylanase A-like           154   2e-38    
gb|EMS60749.1|  Endo-1,4-beta-xylanase Z                                154   2e-38    
ref|XP_004167717.1|  PREDICTED: endo-1,4-beta-xylanase A-like           153   2e-38    
ref|XP_010692658.1|  PREDICTED: uncharacterized protein LOC104905...    154   2e-38    
gb|KEH39967.1|  endo-1,4-beta-xylanase A-like protein                   153   2e-38    
ref|XP_010692660.1|  PREDICTED: uncharacterized protein LOC104905...    154   2e-38    
gb|KGN55310.1|  hypothetical protein Csa_4G645840                       153   2e-38    
ref|XP_010692657.1|  PREDICTED: uncharacterized protein LOC104905...    154   2e-38    
gb|EAY91350.1|  hypothetical protein OsI_12971                          152   2e-38    
gb|AAG50641.1|AC082643_5  xylan endohydrolase isoenzyme, putative       153   2e-38    
ref|NP_001050876.1|  Os03g0672900                                       152   2e-38    
ref|NP_176133.1|  xylanase 1                                            153   2e-38    
ref|XP_008454401.1|  PREDICTED: uncharacterized protein LOC103494817    150   2e-38    
ref|XP_008360966.1|  PREDICTED: uncharacterized protein LOC103424649    153   3e-38    
ref|XP_002459803.1|  hypothetical protein SORBIDRAFT_02g010990          153   3e-38    
gb|KHG10863.1|  Endo-1,4-beta-xylanase A                                152   3e-38    
ref|XP_009113316.1|  PREDICTED: uncharacterized protein LOC103838...    152   3e-38    
ref|XP_009113315.1|  PREDICTED: uncharacterized protein LOC103838...    152   4e-38    
ref|XP_006392302.1|  hypothetical protein EUTSA_v10023244mg             152   4e-38    
gb|EMS67873.1|  Endo-1,4-beta-xylanase Z                                151   4e-38    
tpg|DAA60497.1|  TPA: putative glycosyl hydrolase family protein        149   5e-38    
ref|XP_011099764.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    152   5e-38    
dbj|BAK04251.1|  predicted protein                                      150   6e-38    
ref|XP_008393673.1|  PREDICTED: uncharacterized protein LOC103455847    152   6e-38    
gb|KJB32237.1|  hypothetical protein B456_005G231100                    149   7e-38    



>ref|XP_007201160.1| hypothetical protein PRUPE_ppa004290mg [Prunus persica]
 gb|EMJ02359.1| hypothetical protein PRUPE_ppa004290mg [Prunus persica]
Length=518

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGP+ATL FF+TAH+ DPLATLFMNDFNVVETCSD  STVD YIS
Sbjct  289  DVSNEMLHFDFYEQKLGPNATLHFFETAHKFDPLATLFMNDFNVVETCSDVNSTVDAYIS  348

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG  MDGIGLEGHF  PNPPLIRAILDKLATL LPIWLTE+DI+   G+E QA
Sbjct  349  RLRELRYGGALMDGIGLEGHFIVPNPPLIRAILDKLATLSLPIWLTEVDISSTLGKEAQA  408

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAGDVVD LLKEWQT  
Sbjct  409  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNLQNLPAGDVVDKLLKEWQTGE  468

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TD+HGSYSF GFLGEYKVSV+YGN+T++STFSL +GEETRH  IQL
Sbjct  469  IEGETDDHGSYSFFGFLGEYKVSVKYGNKTSSSTFSLCQGEETRHVSIQL  518



>ref|XP_010646993.1| PREDICTED: probable endo-1,4-beta-xylanase C [Vitis vinifera]
 ref|XP_002277675.2| PREDICTED: probable endo-1,4-beta-xylanase C [Vitis vinifera]
Length=550

 Score =   383 bits (983),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL F++TAHE+DPLATLFMNDFNVVETCSD  STVD YIS
Sbjct  321  DVSNEMLHFDFYEQRLGPDATLHFYETAHESDPLATLFMNDFNVVETCSDVNSTVDAYIS  380

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL +GG +M GIGLEGHF+ PNPPLIRAILDKLATL+LPIWLTEIDI+    +ETQA
Sbjct  381  RLRELSRGGATMSGIGLEGHFTIPNPPLIRAILDKLATLQLPIWLTEIDISNTLSKETQA  440

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+   GC+QMCLTDNN +NLPAGDVVD +LKEWQT  
Sbjct  441  VYLEQVLREGFSHPSVNGIMLWTALHSYGCYQMCLTDNNFHNLPAGDVVDKILKEWQTGE  500

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD+HGSYSF GFLGEY+V+V YGNRTA STFSL RG+ETRHF IQL
Sbjct  501  IGGQTDDHGSYSFFGFLGEYQVTVRYGNRTANSTFSLCRGDETRHFSIQL  550



>ref|XP_007041881.1| Glycosyl hydrolase family 10 protein isoform 2 [Theobroma cacao]
 gb|EOX97712.1| Glycosyl hydrolase family 10 protein isoform 2 [Theobroma cacao]
Length=416

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL F++TAH++DPLATLFMN+FNVVETCSD KSTVDTYI 
Sbjct  187  DVSNEMLHFDFYEQRLGPDATLHFYETAHQSDPLATLFMNEFNVVETCSDVKSTVDTYIE  246

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++LKQGG+ MDGIGLE HF+ PNP L+RA+LDKLATL LPIWLTE+DI+   G+E QA
Sbjct  247  RIRDLKQGGMYMDGIGLESHFTVPNPALMRAVLDKLATLGLPIWLTEVDISSSVGEELQA  306

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ PKGC++MCLTD N  NLPAG+VVDNLLKEWQT  
Sbjct  307  IYLEQVLREGFSHPSVNGIMLWTALHPKGCYEMCLTDKNFKNLPAGEVVDNLLKEWQTGE  366

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGSYSF GFLGEYKV+V  GNR+A STFSL R +ET+HF IQL
Sbjct  367  INGQTDEHGSYSFYGFLGEYKVNVSSGNRSANSTFSLCRSDETKHFSIQL  416



>ref|XP_010090320.1| Endo-1,4-beta-xylanase A [Morus notabilis]
 gb|EXB39290.1| Endo-1,4-beta-xylanase A [Morus notabilis]
Length=548

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 204/230 (89%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGP+ATL FF+TAH++DPLATLFMN+FNVVETC+D  STVD YIS
Sbjct  319  DVSNEMLHFDFYEQKLGPNATLHFFETAHQSDPLATLFMNEFNVVETCNDMNSTVDAYIS  378

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KEL+ GG+ MDGIGLEGHF+ PNP L+RAILDKLATL LP+WLTE+DI+    + TQ 
Sbjct  379  RLKELRSGGVFMDGIGLEGHFTVPNPALMRAILDKLATLGLPVWLTEVDISNTLDKATQT  438

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTD+NL NLPAGDVVD LLKEW+T+ 
Sbjct  439  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDDNLQNLPAGDVVDKLLKEWRTEK  498

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            LEG TDEHGSYSF GFLGEYK+SV+YGN+TA+STFSL++GEETRHF IQL
Sbjct  499  LEGVTDEHGSYSFFGFLGEYKISVDYGNKTASSTFSLSQGEETRHFSIQL  548



>emb|CBI37893.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   383 bits (983),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL F++TAHE+DPLATLFMNDFNVVETCSD  STVD YIS
Sbjct  396  DVSNEMLHFDFYEQRLGPDATLHFYETAHESDPLATLFMNDFNVVETCSDVNSTVDAYIS  455

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL +GG +M GIGLEGHF+ PNPPLIRAILDKLATL+LPIWLTEIDI+    +ETQA
Sbjct  456  RLRELSRGGATMSGIGLEGHFTIPNPPLIRAILDKLATLQLPIWLTEIDISNTLSKETQA  515

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+   GC+QMCLTDNN +NLPAGDVVD +LKEWQT  
Sbjct  516  VYLEQVLREGFSHPSVNGIMLWTALHSYGCYQMCLTDNNFHNLPAGDVVDKILKEWQTGE  575

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD+HGSYSF GFLGEY+V+V YGNRTA STFSL RG+ETRHF IQL
Sbjct  576  IGGQTDDHGSYSFFGFLGEYQVTVRYGNRTANSTFSLCRGDETRHFSIQL  625



>ref|XP_008235994.1| PREDICTED: probable endo-1,4-beta-xylanase C [Prunus mume]
Length=556

 Score =   380 bits (977),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGP+ATL FF+TAH+ DPLATLFMNDFNVVETCSD  STVD YIS
Sbjct  327  DVSNEMLHFDFYEQKLGPNATLHFFETAHKFDPLATLFMNDFNVVETCSDVNSTVDAYIS  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG  MDGIGLEGHF  PNPPLIRAILDKLATL LPIWLTE+DI+   G+E QA
Sbjct  387  RLRELRYGGALMDGIGLEGHFRVPNPPLIRAILDKLATLGLPIWLTEVDISSTLGKEAQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAGDVVD LL EWQT  
Sbjct  447  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNLQNLPAGDVVDKLLTEWQTGE  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TD+HGSYSF GFLGEYKVS++YGN+T++STFSL +G+ETRH  IQL
Sbjct  507  IEGETDDHGSYSFFGFLGEYKVSIKYGNKTSSSTFSLCQGDETRHVSIQL  556



>ref|XP_008349367.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=529

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 202/230 (88%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGP+ATL FF+TAH++DPLATLFMNDFNVVETCSD  STVD+YIS
Sbjct  300  DVSNEMLHFDFYEQKLGPNATLHFFETAHKSDPLATLFMNDFNVVETCSDVNSTVDSYIS  359

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG  MDGIGLEGHF+ PN PL+RAILDKLATL LPIWLTE+DI+    +ETQA
Sbjct  360  RLRELRHGGALMDGIGLEGHFTVPNLPLMRAILDKLATLGLPIWLTEVDISSTLDKETQA  419

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAGDVVD LLKEWQT  
Sbjct  420  IYLEQVLREGFSHPSVNGIMLWTAMHPNGCYQMCLTDNNLQNLPAGDVVDKLLKEWQTGE  479

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TDEHGSYSF GFLGEYKVSV+YGNR+++ST SL +G+ETRH  IQ+
Sbjct  480  IEGQTDEHGSYSFYGFLGEYKVSVKYGNRSSSSTLSLCQGKETRHVSIQM  529



>ref|XP_011457934.1| PREDICTED: uncharacterized protein LOC101305915 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 204/230 (89%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE++LGP+ATL+FF+TAH++DPLATLFMN+FNVVETC+D  STVDTY+S
Sbjct  312  DVSNEMLHFDFYEKQLGPNATLDFFQTAHKSDPLATLFMNEFNVVETCTDVNSTVDTYVS  371

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+QGG+SMDGIGLEGHF+ PNPPL+RAI+DKLATL LPIWLTE+DI+    +ETQA
Sbjct  372  RLRELQQGGVSMDGIGLEGHFTRPNPPLMRAIIDKLATLGLPIWLTEVDISNTLDKETQA  431

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTDNNL NLPAGDVVD LLKEWQT+ 
Sbjct  432  IYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDNNLQNLPAGDVVDRLLKEWQTRK  491

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +E  TDEHGS+SF GFLGEY+VSV+Y NRT  STFSL +GEETRH  I L
Sbjct  492  IEAQTDEHGSHSFYGFLGEYRVSVKYSNRTTNSTFSLCQGEETRHVSILL  541



>gb|KDP29627.1| hypothetical protein JCGZ_18789 [Jatropha curcas]
Length=443

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL FF+TAH+ DPLATLFMN+FNVVETCSD  STVDTYIS
Sbjct  214  DVSNEMLHFDFYEQRLGPDATLHFFETAHKVDPLATLFMNEFNVVETCSDVNSTVDTYIS  273

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG+ +DGIGLE HFSAPN PL+R ILDKLATL LPIWLTE+DI+K +  ETQA
Sbjct  274  RLRELELGGVFLDGIGLESHFSAPNLPLMRGILDKLATLDLPIWLTEVDISKNFNYETQA  333

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV+GI+LWTA+ P GC+QMCLTDNN  NLPAGDVVD LL+EW+T  
Sbjct  334  IYLEQVLREGFSHPAVNGIILWTALHPNGCYQMCLTDNNFKNLPAGDVVDKLLQEWRTGE  393

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDE GS+SF GFLGEY++SV +GNRTA STFSL+RG+ET+HF IQL
Sbjct  394  MNGYTDEQGSHSFFGFLGEYRISVAFGNRTANSTFSLSRGDETKHFNIQL  443



>ref|XP_009340235.1| PREDICTED: probable endo-1,4-beta-xylanase C [Pyrus x bretschneideri]
Length=550

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGP+ATL FF+TAH++DPLATLFMNDFNVVETCSD  STVD YIS
Sbjct  321  DVSNEMLHFDFYEQKLGPNATLHFFETAHKSDPLATLFMNDFNVVETCSDVNSTVDYYIS  380

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG  MDGIGLEGHF+ PN PL+RAILDKLATL LPIWLTE+DI+    +ETQA
Sbjct  381  RLRELRHGGALMDGIGLEGHFTVPNLPLMRAILDKLATLGLPIWLTEVDISSTLDKETQA  440

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL+NLPAGD+VD LLKEWQT  
Sbjct  441  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNLHNLPAGDIVDKLLKEWQTGE  500

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TDEHGSYSF GFLGEY+VS+++GNRT++STFSL +GEETRH  IQL
Sbjct  501  VEGQTDEHGSYSFYGFLGEYRVSIKHGNRTSSSTFSLCQGEETRHVSIQL  550



>ref|XP_011457932.1| PREDICTED: uncharacterized protein LOC101305915 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=556

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 204/230 (89%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE++LGP+ATL+FF+TAH++DPLATLFMN+FNVVETC+D  STVDTY+S
Sbjct  327  DVSNEMLHFDFYEKQLGPNATLDFFQTAHKSDPLATLFMNEFNVVETCTDVNSTVDTYVS  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+QGG+SMDGIGLEGHF+ PNPPL+RAI+DKLATL LPIWLTE+DI+    +ETQA
Sbjct  387  RLRELQQGGVSMDGIGLEGHFTRPNPPLMRAIIDKLATLGLPIWLTEVDISNTLDKETQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTDNNL NLPAGDVVD LLKEWQT+ 
Sbjct  447  IYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDNNLQNLPAGDVVDRLLKEWQTRK  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +E  TDEHGS+SF GFLGEY+VSV+Y NRT  STFSL +GEETRH  I L
Sbjct  507  IEAQTDEHGSHSFYGFLGEYRVSVKYSNRTTNSTFSLCQGEETRHVSILL  556



>ref|XP_007041880.1| Glycosyl hydrolase family 10 protein isoform 1 [Theobroma cacao]
 gb|EOX97711.1| Glycosyl hydrolase family 10 protein isoform 1 [Theobroma cacao]
Length=564

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL F++TAH++DPLATLFMN+FNVVETCSD KSTVDTYI 
Sbjct  335  DVSNEMLHFDFYEQRLGPDATLHFYETAHQSDPLATLFMNEFNVVETCSDVKSTVDTYIE  394

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++LKQGG+ MDGIGLE HF+ PNP L+RA+LDKLATL LPIWLTE+DI+   G+E QA
Sbjct  395  RIRDLKQGGMYMDGIGLESHFTVPNPALMRAVLDKLATLGLPIWLTEVDISSSVGEELQA  454

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ PKGC++MCLTD N  NLPAG+VVDNLLKEWQT  
Sbjct  455  IYLEQVLREGFSHPSVNGIMLWTALHPKGCYEMCLTDKNFKNLPAGEVVDNLLKEWQTGE  514

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGSYSF GFLGEYKV+V  GNR+A STFSL R +ET+HF IQL
Sbjct  515  INGQTDEHGSYSFYGFLGEYKVNVSSGNRSANSTFSLCRSDETKHFSIQL  564



>ref|XP_004500734.1| PREDICTED: probable endo-1,4-beta-xylanase C-like [Cicer arietinum]
Length=537

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG +AT  FF+ AHE+DPLATLFMNDFNVVETC+D  STVD YI 
Sbjct  308  DVSNEMLHFDFYEQRLGTNATFHFFEAAHESDPLATLFMNDFNVVETCNDVNSTVDAYIL  367

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+Q G+ MDGIGLEGHF+ PNPPLIRAILDKLATL LPIWLTEIDI+K   ++TQA
Sbjct  368  RIRELRQHGVFMDGIGLEGHFTKPNPPLIRAILDKLATLDLPIWLTEIDISKTLDKDTQA  427

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+ NNLP+GDVVD LL+EWQT+ 
Sbjct  428  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNDFNNLPSGDVVDKLLEEWQTER  487

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TDEHGS+SF GFLGEYK+SVEYGNRT  STFSL RGEETRH  + L
Sbjct  488  VEGVTDEHGSHSFYGFLGEYKISVEYGNRTINSTFSLCRGEETRHVTVTL  537



>ref|XP_009349686.1| PREDICTED: probable endo-1,4-beta-xylanase C [Pyrus x bretschneideri]
Length=533

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGPDA L FF+TAH++DPLATLFMNDFNVVETCSD  STVD+YIS
Sbjct  304  DVSNEMLHFDFYEQKLGPDAALHFFETAHKSDPLATLFMNDFNVVETCSDVNSTVDSYIS  363

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG  MDGIGLEGHF  PN PL+RAILDKLATL LPIWLTE+DI+    +ETQA
Sbjct  364  RLRELRHGGALMDGIGLEGHFIVPNLPLMRAILDKLATLGLPIWLTEVDISSTLDKETQA  423

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAGDVVD LLKEWQT  
Sbjct  424  IYLEQVLREGFSHPSVNGIMLWTAMHPNGCYQMCLTDNNLQNLPAGDVVDKLLKEWQTGE  483

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TDEHGSYSF GFLGEY+V V+YGNR+++STFSL +G+ETRH  IQ+
Sbjct  484  IDGQTDEHGSYSFYGFLGEYRVGVKYGNRSSSSTFSLCQGKETRHVSIQM  533



>ref|XP_008372900.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=550

 Score =   375 bits (963),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGP+ATL FF+TAH++DPLATLFMNDFNV ETCSD  STVD+YIS
Sbjct  321  DVSNEMLHFDFYEQKLGPNATLHFFETAHKSDPLATLFMNDFNVXETCSDVNSTVDSYIS  380

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG  MDGIGLEGHF+ PN PL+RA LDKLATL LPIWLTE+DI+    +ETQA
Sbjct  381  RLRELRHGGALMDGIGLEGHFTVPNLPLMRAXLDKLATLGLPIWLTEVDISSTLDKETQA  440

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP V+GIMLWTA+ P GC+QMCLTD+NL NLPAGDVVD LLKEWQT  
Sbjct  441  IYLEQVLREGFSHPLVNGIMLWTALHPNGCYQMCLTDDNLQNLPAGDVVDKLLKEWQTGE  500

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TDEHGSYSF GFLGEY+VS++YGNRT++STFSL +GEETRH  IQL
Sbjct  501  VEGQTDEHGSYSFYGFLGEYRVSIKYGNRTSSSTFSLCQGEETRHVSIQL  550



>ref|XP_006577900.1| PREDICTED: uncharacterized protein LOC100793558 [Glycine max]
 gb|KHN33681.1| Endo-1,4-beta-xylanase A [Glycine soja]
Length=557

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHF+ YE+RLGPDATL FF+TAHE+DPLATLFMNDFNVVETCSD KSTVD YIS
Sbjct  328  DVSNEMLHFNFYEERLGPDATLHFFETAHESDPLATLFMNDFNVVETCSDVKSTVDAYIS  387

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ GI MDGIGLEGHF+ PNPPLIRAILDKLATL LPIWLTE+DI+K   ++ QA
Sbjct  388  RVRELQRNGIFMDGIGLEGHFTIPNPPLIRAILDKLATLGLPIWLTEVDISKTLDRDAQA  447

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP+V+GIMLWTA  P GC+QMCLTDNN  NLPAGDVVD L++EWQ   
Sbjct  448  NYLEEVLREGFSHPSVNGIMLWTAFHPNGCYQMCLTDNNFKNLPAGDVVDKLVEEWQISR  507

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TD HGSYSF GFLGEY++SV+YGN+T  STFSL+RG+ETRHF I +
Sbjct  508  VEGVTDVHGSYSFYGFLGEYRISVKYGNKTTKSTFSLSRGDETRHFTITI  557



>emb|CDO96932.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQ+LGPDA+L+FF+T+H+ADPLATLFMN++NVVETC D  STVD YIS
Sbjct  350  DVSNEMLHFDFYEQKLGPDASLQFFETSHQADPLATLFMNEYNVVETCFDMSSTVDAYIS  409

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ G+SMDGIGLE HF+ PNPPL+RAILDKLATL LPIWLTE+DI     Q+TQA
Sbjct  410  RLRELERAGVSMDGIGLESHFTIPNPPLMRAILDKLATLNLPIWLTEVDIGNTLDQQTQA  469

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNN  NLPAGDVVDNLLKEWQT  
Sbjct  470  RYLEAVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNFRNLPAGDVVDNLLKEWQTGA  529

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TD+HGS+SF GF GEYKV+V YGNRT TSTFSL +G+ETRH  IQL
Sbjct  530  VEGQTDDHGSFSFYGFFGEYKVTVCYGNRTVTSTFSLCQGDETRHLNIQL  579



>ref|XP_011092889.1| PREDICTED: endo-1,4-beta-xylanase 1 isoform X2 [Sesamum indicum]
Length=532

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLG DATL+FFKTA+EADPLATLFMN+FNVVETC D  STVD Y+S
Sbjct  303  DVSNEMLHFDFYEERLGADATLKFFKTANEADPLATLFMNEFNVVETCEDVDSTVDAYVS  362

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +M+ELK GG+SMDGIGL+GHF  PN PL+R ILDKLATL LPIWLTE+DI+ K+ +ETQA
Sbjct  363  RMRELKLGGVSMDGIGLQGHFDVPNSPLMRGILDKLATLGLPIWLTEVDISNKFNKETQA  422

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV+GI+LWTA+   GC+QMCLTD + NNLPAGD VD LLKEWQT T
Sbjct  423  IYLEQVLREGFSHPAVNGIILWTALRQGGCYQMCLTDGDFNNLPAGDTVDKLLKEWQTGT  482

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            LEG TDEHGSYSF G LGEY V+  YGN+T  ST SL+RG+ET+HF +QL
Sbjct  483  LEGRTDEHGSYSFFGILGEYVVTARYGNKTVYSTLSLSRGKETKHFNVQL  532



>ref|XP_002534153.1| Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
 gb|EEF28229.1| Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
Length=473

 Score =   368 bits (945),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL F++TAH+ADPLATLFMN+FNVVETCSD  STVDTYIS
Sbjct  244  DVSNEMLHFDFYEQRLGPDATLHFYETAHQADPLATLFMNEFNVVETCSDVNSTVDTYIS  303

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+ GG+ MDGIGLE HFS PN PL+R ILDKLATL LPIWLTE+DI+K +  ++Q 
Sbjct  304  RLRELEGGGVFMDGIGLESHFSVPNLPLMRGILDKLATLGLPIWLTEVDISKNFDHKSQG  363

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV+GIMLWTA+   GC+QMCLTDNN  NLPAGDVVDNLLKEW+T  
Sbjct  364  IYLEQVLREGFSHPAVNGIMLWTALHSDGCYQMCLTDNNFQNLPAGDVVDNLLKEWKTGN  423

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGS+SF GFLGEY++SV++GN  + STFSL+R  ET+HF IQL
Sbjct  424  INGYTDEHGSFSFSGFLGEYRISVQFGNAASNSTFSLSRSLETKHFNIQL  473



>ref|XP_011092888.1| PREDICTED: uncharacterized protein LOC105172963 isoform X1 [Sesamum 
indicum]
Length=554

 Score =   370 bits (951),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLG DATL+FFKTA+EADPLATLFMN+FNVVETC D  STVD Y+S
Sbjct  325  DVSNEMLHFDFYEERLGADATLKFFKTANEADPLATLFMNEFNVVETCEDVDSTVDAYVS  384

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +M+ELK GG+SMDGIGL+GHF  PN PL+R ILDKLATL LPIWLTE+DI+ K+ +ETQA
Sbjct  385  RMRELKLGGVSMDGIGLQGHFDVPNSPLMRGILDKLATLGLPIWLTEVDISNKFNKETQA  444

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV+GI+LWTA+   GC+QMCLTD + NNLPAGD VD LLKEWQT T
Sbjct  445  IYLEQVLREGFSHPAVNGIILWTALRQGGCYQMCLTDGDFNNLPAGDTVDKLLKEWQTGT  504

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            LEG TDEHGSYSF G LGEY V+  YGN+T  ST SL+RG+ET+HF +QL
Sbjct  505  LEGRTDEHGSYSFFGILGEYVVTARYGNKTVYSTLSLSRGKETKHFNVQL  554



>gb|KHN20002.1| Endo-1,4-beta-xylanase A [Glycine soja]
Length=551

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGP+ATL FF+TAH++DPLATLFMNDFNVVETCSD KSTVD YIS
Sbjct  322  DVSNEMLHFDFYEERLGPNATLHFFQTAHKSDPLATLFMNDFNVVETCSDVKSTVDAYIS  381

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ GI MDGIGLEGHF+ PNPPLIRAILDKLATL LPIWLTE+DI+K   ++ QA
Sbjct  382  RVRELQRNGIFMDGIGLEGHFTIPNPPLIRAILDKLATLGLPIWLTEVDISKTLDRDAQA  441

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             Y E VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNN  NLPAGD VD LL+EWQT  
Sbjct  442  NYSEEVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNFKNLPAGDAVDKLLQEWQTGR  501

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG +D HGSYSF GFLGEY++SV+YGN+T  STFSL+RG+ETRHF I +
Sbjct  502  VEGVSDVHGSYSFYGFLGEYRISVKYGNKTTKSTFSLSRGDETRHFTITI  551



>ref|XP_006581102.1| PREDICTED: probable endo-1,4-beta-xylanase C-like [Glycine max]
Length=551

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGP+ATL FF+TAH++DPLATLFMNDFNVVETCSD KSTVD YIS
Sbjct  322  DVSNEMLHFDFYEERLGPNATLHFFQTAHKSDPLATLFMNDFNVVETCSDVKSTVDAYIS  381

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ GI MDGIGLEGHF+ PNPPLIRAILDKLATL LPIWLTE+DI+K   ++ QA
Sbjct  382  RVRELQRNGIFMDGIGLEGHFTIPNPPLIRAILDKLATLGLPIWLTEVDISKTLDRDAQA  441

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             Y E VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNN  NLPAGD VD LL+EWQT  
Sbjct  442  NYSEEVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNFKNLPAGDAVDKLLQEWQTGR  501

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG +D HGSYSF GFLGEY++SV+YGN T  STFSL+RG+ETRHF I +
Sbjct  502  VEGVSDVHGSYSFYGFLGEYRISVKYGNNTTKSTFSLSRGDETRHFTITI  551



>gb|KHG02946.1| Endo-1,4-beta-xylanase A [Gossypium arboreum]
Length=542

 Score =   367 bits (943),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGPDATL F++TAH++DPLATLFMN+FNVVETCSD KSTVDTYI 
Sbjct  313  DVSNEMLHFDFYEQRLGPDATLHFYETAHQSDPLATLFMNEFNVVETCSDVKSTVDTYIE  372

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++GG+ MDGIGLE HF+ PN PL+RA++DKLATLRLPIWLTE+DI+   G+E Q 
Sbjct  373  RIRELERGGMYMDGIGLESHFTVPNLPLMRAVIDKLATLRLPIWLTEVDISSSVGKELQG  432

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+ PKGC++MCLTD N  NLPAGDVVD LLKEW++  
Sbjct  433  VYLEQVLREGFSHPSVNGIMLWTALHPKGCYEMCLTDENFKNLPAGDVVDKLLKEWESGE  492

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TDEHGSYSF GFLGEYKV+V YG+R A STFSL R +ET+HF I L
Sbjct  493  MKGVTDEHGSYSFYGFLGEYKVNVGYGDRAANSTFSLPRSDETKHFSIHL  542



>ref|XP_008457673.1| PREDICTED: uncharacterized protein LOC103497316 [Cucumis melo]
Length=556

 Score =   368 bits (944),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+ LG +ATL F+KTAHE DPLATLFMN+FNVVETCSD KSTVD YI+
Sbjct  327  DVSNEMLHFDFYEKSLGANATLHFYKTAHEIDPLATLFMNEFNVVETCSDVKSTVDNYIN  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KELK+ G+SMDGIGLEGHF+ PNPPL+RAILDKLATL LPIWLTE+DI+   GQETQA
Sbjct  387  RLKELKRNGVSMDGIGLEGHFTIPNPPLMRAILDKLATLNLPIWLTEVDISHTLGQETQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHPAV GIMLW+A+ P GC+QMCLTD N  NLP GDVVD LLKEW+T+ 
Sbjct  447  SYLEVVLREGFSHPAVGGIMLWSALGPNGCYQMCLTDANFRNLPTGDVVDKLLKEWKTED  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +E  TD HGS+SF GFLGEY+VSV+Y NR+ATSTF ++ G+ET+HF IQL
Sbjct  507  IEARTDNHGSFSFYGFLGEYEVSVKYENRSATSTFPVSVGDETKHFSIQL  556



>gb|KDO68006.1| hypothetical protein CISIN_1g035723mg, partial [Citrus sinensis]
Length=528

 Score =   367 bits (941),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG DATL F++TAH++DPLATLFMN+FNVVETCSD  STVD YIS
Sbjct  299  DVSNEMLHFDFYEQRLGHDATLHFYETAHQSDPLATLFMNEFNVVETCSDENSTVDRYIS  358

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG+ MDGIGLE HF+ PN PL+RAILDKLATL LPIWLTE+DI+ K  +ETQA
Sbjct  359  RLRELKRGGVLMDGIGLESHFTVPNLPLMRAILDKLATLNLPIWLTEVDISGKLDKETQA  418

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAG++VD LLKEWQT  
Sbjct  419  VYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNLQNLPAGNIVDKLLKEWQTGE  478

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD HGS+SF GFLGEY VSV+YGNRTA STFSL +G+ETRH  I++
Sbjct  479  VTGHTDGHGSFSFYGFLGEYTVSVKYGNRTANSTFSLCQGDETRHVTIRV  528



>ref|XP_006486857.1| PREDICTED: uncharacterized protein LOC102613106 [Citrus sinensis]
Length=556

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG DATL F++TAH++DPLATLFMN+FNVVETCSD  STVD YIS
Sbjct  327  DVSNEMLHFDFYEQRLGHDATLHFYETAHQSDPLATLFMNEFNVVETCSDENSTVDRYIS  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG+ MDGIGLE HF+ PN PL+RAILDKLATL LPIWLTE+DI+ K  +ETQA
Sbjct  387  RLRELKRGGVLMDGIGLESHFTVPNLPLMRAILDKLATLNLPIWLTEVDISGKLDKETQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAG++VD LLKEWQT  
Sbjct  447  VYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNLQNLPAGNIVDKLLKEWQTGE  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD HGS+SF GFLGEY VSV+YGNRTA STFSL +G+ETRH  I++
Sbjct  507  VTGHTDGHGSFSFYGFLGEYTVSVKYGNRTANSTFSLCQGDETRHVTIRV  556



>ref|XP_006422632.1| hypothetical protein CICLE_v10028121mg [Citrus clementina]
 gb|ESR35872.1| hypothetical protein CICLE_v10028121mg [Citrus clementina]
Length=556

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG DATL F++TAH++DPLATLFMN+FNVVETCSD  STVD YIS
Sbjct  327  DVSNEMLHFDFYEQRLGHDATLHFYETAHQSDPLATLFMNEFNVVETCSDENSTVDRYIS  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG+ MDGIGLE HF+ PN PL+RAILDKLATL LPIWLTE+DI+ K  +ETQA
Sbjct  387  RLRELKRGGVLMDGIGLESHFTVPNLPLMRAILDKLATLNLPIWLTEVDISGKLDKETQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDNNL NLPAG++VD LLKEWQT  
Sbjct  447  VYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNNLQNLPAGNIVDKLLKEWQTGE  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD HGS+SF GFLGEY VSV+YGNRTA STFSL +G+ETRH  I++
Sbjct  507  VTGHTDGHGSFSFYGFLGEYTVSVKYGNRTANSTFSLCQGDETRHVTIRV  556



>gb|KEH36385.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=454

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            D+SNEMLHFD YEQRLGP+AT  FF+ AHE+DPLATLFMNDFNVVETCSD  S+VD YIS
Sbjct  225  DISNEMLHFDFYEQRLGPNATFHFFEAAHESDPLATLFMNDFNVVETCSDVNSSVDAYIS  284

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+Q G+ MDGIGLEGHF+ PN PLIRAILDKLATL LP+WLTEIDI+     +TQA
Sbjct  285  RIRELRQYGVFMDGIGLEGHFTIPNLPLIRAILDKLATLDLPVWLTEIDISNTLDHDTQA  344

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+ NNLP+GDVVD LL+EWQT +
Sbjct  345  IYLEQVLREGFSHPSVNGIMLWTALHPYGCYQMCLTDNDFNNLPSGDVVDKLLQEWQTSS  404

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TDEHGS+SF GFLGEY++ VEY N+T  STFSL RGEET+H  + L
Sbjct  405  VQGITDEHGSHSFYGFLGEYRIRVEYRNKTINSTFSLCRGEETKHVPVTL  454



>ref|XP_010246857.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            D+SNEMLHFD YE++LGP+ATL+FF+TAH+ADPLATLFMN+FNVVETC+D  STVD YI 
Sbjct  157  DISNEMLHFDFYEKKLGPNATLQFFQTAHQADPLATLFMNEFNVVETCADANSTVDHYIL  216

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG +M GIGLEGHF+ PN PL+RA++DKLATL LPIWLTEIDI+K   ++TQA
Sbjct  217  RLRELKKGGATMSGIGLEGHFTIPNLPLMRAVIDKLATLGLPIWLTEIDISKTIDKQTQA  276

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+LNNLPAGDVVD LL+EWQT  
Sbjct  277  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNDLNNLPAGDVVDKLLQEWQTGE  336

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G T+E GSYSF GFLGEYK+ V+Y ++   STFSL+RG+ET+HF IQL
Sbjct  337  IKGQTNEQGSYSFYGFLGEYKLYVQYEDKFINSTFSLSRGDETKHFSIQL  386



>gb|KEH36384.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=484

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            D+SNEMLHFD YEQRLGP+AT  FF+ AHE+DPLATLFMNDFNVVETCSD  S+VD YIS
Sbjct  255  DISNEMLHFDFYEQRLGPNATFHFFEAAHESDPLATLFMNDFNVVETCSDVNSSVDAYIS  314

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+Q G+ MDGIGLEGHF+ PN PLIRAILDKLATL LP+WLTEIDI+     +TQA
Sbjct  315  RIRELRQYGVFMDGIGLEGHFTIPNLPLIRAILDKLATLDLPVWLTEIDISNTLDHDTQA  374

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+ NNLP+GDVVD LL+EWQT +
Sbjct  375  IYLEQVLREGFSHPSVNGIMLWTALHPYGCYQMCLTDNDFNNLPSGDVVDKLLQEWQTSS  434

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TDEHGS+SF GFLGEY++ VEY N+T  STFSL RGEET+H  + L
Sbjct  435  VQGITDEHGSHSFYGFLGEYRIRVEYRNKTINSTFSLCRGEETKHVPVTL  484



>ref|XP_011001986.1| PREDICTED: endo-1,4-beta-xylanase F1-like isoform X4 [Populus 
euphratica]
Length=450

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGPDATL F+KTAHEADPLA+LF+N+FNVVETC+D  +TVDTYI 
Sbjct  220  DVSNEMLHFDFYEERLGPDATLHFYKTAHEADPLASLFLNEFNVVETCTDVNTTVDTYID  279

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++EL++GG SM+GIGLE HFS PN PL+RAILDKLATL+LPIWLTE+DI+ K+ +ETQA
Sbjct  280  KIRELERGGSSMNGIGLESHFSKPNLPLMRAILDKLATLKLPIWLTEVDISNKFDKETQA  339

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPK-GCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            IYLE VLRE FSHPAV GIMLWTAI P  GC+QMCLTD NL NLPAGD VD LL+EW+T 
Sbjct  340  IYLEQVLREGFSHPAVDGIMLWTAIHPNGGCYQMCLTDYNLQNLPAGDTVDKLLREWETG  399

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              +G TD+ GSYSF GFLGEYK+ V+YGNRT  ST SL++ +ET+HF IQL
Sbjct  400  QGKGRTDDQGSYSFFGFLGEYKIMVQYGNRTTNSTLSLSQSDETKHFNIQL  450



>ref|XP_004169878.1| PREDICTED: endo-1,4-beta-xylanase C-like, partial [Cucumis sativus]
Length=527

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+ LG +ATL F+KTAHE DPLATLFMN+FNVVETCSD KSTVD YI+
Sbjct  298  DVSNEMLHFDFYEKSLGANATLHFYKTAHEIDPLATLFMNEFNVVETCSDVKSTVDNYIN  357

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KELK+ G+SMDGIGLEGHF+ PNPPL+RAILDKLATL LPIWLTE+DI+   GQETQA
Sbjct  358  RLKELKRNGVSMDGIGLEGHFTIPNPPLMRAILDKLATLNLPIWLTEVDISHSLGQETQA  417

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHPAV GI+LW+A+ P GC+QMCLTD N  NLP GDVVD LLKEW+T  
Sbjct  418  SYLEVVLREGFSHPAVGGILLWSALDPNGCYQMCLTDANFKNLPTGDVVDKLLKEWKTGD  477

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +E  TD HGS+SF GFLGEY+VSV+Y NR+A STF ++ G+ET+HF IQL
Sbjct  478  IEARTDNHGSFSFYGFLGEYEVSVKYDNRSAASTFPVSVGDETKHFSIQL  527



>ref|XP_010066270.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Eucalyptus 
grandis]
Length=377

 Score =   359 bits (922),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGP+ATL FF+TAHE+DPLATLFMN+FNV+ETCSD  STVD+YIS
Sbjct  148  DVSNEMLHFDFYEQRLGPNATLHFFQTAHESDPLATLFMNEFNVLETCSDANSTVDSYIS  207

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +M+ELK+GG+SMDGIGLEGHF+ PN PL+RAILDKL TLRLP+WLTE+DI+    +E QA
Sbjct  208  RMRELKRGGVSMDGIGLEGHFTVPNLPLMRAILDKLGTLRLPMWLTEVDISSTLSKEAQA  267

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            ++LE VLRE FSHP+++GIMLWTA+ P GC+QMCLTD +  NLPAGDVVD+LL EW+T+ 
Sbjct  268  LHLEEVLREGFSHPSLNGIMLWTALHPNGCYQMCLTDADFRNLPAGDVVDSLLGEWRTKE  327

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G T+EHGSYSF GFLGEY+VSV +G++TA STF+L++G ETRH  I L
Sbjct  328  VNGKTNEHGSYSFEGFLGEYEVSVMHGDQTANSTFALSQGVETRHVTILL  377



>ref|XP_004147070.1| PREDICTED: endo-1,4-beta-xylanase C-like [Cucumis sativus]
Length=532

 Score =   365 bits (936),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+ LG +ATL F+KTAHE DPLATLFMN+FNVVETCSD KSTVD YI+
Sbjct  303  DVSNEMLHFDFYEKSLGANATLHFYKTAHEIDPLATLFMNEFNVVETCSDVKSTVDNYIN  362

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KELK+ G+SMDGIGLEGHF+ PNPPL+RAILDKLATL LPIWLTE+DI+   GQETQA
Sbjct  363  RLKELKRNGVSMDGIGLEGHFTIPNPPLMRAILDKLATLNLPIWLTEVDISHSLGQETQA  422

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHPAV GI+LW+A+ P GC+QMCLTD N  NLP GDVVD LLKEW+T  
Sbjct  423  SYLEVVLREGFSHPAVGGILLWSALDPNGCYQMCLTDANFKNLPTGDVVDKLLKEWKTGD  482

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +E  TD HGS+SF GFLGEY+VSV+Y NR+A STF ++ G+ET+HF IQL
Sbjct  483  IEARTDNHGSFSFYGFLGEYEVSVKYDNRSAASTFPVSVGDETKHFSIQL  532



>ref|XP_011001985.1| PREDICTED: endo-1,4-beta-xylanase F1-like isoform X3 [Populus 
euphratica]
Length=472

 Score =   362 bits (930),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGPDATL F+KTAHEADPLA+LF+N+FNVVETC+D  +TVDTYI 
Sbjct  242  DVSNEMLHFDFYEERLGPDATLHFYKTAHEADPLASLFLNEFNVVETCTDVNTTVDTYID  301

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++EL++GG SM+GIGLE HFS PN PL+RAILDKLATL+LPIWLTE+DI+ K+ +ETQA
Sbjct  302  KIRELERGGSSMNGIGLESHFSKPNLPLMRAILDKLATLKLPIWLTEVDISNKFDKETQA  361

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPK-GCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            IYLE VLRE FSHPAV GIMLWTAI P  GC+QMCLTD NL NLPAGD VD LL+EW+T 
Sbjct  362  IYLEQVLREGFSHPAVDGIMLWTAIHPNGGCYQMCLTDYNLQNLPAGDTVDKLLREWETG  421

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              +G TD+ GSYSF GFLGEYK+ V+YGNRT  ST SL++ +ET+HF IQL
Sbjct  422  QGKGRTDDQGSYSFFGFLGEYKIMVQYGNRTTNSTLSLSQSDETKHFNIQL  472



>ref|XP_006359674.1| PREDICTED: probable endo-1,4-beta-xylanase C-like isoform X1 
[Solanum tuberosum]
 ref|XP_006359675.1| PREDICTED: probable endo-1,4-beta-xylanase C-like isoform X2 
[Solanum tuberosum]
Length=500

 Score =   363 bits (933),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 194/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLG + +LEFF+TA + DPLA LFMND+NVVETC D  STVD YIS
Sbjct  271  DVDNEMLHYDFYEQRLGTNTSLEFFQTAQQLDPLAKLFMNDYNVVETCYDMNSTVDAYIS  330

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+++LKQGGI MDGIGLEGHF+ PNPPLIRA+LDKLATL+LPIWLTE+DI+K   +ETQA
Sbjct  331  KLRDLKQGGIIMDGIGLEGHFTVPNPPLIRAVLDKLATLKLPIWLTEVDISKNLDKETQA  390

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP V+GIMLWT +   GC+QMCLTDNN +NLPAGD+VDNLLKEWQT  
Sbjct  391  KYLEMVLREGFSHPGVNGIMLWTGLHSNGCYQMCLTDNNFHNLPAGDIVDNLLKEWQTGV  450

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGS+SF  FLGEYK++V++GNRT  STFSL RG++TRH  IQL
Sbjct  451  VHGETDEHGSFSFSVFLGEYKINVKFGNRTVNSTFSLYRGDDTRHINIQL  500



>ref|XP_002306176.2| hypothetical protein POPTR_0004s17900g [Populus trichocarpa]
 gb|EEE86687.2| hypothetical protein POPTR_0004s17900g [Populus trichocarpa]
Length=543

 Score =   365 bits (936),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGPDATL F+KTAHEADPLA+LF+N+FNVVETC+D  +TVDTYI 
Sbjct  313  DVSNEMLHFDFYEERLGPDATLHFYKTAHEADPLASLFLNEFNVVETCTDVSTTVDTYID  372

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++EL++GG SM+GIGLE HFS PN PL+RAILDKLATL+LPIWLTE+DI+ K+ +ETQA
Sbjct  373  KIRELERGGSSMNGIGLESHFSKPNLPLMRAILDKLATLKLPIWLTEVDISNKFDKETQA  432

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPK-GCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            IYLE VLRE FSHPAV GIMLWTAI P  GC+QMCLTD NL NLPAGD VD LL+EW+T 
Sbjct  433  IYLEQVLREGFSHPAVDGIMLWTAIHPNGGCYQMCLTDYNLQNLPAGDTVDKLLREWETG  492

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G TD+HGSYSF GFLGEYK+ V+YGNRT  ST SL++ +ET+HF IQL
Sbjct  493  EGNGRTDDHGSYSFFGFLGEYKIMVQYGNRTTNSTLSLSQSDETKHFNIQL  543



>gb|KGN61918.1| hypothetical protein Csa_2G264620 [Cucumis sativus]
Length=556

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+ LG +ATL F+KTAHE DPLATLFMN+FNVVETCSD KSTVD YI+
Sbjct  327  DVSNEMLHFDFYEKSLGANATLHFYKTAHEIDPLATLFMNEFNVVETCSDVKSTVDNYIN  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KELK+ G+SMDGIGLEGHF+ PNPPL+RAILDKLATL LPIWLTE+DI+   GQETQA
Sbjct  387  RLKELKRNGVSMDGIGLEGHFTIPNPPLMRAILDKLATLNLPIWLTEVDISHSLGQETQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHPAV GI+LW+A+ P GC+QMCLTD N  NLP GDVVD LLKEW+T  
Sbjct  447  SYLEVVLREGFSHPAVGGILLWSALDPNGCYQMCLTDANFKNLPTGDVVDKLLKEWKTGD  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +E  TD HGS+SF GFLGEY+VSV+Y NR+A STF ++ G+ET+HF IQL
Sbjct  507  IEARTDNHGSFSFYGFLGEYEVSVKYDNRSAASTFPVSVGDETKHFSIQL  556



>gb|AES74285.2| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=535

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            D+SNEMLHFD YEQRLGP+AT  FF+ AHE+DPLATLFMNDFNVVETCSD  S+VD YIS
Sbjct  306  DISNEMLHFDFYEQRLGPNATFHFFEAAHESDPLATLFMNDFNVVETCSDVNSSVDAYIS  365

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+Q G+ MDGIGLEGHF+ PN PLIRAILDKLATL LP+WLTEIDI+     +TQA
Sbjct  366  RIRELRQYGVFMDGIGLEGHFTIPNLPLIRAILDKLATLDLPVWLTEIDISNTLDHDTQA  425

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+ NNLP+GDVVD LL+EWQT +
Sbjct  426  IYLEQVLREGFSHPSVNGIMLWTALHPYGCYQMCLTDNDFNNLPSGDVVDKLLQEWQTSS  485

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TDEHGS+SF GFLGEY++ VEY N+T  STFSL RGEET+H  + L
Sbjct  486  VQGITDEHGSHSFYGFLGEYRIRVEYRNKTINSTFSLCRGEETKHVPVTL  535



>ref|XP_003604034.1| Endo-1,4-beta-xylanase A [Medicago truncatula]
Length=536

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            D+SNEMLHFD YEQRLGP+AT  FF+ AHE+DPLATLFMNDFNVVETCSD  S+VD YIS
Sbjct  307  DISNEMLHFDFYEQRLGPNATFHFFEAAHESDPLATLFMNDFNVVETCSDVNSSVDAYIS  366

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL+Q G+ MDGIGLEGHF+ PN PLIRAILDKLATL LP+WLTEIDI+     +TQA
Sbjct  367  RIRELRQYGVFMDGIGLEGHFTIPNLPLIRAILDKLATLDLPVWLTEIDISNTLDHDTQA  426

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+ NNLP+GDVVD LL+EWQT +
Sbjct  427  IYLEQVLREGFSHPSVNGIMLWTALHPYGCYQMCLTDNDFNNLPSGDVVDKLLQEWQTSS  486

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TDEHGS+SF GFLGEY++ VEY N+T  STFSL RGEET+H  + L
Sbjct  487  VQGITDEHGSHSFYGFLGEYRIRVEYRNKTINSTFSLCRGEETKHVPVTL  536



>ref|XP_007137357.1| hypothetical protein PHAVU_009G120500g [Phaseolus vulgaris]
 gb|ESW09351.1| hypothetical protein PHAVU_009G120500g [Phaseolus vulgaris]
Length=559

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 194/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHF+ YEQRLG DATL FF+TAHE+DPL+TLFMNDFNVVETCSD  STVD YIS
Sbjct  330  DVSNEMLHFEFYEQRLGSDATLHFFETAHESDPLSTLFMNDFNVVETCSDVNSTVDAYIS  389

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ GI MDGIGLEGHF+ PNPPLIRAILDKLATL LPIWLTE+DI+K   +++QA
Sbjct  390  RVRELQRNGIFMDGIGLEGHFTVPNPPLIRAILDKLATLGLPIWLTEVDISKTIDRDSQA  449

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP+V+GIMLWTA  P GC+QMCLTDNN NNLPAGD VD +L+EWQT  
Sbjct  450  KYLEEVLREGFSHPSVNGIMLWTAYHPNGCYQMCLTDNNFNNLPAGDTVDKVLQEWQTGR  509

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG  D HGSYSF GFLGEY ++V YGNRT  STFSL+  +ETRHF I L
Sbjct  510  VEGVADVHGSYSFYGFLGEYSITVNYGNRTTHSTFSLSPAQETRHFTITL  559



>ref|XP_011013611.1| PREDICTED: endo-1,4-beta-xylanase A-like [Populus euphratica]
Length=563

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGPDATL F+KTAHEADPLA+LF+N+FNVVETC+D  +TVDTYI 
Sbjct  333  DVSNEMLHFDFYEERLGPDATLHFYKTAHEADPLASLFLNEFNVVETCTDVNTTVDTYID  392

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++EL++GG SM+GIGLE HFS PN PL+RAILDKLATL+LPIWLTE+DI+ K+ +ETQA
Sbjct  393  KIRELERGGSSMNGIGLESHFSKPNLPLVRAILDKLATLKLPIWLTEVDISNKFDKETQA  452

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPK-GCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE FSHPAV GIMLWTAI P  GC+QMCLTD NL NLPAGD VD LL+EW+T 
Sbjct  453  TYLEQVLREGFSHPAVDGIMLWTAIHPNGGCYQMCLTDYNLQNLPAGDTVDKLLREWETG  512

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              +G TD+HGSYSF GFLGEYK+ V+YGNRT  ST SL++ +ET+HF IQL
Sbjct  513  QGKGRTDDHGSYSFFGFLGEYKIMVQYGNRTTNSTLSLSQSDETKHFNIQL  563



>ref|XP_011001984.1| PREDICTED: endo-1,4-beta-xylanase A-like isoform X2 [Populus 
euphratica]
Length=560

 Score =   363 bits (931),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGPDATL F+KTAHEADPLA+LF+N+FNVVETC+D  +TVDTYI 
Sbjct  330  DVSNEMLHFDFYEERLGPDATLHFYKTAHEADPLASLFLNEFNVVETCTDVNTTVDTYID  389

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++EL++GG SM+GIGLE HFS PN PL+RAILDKLATL+LPIWLTE+DI+ K+ +ETQA
Sbjct  390  KIRELERGGSSMNGIGLESHFSKPNLPLMRAILDKLATLKLPIWLTEVDISNKFDKETQA  449

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPK-GCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            IYLE VLRE FSHPAV GIMLWTAI P  GC+QMCLTD NL NLPAGD VD LL+EW+T 
Sbjct  450  IYLEQVLREGFSHPAVDGIMLWTAIHPNGGCYQMCLTDYNLQNLPAGDTVDKLLREWETG  509

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              +G TD+ GSYSF GFLGEYK+ V+YGNRT  ST SL++ +ET+HF IQL
Sbjct  510  QGKGRTDDQGSYSFFGFLGEYKIMVQYGNRTTNSTLSLSQSDETKHFNIQL  560



>ref|XP_011001983.1| PREDICTED: endo-1,4-beta-xylanase A-like isoform X1 [Populus 
euphratica]
Length=563

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLGPDATL F+KTAHEADPLA+LF+N+FNVVETC+D  +TVDTYI 
Sbjct  333  DVSNEMLHFDFYEERLGPDATLHFYKTAHEADPLASLFLNEFNVVETCTDVNTTVDTYID  392

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++EL++GG SM+GIGLE HFS PN PL+RAILDKLATL+LPIWLTE+DI+ K+ +ETQA
Sbjct  393  KIRELERGGSSMNGIGLESHFSKPNLPLMRAILDKLATLKLPIWLTEVDISNKFDKETQA  452

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPK-GCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            IYLE VLRE FSHPAV GIMLWTAI P  GC+QMCLTD NL NLPAGD VD LL+EW+T 
Sbjct  453  IYLEQVLREGFSHPAVDGIMLWTAIHPNGGCYQMCLTDYNLQNLPAGDTVDKLLREWETG  512

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              +G TD+ GSYSF GFLGEYK+ V+YGNRT  ST SL++ +ET+HF IQL
Sbjct  513  QGKGRTDDQGSYSFFGFLGEYKIMVQYGNRTTNSTLSLSQSDETKHFNIQL  563



>ref|XP_010315368.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315369.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315370.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
Length=500

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLG + +LEFF+TA + DPLA LFMND+NVVETC D  STVD YIS
Sbjct  271  DVDNEMLHYDFYEQRLGINTSLEFFQTAQQLDPLAKLFMNDYNVVETCYDMNSTVDAYIS  330

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+++LKQGGI MDGIGLEGHF+ PNPPLIRA+LDKLATL+LPIWLTE+DI+K   +ETQA
Sbjct  331  KLRDLKQGGIFMDGIGLEGHFTVPNPPLIRAVLDKLATLKLPIWLTEVDISKNLDKETQA  390

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP V+GIMLWT +   GC+QMCLTDN+ +NLPAGD+VDNLLKEWQT  
Sbjct  391  RYLEMVLREGFSHPGVNGIMLWTGLHSNGCYQMCLTDNDFHNLPAGDIVDNLLKEWQTGV  450

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGS+SF GFLGEYK++V+ GNRT  STFSL RG++TRH  I L
Sbjct  451  VHGETDEHGSFSFSGFLGEYKINVKSGNRTTNSTFSLYRGDDTRHLNIHL  500



>ref|XP_010315367.1| PREDICTED: endo-1,4-beta-xylanase UM03411 isoform X2 [Solanum 
lycopersicum]
Length=533

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLG + +LEFF+TA + DPLA LFMND+NVVETC D  STVD YIS
Sbjct  304  DVDNEMLHYDFYEQRLGINTSLEFFQTAQQLDPLAKLFMNDYNVVETCYDMNSTVDAYIS  363

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+++LKQGGI MDGIGLEGHF+ PNPPLIRA+LDKLATL+LPIWLTE+DI+K   +ETQA
Sbjct  364  KLRDLKQGGIFMDGIGLEGHFTVPNPPLIRAVLDKLATLKLPIWLTEVDISKNLDKETQA  423

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP V+GIMLWT +   GC+QMCLTDN+ +NLPAGD+VDNLLKEWQT  
Sbjct  424  RYLEMVLREGFSHPGVNGIMLWTGLHSNGCYQMCLTDNDFHNLPAGDIVDNLLKEWQTGV  483

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGS+SF GFLGEYK++V+ GNRT  STFSL RG++TRH  I L
Sbjct  484  VHGETDEHGSFSFSGFLGEYKINVKSGNRTTNSTFSLYRGDDTRHLNIHL  533



>ref|XP_004231450.1| PREDICTED: endo-1,4-beta-xylanase UM03411 isoform X1 [Solanum 
lycopersicum]
Length=550

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLG + +LEFF+TA + DPLA LFMND+NVVETC D  STVD YIS
Sbjct  321  DVDNEMLHYDFYEQRLGINTSLEFFQTAQQLDPLAKLFMNDYNVVETCYDMNSTVDAYIS  380

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+++LKQGGI MDGIGLEGHF+ PNPPLIRA+LDKLATL+LPIWLTE+DI+K   +ETQA
Sbjct  381  KLRDLKQGGIFMDGIGLEGHFTVPNPPLIRAVLDKLATLKLPIWLTEVDISKNLDKETQA  440

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP V+GIMLWT +   GC+QMCLTDN+ +NLPAGD+VDNLLKEWQT  
Sbjct  441  RYLEMVLREGFSHPGVNGIMLWTGLHSNGCYQMCLTDNDFHNLPAGDIVDNLLKEWQTGV  500

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TDEHGS+SF GFLGEYK++V+ GNRT  STFSL RG++TRH  I L
Sbjct  501  VHGETDEHGSFSFSGFLGEYKINVKSGNRTTNSTFSLYRGDDTRHLNIHL  550



>gb|EYU40424.1| hypothetical protein MIMGU_mgv1a020606mg, partial [Erythranthe 
guttata]
Length=520

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 192/230 (83%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLH+D YE+ LGP+ATL FF +AH ADPLATLFMN+FNVVETC D  STVDTY+S
Sbjct  291  DVSNEMLHYDFYEKNLGPNATLRFFGSAHRADPLATLFMNEFNVVETCMDADSTVDTYVS  350

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +M+ELK GG+SMDGIGL+GHF  PN PL+R +LDKLATL LPIWLTE+DI+ K+ +ETQA
Sbjct  351  RMRELKMGGVSMDGIGLQGHFDVPNSPLMRGVLDKLATLGLPIWLTEVDISNKFNKETQA  410

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GI+LWTA+   GC+QMCLTD + NNLPAG+ VDNLLKEW T  
Sbjct  411  IYLEEVLREGFSHPAVDGIILWTALRRGGCYQMCLTDGDFNNLPAGETVDNLLKEWDTGI  470

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L G TDEHGSY+F GFLGEYKV+ +YGN T  STFSL RG+ET+ F IQ+
Sbjct  471  LNGQTDEHGSYTFFGFLGEYKVTAKYGNATFDSTFSLPRGKETKQFNIQM  520



>ref|XP_010066269.1| PREDICTED: uncharacterized protein LOC104453421 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64117.1| hypothetical protein EUGRSUZ_G01773 [Eucalyptus grandis]
Length=549

 Score =   360 bits (923),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLGP+ATL FF+TAHE+DPLATLFMN+FNV+ETCSD  STVD+YIS
Sbjct  320  DVSNEMLHFDFYEQRLGPNATLHFFQTAHESDPLATLFMNEFNVLETCSDANSTVDSYIS  379

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +M+ELK+GG+SMDGIGLEGHF+ PN PL+RAILDKL TLRLP+WLTE+DI+    +E QA
Sbjct  380  RMRELKRGGVSMDGIGLEGHFTVPNLPLMRAILDKLGTLRLPMWLTEVDISSTLSKEAQA  439

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            ++LE VLRE FSHP+++GIMLWTA+ P GC+QMCLTD +  NLPAGDVVD+LL EW+T+ 
Sbjct  440  LHLEEVLREGFSHPSLNGIMLWTALHPNGCYQMCLTDADFRNLPAGDVVDSLLGEWRTKE  499

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G T+EHGSYSF GFLGEY+VSV +G++TA STF+L++G ETRH  I L
Sbjct  500  VNGKTNEHGSYSFEGFLGEYEVSVMHGDQTANSTFALSQGVETRHVTILL  549



>ref|XP_010690393.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHFD YEQRLGP ATLEFFKTAH+ADPLATLFMN+FNVVETC+D  STVD Y+ 
Sbjct  233  DVNNEMLHFDFYEQRLGPHATLEFFKTAHQADPLATLFMNEFNVVETCNDANSTVDDYVR  292

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG++MDGIGLEGHF+ PNPP IR +LDKLATL LPIWLTEIDI++   ++TQA
Sbjct  293  RLRELKEGGVTMDGIGLEGHFTVPNPPFIRGVLDKLATLGLPIWLTEIDISQTIDKQTQA  352

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE V+RE FSHP+V G+MLWTA+ PKGC+QMCLTDNN NNLPAGD VD LL+EWQT+ 
Sbjct  353  VYLEQVMREGFSHPSVKGLMLWTALDPKGCYQMCLTDNNFNNLPAGDTVDKLLEEWQTRR  412

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TD+ GS+SF GFLGEY + V++GN+T   + SL+ G ETR   +QL
Sbjct  413  VEGVTDQLGSFSFHGFLGEYTIMVKHGNKTKNLSLSLSGGHETRFVNLQL  462



>ref|XP_010246856.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            D+SNEMLHFD YE++LGP+ATL+FF+TAH+ADPLATLFMN+FNVVETC+D  STVD YI 
Sbjct  328  DISNEMLHFDFYEKKLGPNATLQFFQTAHQADPLATLFMNEFNVVETCADANSTVDHYIL  387

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG +M GIGLEGHF+ PN PL+RA++DKLATL LPIWLTEIDI+K   ++TQA
Sbjct  388  RLRELKKGGATMSGIGLEGHFTIPNLPLMRAVIDKLATLGLPIWLTEIDISKTIDKQTQA  447

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTDN+LNNLPAGDVVD LL+EWQT  
Sbjct  448  IYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDNDLNNLPAGDVVDKLLQEWQTGE  507

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G T+E GSYSF GFLGEYK+ V+Y ++   STFSL+RG+ET+HF IQL
Sbjct  508  IKGQTNEQGSYSFYGFLGEYKLYVQYEDKFINSTFSLSRGDETKHFSIQL  557



>ref|XP_011088588.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Sesamum 
indicum]
Length=500

 Score =   356 bits (913),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLGP+A+LEFF+TA ++DPLA LFMN++NV+ETC D  STVD Y+S
Sbjct  271  DVDNEMLHWDFYEQRLGPNASLEFFQTAQKSDPLARLFMNEYNVLETCDDMNSTVDHYVS  330

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL +GG+SMDGIGLEGHF+ PNPPLIRAILDKLATL+LPIWLTE+DI+    QETQA
Sbjct  331  RLQELGEGGVSMDGIGLEGHFTVPNPPLIRAILDKLATLKLPIWLTEVDISNSLDQETQA  390

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP++ GIMLWTA+ P GC++MCLTDN L+NLPAGDVVD+LLKEW+T  
Sbjct  391  KYLEVVLREGFSHPSIKGIMLWTALHPSGCYRMCLTDNKLHNLPAGDVVDSLLKEWETGV  450

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TD+HG++ F GFLGEY+V+V YGNRT  STFSL + +ET+H+ I L
Sbjct  451  VKGETDDHGAFDFSGFLGEYRVTVNYGNRTTNSTFSLCQDDETKHWNIHL  500



>gb|KDO68005.1| hypothetical protein CISIN_1g036715mg [Citrus sinensis]
Length=362

 Score =   350 bits (899),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 192/230 (83%), Gaps = 4/230 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNE+LHFD YEQRLGP A L FF+TAH++DPLATLFMN++NVVETCSD  S VD+YIS
Sbjct  137  DVSNEILHFDFYEQRLGPKAALHFFQTAHQSDPLATLFMNEYNVVETCSDVNSMVDSYIS  196

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ G+S DGIGL+GHF+ PN PL+RAI+DK+ TL+LPIWLTE+DI+ K  +E QA
Sbjct  197  RLRELRRSGVSTDGIGLQGHFTVPNLPLMRAIIDKMTTLKLPIWLTEVDISSKLSKEKQA  256

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+VSGIMLW A+ P GC+QMCLTDNNL NLPAGDVVD LLKE QT  
Sbjct  257  VYLEQVLREGFSHPSVSGIMLWAALHPNGCYQMCLTDNNLQNLPAGDVVDKLLKECQTGE  316

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD HGSYSF GFL    VSV+YGNRTA STFSL RG+ETRH  I+L
Sbjct  317  VTGHTDAHGSYSFYGFL----VSVKYGNRTANSTFSLCRGDETRHVTIRL  362



>ref|XP_010690392.1| PREDICTED: endo-1,4-beta-xylanase 5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHFD YEQRLGP ATLEFFKTAH+ADPLATLFMN+FNVVETC+D  STVD Y+ 
Sbjct  313  DVNNEMLHFDFYEQRLGPHATLEFFKTAHQADPLATLFMNEFNVVETCNDANSTVDDYVR  372

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK+GG++MDGIGLEGHF+ PNPP IR +LDKLATL LPIWLTEIDI++   ++TQA
Sbjct  373  RLRELKEGGVTMDGIGLEGHFTVPNPPFIRGVLDKLATLGLPIWLTEIDISQTIDKQTQA  432

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE V+RE FSHP+V G+MLWTA+ PKGC+QMCLTDNN NNLPAGD VD LL+EWQT+ 
Sbjct  433  VYLEQVMREGFSHPSVKGLMLWTALDPKGCYQMCLTDNNFNNLPAGDTVDKLLEEWQTRR  492

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            +EG TD+ GS+SF GFLGEY + V++GN+T   + SL+ G ETR   +QL
Sbjct  493  VEGVTDQLGSFSFHGFLGEYTIMVKHGNKTKNLSLSLSGGHETRFVNLQL  542



>emb|CDO96931.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   358 bits (919),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG +ATL FF+TAH++DPLATLF+N+FNVVETC D  STVDTYIS
Sbjct  427  DVSNEMLHFDFYEQRLGRNATLSFFETAHKSDPLATLFLNEFNVVETCDDVNSTVDTYIS  486

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++ELK GG++M GIGLEGHF+ PN PL+RAILDKLATL LPIWLTE+DI+K   +ETQ 
Sbjct  487  RLRELKLGGVTMGGIGLEGHFTVPNLPLMRAILDKLATLGLPIWLTEVDISKTLTKETQG  546

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V GIM+WTA+ P GC+QMCLTDN  +NLPAGDVVD LL+EWQT T
Sbjct  547  LYLEEVLREGFSHPSVKGIMMWTALHPYGCYQMCLTDNEFHNLPAGDVVDKLLREWQTGT  606

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            LEG TD  GS+SF GFLGEYKV+  YG+++  S+FSL++G+ETRHF IQ+
Sbjct  607  LEGHTDGQGSFSFHGFLGEYKVTARYGDKSVNSSFSLSQGDETRHFNIQI  656



>ref|XP_011088587.1| PREDICTED: uncharacterized protein LOC105169775 isoform X2 [Sesamum 
indicum]
Length=556

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLGP+A+LEFF+TA ++DPLA LFMN++NV+ETC D  STVD Y+S
Sbjct  327  DVDNEMLHWDFYEQRLGPNASLEFFQTAQKSDPLARLFMNEYNVLETCDDMNSTVDHYVS  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL +GG+SMDGIGLEGHF+ PNPPLIRAILDKLATL+LPIWLTE+DI+    QETQA
Sbjct  387  RLQELGEGGVSMDGIGLEGHFTVPNPPLIRAILDKLATLKLPIWLTEVDISNSLDQETQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP++ GIMLWTA+ P GC++MCLTDN L+NLPAGDVVD+LLKEW+T  
Sbjct  447  KYLEVVLREGFSHPSIKGIMLWTALHPSGCYRMCLTDNKLHNLPAGDVVDSLLKEWETGV  506

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TD+HG++ F GFLGEY+V+V YGNRT  STFSL + +ET+H+ I L
Sbjct  507  VKGETDDHGAFDFSGFLGEYRVTVNYGNRTTNSTFSLCQDDETKHWNIHL  556



>ref|XP_011088586.1| PREDICTED: uncharacterized protein LOC105169775 isoform X1 [Sesamum 
indicum]
Length=558

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLGP+A+LEFF+TA ++DPLA LFMN++NV+ETC D  STVD Y+S
Sbjct  329  DVDNEMLHWDFYEQRLGPNASLEFFQTAQKSDPLARLFMNEYNVLETCDDMNSTVDHYVS  388

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL +GG+SMDGIGLEGHF+ PNPPLIRAILDKLATL+LPIWLTE+DI+    QETQA
Sbjct  389  RLQELGEGGVSMDGIGLEGHFTVPNPPLIRAILDKLATLKLPIWLTEVDISNSLDQETQA  448

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP++ GIMLWTA+ P GC++MCLTDN L+NLPAGDVVD+LLKEW+T  
Sbjct  449  KYLEVVLREGFSHPSIKGIMLWTALHPSGCYRMCLTDNKLHNLPAGDVVDSLLKEWETGV  508

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G TD+HG++ F GFLGEY+V+V YGNRT  STFSL + +ET+H+ I L
Sbjct  509  VKGETDDHGAFDFSGFLGEYRVTVNYGNRTTNSTFSLCQDDETKHWNIHL  558



>ref|XP_010920164.1| PREDICTED: uncharacterized protein LOC105044067 [Elaeis guineensis]
Length=560

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG +ATL+FF TA  +DPLATLFMNDFNV+ETC D  STVD+Y S
Sbjct  331  DVSNEMLHFDFYEQRLGYNATLDFFATAQNSDPLATLFMNDFNVIETCDDVNSTVDSYAS  390

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++K+LK+GG  ++G+GLEGHFS PN PL+RA+LDKLATL+LPIWLTEIDI+  + Q+TQA
Sbjct  391  RLKDLKEGGAILEGVGLEGHFSKPNIPLMRAVLDKLATLKLPIWLTEIDISNYFDQKTQA  450

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHP+V+GIMLWTAI P GC+QMCLTD N  NLPAGDVVD LL+EW+T+ 
Sbjct  451  IYLEEVLREGFSHPSVNGIMLWTAIHPYGCYQMCLTDGNFRNLPAGDVVDGLLQEWETKQ  510

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G T+E GSYSF GFLGEYKVSV +GN++  +T SL RG+ET+H  IQL
Sbjct  511  AGGATNERGSYSFFGFLGEYKVSVSFGNKSTETTLSLTRGDETKHLNIQL  560



>ref|NP_001049529.1| Os03g0243700 [Oryza sativa Japonica Group]
 dbj|BAF11443.1| Os03g0243700 [Oryza sativa Japonica Group]
Length=401

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLG +A++EFF  A +ADPLATLFMN+FNV+ETC D  STVDTY++
Sbjct  172  DVNNEMLHYNFYEQRLGANASVEFFSVAQDADPLATLFMNEFNVIETCDDVSSTVDTYVA  231

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+ GG  ++GIGLEGHF  PN PL+RA+LDKLATL LPIW TEIDI+ +Y  +TQA
Sbjct  232  KLKDLRAGGAVLEGIGLEGHFLKPNIPLMRAVLDKLATLGLPIWFTEIDISNRYDAQTQA  291

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAV+G+MLWTA+ P GC+QMCLTD NLNNLP GDVVD LL+EWQT  
Sbjct  292  VYLEQVLREAYSHPAVTGVMLWTALHPNGCYQMCLTDWNLNNLPVGDVVDRLLQEWQTGQ  351

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF GFLGEY VSV Y N T+ +TFSL+ G+ETRH  IQ+
Sbjct  352  AAGPTDAHGAYSFSGFLGEYIVSVTYANSTSQATFSLSPGDETRHINIQI  401



>ref|XP_008788407.1| PREDICTED: endo-1,4-beta-xylanase A-like [Phoenix dactylifera]
Length=553

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG +AT +FF TA ++DP ATLFMNDFNV+ETC D  STVD+Y S
Sbjct  324  DVSNEMLHFDFYEQRLGYNATFDFFATAQQSDPYATLFMNDFNVIETCDDVNSTVDSYAS  383

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KE+K+GG  ++GIGLEGHFS PN PL+RA+LDKLATL+LPIWLTEIDI+  + Q+TQA
Sbjct  384  RLKEIKEGGGVLEGIGLEGHFSKPNFPLMRAVLDKLATLKLPIWLTEIDISNSFDQQTQA  443

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP+V+GIMLWTAI P GC+QMCLTD N +NLPAGD VD LL+EW+T+ 
Sbjct  444  TYLEEVLREGFSHPSVNGIMLWTAIHPYGCYQMCLTDGNFHNLPAGDAVDGLLQEWETKE  503

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TDE GSYSF+GFLGEYKVSV YGN++  +T  L  G+ET+H  IQL
Sbjct  504  ARGATDERGSYSFIGFLGEYKVSVSYGNKSTETTLPLTPGDETKHLNIQL  553



>gb|ABF94922.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=470

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLG +A++EFF  A +ADPLATLFMN+FNV+ETC D  STVDTY++
Sbjct  241  DVNNEMLHYNFYEQRLGANASVEFFSVAQDADPLATLFMNEFNVIETCDDVSSTVDTYVA  300

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+ GG  ++GIGLEGHF  PN PL+RA+LDKLATL LPIW TEIDI+ +Y  +TQA
Sbjct  301  KLKDLRAGGAVLEGIGLEGHFLKPNIPLMRAVLDKLATLGLPIWFTEIDISNRYDAQTQA  360

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAV+G+MLWTA+ P GC+QMCLTD NLNNLP GDVVD LL+EWQT  
Sbjct  361  VYLEQVLREAYSHPAVTGVMLWTALHPNGCYQMCLTDWNLNNLPVGDVVDRLLQEWQTGQ  420

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF GFLGEY VSV Y N T+ +TFSL+ G+ETRH  IQ+
Sbjct  421  AAGPTDAHGAYSFSGFLGEYIVSVTYANSTSQATFSLSPGDETRHINIQI  470



>tpg|DAA44350.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=470

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 188/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLGP+A+ EFF  A +ADPLATLFMN++NV+ETC DP STVDTY+S
Sbjct  241  DVNNEMLHYNFYEQRLGPNASAEFFSVAQDADPLATLFMNEYNVIETCDDPFSTVDTYVS  300

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+  G  ++GIGLEGHFS PN PL+RAILDKLATL LPIW TEIDI+ K+  +TQA
Sbjct  301  KLKDLRSAGAILEGIGLEGHFSKPNIPLMRAILDKLATLGLPIWFTEIDISNKFDAQTQA  360

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE +SHPAVSG+MLWTA+ P GC+QMCLTD NL+NLP GDVVD LL EW+T  
Sbjct  361  AYLEQVLREAYSHPAVSGVMLWTALHPSGCYQMCLTDWNLSNLPTGDVVDRLLNEWRTLQ  420

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF G+LGEY ++V Y NRT  STFSL+ G+ETRH  +Q+
Sbjct  421  AAGQTDAHGAYSFTGYLGEYVLTVSYNNRTTQSTFSLSPGDETRHINVQM  470



>ref|XP_009761415.1| PREDICTED: uncharacterized protein LOC104213578 isoform X3 [Nicotiana 
sylvestris]
Length=516

 Score =   346 bits (887),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  288  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  346

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  347  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  406

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLWTAI    C++MCLTD +LNNLP GDVVD LLKEW+T  
Sbjct  407  IYLEQVLREAFSHPAVDGIMLWTAIRRNKCYRMCLTDPDLNNLPTGDVVDKLLKEWETGV  466

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G TD  GSYSF GFLG+YKV+  YG +   + FSL+R EET+HF IQL
Sbjct  467  LKGQTDARGSYSFYGFLGDYKVTASYGGKVVDAAFSLSRSEETKHFSIQL  516



>ref|XP_009761414.1| PREDICTED: uncharacterized protein LOC104213578 isoform X2 [Nicotiana 
sylvestris]
Length=530

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  302  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  360

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  361  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  420

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLWTAI    C++MCLTD +LNNLP GDVVD LLKEW+T  
Sbjct  421  IYLEQVLREAFSHPAVDGIMLWTAIRRNKCYRMCLTDPDLNNLPTGDVVDKLLKEWETGV  480

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G TD  GSYSF GFLG+YKV+  YG +   + FSL+R EET+HF IQL
Sbjct  481  LKGQTDARGSYSFYGFLGDYKVTASYGGKVVDAAFSLSRSEETKHFSIQL  530



>ref|XP_010934099.1| PREDICTED: endo-1,4-beta-xylanase-like [Elaeis guineensis]
Length=564

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHF+ YEQRLGP+A+LEFF TA +ADPLATLFMN+FNV+ETC+D  STVD+YIS
Sbjct  334  DVNNEMLHFNFYEQRLGPNASLEFFDTAQQADPLATLFMNEFNVLETCADANSTVDSYIS  393

Query  578  KMKELKQGGISMDGIGLEGHF-SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++ELK+GG+ ++GIGLEGHF + PN PL+RA+LDKLATL LPIWLTE+DIN  +  +TQ
Sbjct  394  RLRELKEGGVVLEGIGLEGHFFTHPNLPLMRAVLDKLATLELPIWLTEVDINHMFDHQTQ  453

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FS+P+V+GIMLWTA+ P GC++MCLTD + +NLP+GDVVD LL+EW+T+
Sbjct  454  AIYLEEVLREGFSYPSVNGIMLWTALHPYGCYEMCLTDGDFHNLPSGDVVDRLLQEWETK  513

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G TD+HG YSF GFLGEYKVSV Y N++  +TFSL++G+ETRH  IQL
Sbjct  514  ETGGATDDHGLYSFSGFLGEYKVSVSYANKSTETTFSLDKGDETRHLNIQL  564



>ref|XP_009761411.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009761412.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009761413.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  329  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  387

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  388  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  447

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLWTAI    C++MCLTD +LNNLP GDVVD LLKEW+T  
Sbjct  448  IYLEQVLREAFSHPAVDGIMLWTAIRRNKCYRMCLTDPDLNNLPTGDVVDKLLKEWETGV  507

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G TD  GSYSF GFLG+YKV+  YG +   + FSL+R EET+HF IQL
Sbjct  508  LKGQTDARGSYSFYGFLGDYKVTASYGGKVVDAAFSLSRSEETKHFSIQL  557



>ref|XP_004985034.1| PREDICTED: uncharacterized protein LOC101776078 [Setaria italica]
Length=560

 Score =   345 bits (884),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLGP+A++EFF  A +ADPLATLFMN++NV+ETC DP STVDTY++
Sbjct  331  DVNNEMLHYNFYEQRLGPNASMEFFSVAQDADPLATLFMNEYNVIETCDDPFSTVDTYVA  390

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+KEL+ GG  ++GIGLEGHFS PN PL+RAILDKLATL LPIW TEIDI+ K+  +TQA
Sbjct  391  KLKELRAGGAILEGIGLEGHFSKPNIPLMRAILDKLATLGLPIWFTEIDISNKFDAQTQA  450

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE V+RE +SHPAVSG+MLWTA+   GC+QMCLTD NLNNLP GDVVD LL EW+T  
Sbjct  451  AYLEQVMREAYSHPAVSGVMLWTALHQSGCYQMCLTDWNLNNLPTGDVVDRLLNEWRTLQ  510

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF G+LGEY ++V Y NRT  STFSL+ G+ETRH  +Q+
Sbjct  511  AGGQTDAHGAYSFSGYLGEYTLTVSYNNRTTQSTFSLSPGDETRHINVQM  560



>gb|ABF94921.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=558

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLG +A++EFF  A +ADPLATLFMN+FNV+ETC D  STVDTY++
Sbjct  329  DVNNEMLHYNFYEQRLGANASVEFFSVAQDADPLATLFMNEFNVIETCDDVSSTVDTYVA  388

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+ GG  ++GIGLEGHF  PN PL+RA+LDKLATL LPIW TEIDI+ +Y  +TQA
Sbjct  389  KLKDLRAGGAVLEGIGLEGHFLKPNIPLMRAVLDKLATLGLPIWFTEIDISNRYDAQTQA  448

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAV+G+MLWTA+ P GC+QMCLTD NLNNLP GDVVD LL+EWQT  
Sbjct  449  VYLEQVLREAYSHPAVTGVMLWTALHPNGCYQMCLTDWNLNNLPVGDVVDRLLQEWQTGQ  508

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF GFLGEY VSV Y N T+ +TFSL+ G+ETRH  IQ+
Sbjct  509  AAGPTDAHGAYSFSGFLGEYIVSVTYANSTSQATFSLSPGDETRHINIQI  558



>ref|XP_002468186.1| hypothetical protein SORBIDRAFT_01g041310 [Sorghum bicolor]
 gb|EER95184.1| hypothetical protein SORBIDRAFT_01g041310 [Sorghum bicolor]
Length=560

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLGP+A+++FF  A +ADPLATLFMN++NV+ETC DP STVDTY++
Sbjct  331  DVNNEMLHYNFYEQRLGPNASMDFFSVAQDADPLATLFMNEYNVIETCDDPFSTVDTYVA  390

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+KEL+ GG  ++GIGLEGHFS PN PL+RAILDKLATL LPIW TEIDI+ K+  +TQA
Sbjct  391  KLKELRSGGAILEGIGLEGHFSKPNIPLMRAILDKLATLGLPIWFTEIDISNKFDAQTQA  450

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE +SHPAVSG+MLWTA+ P GC+QMCLTD NL NLP GDVVD LL EW+T  
Sbjct  451  AYLEQVLREAYSHPAVSGVMLWTALHPSGCYQMCLTDWNLANLPTGDVVDRLLNEWRTLQ  510

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF G+LGEY ++V Y NRT  STFSL+ G+ETRH  +Q+
Sbjct  511  AGGQTDAHGAYSFSGYLGEYVLTVSYNNRTTQSTFSLSPGDETRHINVQM  560



>gb|ABF94920.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=563

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLG +A++EFF  A +ADPLATLFMN+FNV+ETC D  STVDTY++
Sbjct  334  DVNNEMLHYNFYEQRLGANASVEFFSVAQDADPLATLFMNEFNVIETCDDVSSTVDTYVA  393

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+ GG  ++GIGLEGHF  PN PL+RA+LDKLATL LPIW TEIDI+ +Y  +TQA
Sbjct  394  KLKDLRAGGAVLEGIGLEGHFLKPNIPLMRAVLDKLATLGLPIWFTEIDISNRYDAQTQA  453

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAV+G+MLWTA+ P GC+QMCLTD NLNNLP GDVVD LL+EWQT  
Sbjct  454  VYLEQVLREAYSHPAVTGVMLWTALHPNGCYQMCLTDWNLNNLPVGDVVDRLLQEWQTGQ  513

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF GFLGEY VSV Y N T+ +TFSL+ G+ETRH  IQ+
Sbjct  514  AAGPTDAHGAYSFSGFLGEYIVSVTYANSTSQATFSLSPGDETRHINIQI  563



>ref|NP_001140909.1| uncharacterized protein LOC100272986 precursor [Zea mays]
 gb|ACF84937.1| unknown [Zea mays]
 tpg|DAA44349.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=560

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 188/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLGP+A+ EFF  A +ADPLATLFMN++NV+ETC DP STVDTY+S
Sbjct  331  DVNNEMLHYNFYEQRLGPNASAEFFSVAQDADPLATLFMNEYNVIETCDDPFSTVDTYVS  390

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+  G  ++GIGLEGHFS PN PL+RAILDKLATL LPIW TEIDI+ K+  +TQA
Sbjct  391  KLKDLRSAGAILEGIGLEGHFSKPNIPLMRAILDKLATLGLPIWFTEIDISNKFDAQTQA  450

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE +SHPAVSG+MLWTA+ P GC+QMCLTD NL+NLP GDVVD LL EW+T  
Sbjct  451  AYLEQVLREAYSHPAVSGVMLWTALHPSGCYQMCLTDWNLSNLPTGDVVDRLLNEWRTLQ  510

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF G+LGEY ++V Y NRT  STFSL+ G+ETRH  +Q+
Sbjct  511  AAGQTDAHGAYSFTGYLGEYVLTVSYNNRTTQSTFSLSPGDETRHINVQM  560



>ref|XP_009628229.1| PREDICTED: uncharacterized protein LOC104118640 isoform X4 [Nicotiana 
tomentosiformis]
Length=519

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  291  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  349

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  350  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  409

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW+T  
Sbjct  410  IYLEQVLREAFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWETGV  469

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G T   GSYSF GFLG+YKV+V YG +   + FSL+R EET+HF IQL
Sbjct  470  LKGQTVARGSYSFYGFLGDYKVTVSYGGQVVDAAFSLSRSEETKHFSIQL  519



>ref|XP_009628227.1| PREDICTED: uncharacterized protein LOC104118640 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  317  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  375

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  376  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  435

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW+T  
Sbjct  436  IYLEQVLREAFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWETGV  495

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G T   GSYSF GFLG+YKV+V YG +   + FSL+R EET+HF IQL
Sbjct  496  LKGQTVARGSYSFYGFLGDYKVTVSYGGQVVDAAFSLSRSEETKHFSIQL  545



>ref|XP_009628228.1| PREDICTED: uncharacterized protein LOC104118640 isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  313  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  371

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  372  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  431

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW+T  
Sbjct  432  IYLEQVLREAFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWETGV  491

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G T   GSYSF GFLG+YKV+V YG +   + FSL+R EET+HF IQL
Sbjct  492  LKGQTVARGSYSFYGFLGDYKVTVSYGGQVVDAAFSLSRSEETKHFSIQL  541



>ref|XP_010313055.1| PREDICTED: endo-1,4-beta-xylanase C isoform X2 [Solanum lycopersicum]
Length=373

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 186/230 (81%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHF+ YEQRLGPDAT EF++T H+ DPLATLF+N+FNVVETC D  STVD YI+
Sbjct  145  DVNNELLHFNFYEQRLGPDATHEFYRTVHQQDPLATLFLNEFNVVETC-DSSSTVDKYIA  203

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+  +SM+GIGLEGHF APNPP IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  204  KIRELKEDRMSMNGIGLEGHFGAPNPPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  263

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW T  
Sbjct  264  IYLEQVLREGFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWDTGV  323

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G TDEHGSYSF GFLGEYK++  Y  +   + FSL+   ET+HF +QL
Sbjct  324  LKGQTDEHGSYSFYGFLGEYKLTASYDGKVVDAAFSLSPSHETKHFSVQL  373



>ref|XP_009628223.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628225.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628226.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVE C D KSTVD YIS
Sbjct  329  DVNNELLHFDFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVENC-DSKSTVDKYIS  387

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SMDGIGLEGHF  PN P IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  388  KIRELKEDGMSMDGIGLEGHFGVPNRPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  447

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW+T  
Sbjct  448  IYLEQVLREAFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWETGV  507

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G T   GSYSF GFLG+YKV+V YG +   + FSL+R EET+HF IQL
Sbjct  508  LKGQTVARGSYSFYGFLGDYKVTVSYGGQVVDAAFSLSRSEETKHFSIQL  557



>gb|EEC74851.1| hypothetical protein OsI_10717 [Oryza sativa Indica Group]
 gb|EEE58681.1| hypothetical protein OsJ_10107 [Oryza sativa Japonica Group]
Length=717

 Score =   344 bits (882),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLG +A++EFF  A +ADPLATLFMN+FNV+ETC D  STVDTY++
Sbjct  488  DVNNEMLHYNFYEQRLGANASVEFFSVAQDADPLATLFMNEFNVIETCDDVSSTVDTYVA  547

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+ GG  ++GIGLEGHF  PN PL+RA+LDKLATL LPIW TEIDI+ +Y  +TQA
Sbjct  548  KLKDLRAGGAVLEGIGLEGHFLKPNIPLMRAVLDKLATLGLPIWFTEIDISNRYDAQTQA  607

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAV+G+MLWTA+ P GC+QMCLTD NLNNLP GDVVD LL+EWQT  
Sbjct  608  VYLEQVLREAYSHPAVTGVMLWTALHPNGCYQMCLTDWNLNNLPVGDVVDRLLQEWQTGQ  667

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF GFLGEY VSV Y N T+ +TFSL+ G+ETRH  IQ+
Sbjct  668  AAGPTDAHGAYSFSGFLGEYIVSVTYANSTSQATFSLSPGDETRHINIQI  717



>gb|EPS72309.1| hypothetical protein M569_02449, partial [Genlisea aurea]
Length=526

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 187/229 (82%), Gaps = 1/229 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHFD YE++LG +A++EFF+TA++ADPLATLFMN+FNVVETCSD +STVDTY++
Sbjct  298  DVNNEMLHFDFYEEKLGRNASVEFFRTANDADPLATLFMNEFNVVETCSDDESTVDTYVA  357

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKY-GQETQ  402
            +M+EL  GG+ MDGIGL+GHF  PNPPL+R ILDKLATL  PIWLTE+D++KK+  Q+ Q
Sbjct  358  RMRELNSGGVRMDGIGLQGHFENPNPPLMRGILDKLATLEHPIWLTEVDVSKKFSSQKQQ  417

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP V GIMLW+AI   GC+QMCLTD   NNLP GD VD LL+EW T 
Sbjct  418  AIYLEEVLREGFSHPGVDGIMLWSAIRGGGCYQMCLTDGEFNNLPTGDKVDELLREWGTA  477

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRI  75
             LEG  D+HGSYSF+GFLGEY++S   GN T  +T SL  G++T+HF I
Sbjct  478  ALEGTADKHGSYSFLGFLGEYRISATVGNTTVKATLSLAAGKDTKHFNI  526



>ref|XP_006649724.1| PREDICTED: uncharacterized protein LOC102701898 [Oryza brachyantha]
Length=558

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 187/230 (81%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLGP+A+ EFF  A +ADPLATLFMN+FNV+ETC D  STVDTY++
Sbjct  329  DVNNEMLHYNFYEQRLGPNASAEFFSVAQDADPLATLFMNEFNVIETCDDVSSTVDTYVA  388

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+L+  G  ++GIGLEGHF  PN PL+RA+LDKLATL LPIW TEIDI+ ++  +TQA
Sbjct  389  KLKDLRNAGAVLEGIGLEGHFLKPNIPLMRAVLDKLATLGLPIWFTEIDISNRFDAQTQA  448

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAV+G+MLWTA+ P GC+QMCLTD NL NLP GDVVD LL+EWQT  
Sbjct  449  VYLEQVLREAYSHPAVTGVMLWTALHPSGCYQMCLTDWNLKNLPVGDVVDRLLQEWQTGQ  508

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF G+LGEY VSV Y N T+ +TFSL+ G+ETRH  IQ+
Sbjct  509  AAGPTDAHGAYSFSGYLGEYIVSVTYDNSTSQATFSLSPGDETRHINIQI  558



>ref|XP_008781049.1| PREDICTED: endo-1,4-beta-xylanase-like [Phoenix dactylifera]
Length=566

 Score =   337 bits (864),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 192/231 (83%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHFD YEQRLGP+A+LEFF TA +ADPLAT+FMN+FNV+ETC D  STVD+YIS
Sbjct  336  DVNNEMLHFDFYEQRLGPNASLEFFGTAQQADPLATMFMNEFNVLETCDDVNSTVDSYIS  395

Query  578  KMKELKQGGISMDGIGLEGHF-SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++ELK+ G  + GIGLEGHF + PN PL+RA+LDKLATL LPIWLTE+DIN  +  +TQ
Sbjct  396  RLRELKEAGAVLQGIGLEGHFFTKPNLPLMRAVLDKLATLDLPIWLTEVDINHIFDHQTQ  455

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FS+P V+GIMLWTA+ P GC++MCLTD + +NLP+GDVVD LL+EW+T+
Sbjct  456  AIYLEEVLREGFSYPFVNGIMLWTALHPYGCYEMCLTDEDFHNLPSGDVVDRLLQEWETK  515

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G TD+HG Y+F GFLGEYKVSV Y N++  +TFSL RG+ET+H  +QL
Sbjct  516  ETAGVTDDHGLYTFSGFLGEYKVSVSYANKSTETTFSLGRGDETKHLNVQL  566



>gb|EMS68876.1| Endo-1,4-beta-xylanase Z [Triticum urartu]
Length=496

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 186/230 (81%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHF+ YEQRLG +AT+EFF  A +ADPLATLFMN++NVVETC D  STVD Y++
Sbjct  267  DVNNEMLHFNFYEQRLGANATMEFFSVAQDADPLATLFMNEYNVVETCDDASSTVDAYVA  326

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++K+L+ GG  ++GIGLEGHFS PN P +RA+LDKLATL LPIW TEIDIN K+  +TQA
Sbjct  327  RLKDLRAGGAVLEGIGLEGHFSRPNIPYMRAVLDKLATLNLPIWFTEIDINNKFDAQTQA  386

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE ++HPAVSG+MLWTA+   GC+QMCLTD NL NLP GDVVD LL+EWQT  
Sbjct  387  VYLEQVLREAYAHPAVSGVMLWTALHEGGCYQMCLTDWNLKNLPVGDVVDRLLQEWQTGQ  446

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD HG+YSF G+LGEY V+V  GN +  +TFSL+ G+ETRH  +Q+
Sbjct  447  VAGPTDAHGAYSFSGYLGEYVVTVNAGNTSKQATFSLSPGDETRHITVQI  496



>gb|EMT22806.1| Endo-1,4-beta-xylanase Z [Aegilops tauschii]
Length=552

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 186/230 (81%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLHF+ YEQRLG +AT+EFF  A +ADPLATLFMN++NVVETC D  STVD Y++
Sbjct  323  DVNNEMLHFNFYEQRLGANATMEFFSVAQDADPLATLFMNEYNVVETCDDASSTVDAYVA  382

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++K+L+ GG  ++GIGLEGHFS PN P +RA+LDKLATL LPIW TEIDIN K+  +TQA
Sbjct  383  RLKDLRAGGAVLEGIGLEGHFSKPNIPYMRAVLDKLATLNLPIWFTEIDINNKFDAQTQA  442

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE ++HPAVSG+MLWTA+   GC+QMCLTD NL NLP GDVVD LL+EWQT  
Sbjct  443  VYLEQVLREAYAHPAVSGVMLWTALHEGGCYQMCLTDWNLKNLPVGDVVDRLLQEWQTGQ  502

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + G TD HG+YSF G+LGEY V+V  GN +  STFSL+ G+ETRH  +Q+
Sbjct  503  VAGPTDAHGAYSFSGYLGEYVVTVNAGNSSKQSTFSLSPGDETRHITVQI  552



>ref|XP_003558355.1| PREDICTED: uncharacterized protein LOC100841372 [Brachypodium 
distachyon]
Length=563

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 186/230 (81%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NEMLH++ YEQRLGP+AT+EFF  A +ADPLATLFMN++NV+ETC D  STVD Y++
Sbjct  334  DVNNEMLHYNFYEQRLGPNATVEFFSVAQDADPLATLFMNEYNVIETCDDVSSTVDAYVA  393

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++K+L+ GG  ++GIGLEGHFS PN P +RA+LDKLATL LPIW TEIDIN K+  +TQA
Sbjct  394  RLKDLRAGGAVLEGIGLEGHFSKPNIPYMRAVLDKLATLGLPIWFTEIDINNKFDAQTQA  453

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE +SHPAVSG+MLWTA+   GC+QMCLTD +L NLP GDVVD LL+EWQT  
Sbjct  454  VYLEQVLREAYSHPAVSGVMLWTALHQNGCYQMCLTDWDLKNLPVGDVVDRLLQEWQTGQ  513

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
              G TD HG+YSF G+LGEY V+V  GN +A STFSL+ G+ETRH  + +
Sbjct  514  AAGNTDAHGAYSFSGYLGEYVVTVSSGNSSAQSTFSLSPGDETRHITLHI  563



>ref|XP_009400614.1| PREDICTED: uncharacterized protein LOC103984779 [Musa acuminata 
subsp. malaccensis]
Length=570

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 189/231 (82%), Gaps = 3/231 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG +A+ EFF+TA ++DPLATLFMN+FNVVETCSD +STVD+YIS
Sbjct  342  DVSNEMLHFDFYEQRLGSNASSEFFRTAQQSDPLATLFMNEFNVVETCSDARSTVDSYIS  401

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++KELK GG  ++GIGLEGHF  PN PL+RA+LDKL+TL LPIWLTEIDI+KK   + QA
Sbjct  402  RLKELKNGGAVLEGIGLEGHFWRPNIPLMRAVLDKLSTLELPIWLTEIDISKKVDAQEQA  461

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V GI+LWTA+ P GC+QMCLTD +  NLP GD VD LLKEW+T  
Sbjct  462  LYLEEVLREGFSHPSVGGIILWTALHPNGCYQMCLTDQSFGNLPTGDAVDELLKEWETT-  520

Query  218  LEGG-TDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             EGG TDEHG YSF+GFLGEYKVSV  GN++  ++  L+RG ET+H  + L
Sbjct  521  -EGGLTDEHGQYSFIGFLGEYKVSVVAGNKSTETSLFLSRGGETKHVTVHL  570



>ref|XP_004250707.1| PREDICTED: uncharacterized protein LOC101263970 isoform X1 [Solanum 
lycopersicum]
Length=549

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 186/230 (81%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHF+ YEQRLGPDAT EF++T H+ DPLATLF+N+FNVVETC D  STVD YI+
Sbjct  321  DVNNELLHFNFYEQRLGPDATHEFYRTVHQQDPLATLFLNEFNVVETC-DSSSTVDKYIA  379

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+  +SM+GIGLEGHF APNPP IRA LDKLATL LPIWLTE+DI+  + +ETQA
Sbjct  380  KIRELKEDRMSMNGIGLEGHFGAPNPPRIRATLDKLATLGLPIWLTEVDISDTFSKETQA  439

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW T  
Sbjct  440  IYLEQVLREGFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWDTGV  499

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G TDEHGSYSF GFLGEYK++  Y  +   + FSL+   ET+HF +QL
Sbjct  500  LKGQTDEHGSYSFYGFLGEYKLTASYDGKVVDAAFSLSPSHETKHFSVQL  549



>ref|XP_006343478.1| PREDICTED: uncharacterized protein LOC102583591 [Solanum tuberosum]
Length=543

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 187/230 (81%), Gaps = 1/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHF+ YEQRLGP+ATLEF++T H+ DPLATLF+N+FNVVETC D  STVD YI+
Sbjct  315  DVNNELLHFNFYEQRLGPNATLEFYRTVHQQDPLATLFLNEFNVVETC-DSTSTVDKYIA  373

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ELK+ G+SM+GIGLEGHF APNPP IRA LDKLATL LPIWLTE+DI+  + +ETQ 
Sbjct  374  KIRELKEDGMSMNGIGLEGHFGAPNPPRIRATLDKLATLGLPIWLTEVDISDTFSKETQG  433

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            IYLE VLRE FSHPAV GIMLW+AI    C++MCLTD +LNNLP G+VVD LLKEW T  
Sbjct  434  IYLEQVLREGFSHPAVDGIMLWSAIRRNKCYRMCLTDPDLNNLPTGNVVDKLLKEWDTGV  493

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            L+G TD+HGSYSF GFLGEYK++  Y  +   + FSL+   ET+HF +QL
Sbjct  494  LKGPTDDHGSYSFYGFLGEYKLTASYEGKVVDAAFSLSPSHETKHFSVQL  543



>emb|CAB37521.1| putative protein [Arabidopsis thaliana]
 emb|CAB80529.1| putative protein [Arabidopsis thaliana]
Length=433

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E D LATLF NDFNVVETCSD KSTVD YI+
Sbjct  203  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDSLATLFFNDFNVVETCSDEKSTVDEYIA  262

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL++  G+ MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      +Q
Sbjct  263  RVRELQRYDGVRMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISSSLDHRSQ  322

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTD+   NLPAGDVVD  L EW+T 
Sbjct  323  AIYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDDKFRNLPAGDVVDQKLLEWKTG  382

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HGS+SF GFLGEY+V + Y  +T  S+FSL++G ET+H R+Q+
Sbjct  383  EVKATTDDHGSFSFFGFLGEYRVGIMYQGKTVNSSFSLSQGPETKHVRLQI  433



>ref|XP_002866813.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43072.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 184/231 (80%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E D LATLF NDFNVVETCSD KSTVD YI+
Sbjct  332  DVSNEMLHFDFYESRLGKNASYGFFAAAREIDSLATLFFNDFNVVETCSDEKSTVDEYIA  391

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL++  GI MDGIGLEGHF+ PN  L+RAI+DKLATL+LPIWLTEIDI+      TQ
Sbjct  392  RVRELQRYDGIRMDGIGLEGHFTTPNVALMRAIIDKLATLQLPIWLTEIDISSSLDHRTQ  451

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTD+   NLPAGD+VD  L EW+T+
Sbjct  452  AIYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDDKFRNLPAGDMVDQKLLEWKTR  511

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HGS+SF GFLGEY+V + Y  +T  S+FSL++G ET+H R+Q+
Sbjct  512  EVKATTDDHGSFSFFGFLGEYRVGIVYQGKTVNSSFSLSQGPETKHVRLQI  562



>gb|KJB12083.1| hypothetical protein B456_002G1956002, partial [Gossypium raimondii]
Length=204

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  680  TAHEADPLATLFMNDFNVVETCSDPKSTVDTYISKMKELKQGGISMDGIGLEGHFSAPNP  501
            TAH++DPLATLF N+FNVVETCSD KSTVDTYI +++EL++GG+ MDGIGLE HF+ PN 
Sbjct  1    TAHQSDPLATLFTNEFNVVETCSDVKSTVDTYIERIRELERGGMYMDGIGLESHFTVPNL  60

Query  500  PLIRAILDKLATLRLPIWLTEIDINKKYGQETQAIYLETVLREVFSHPAVSGIMLWTAIS  321
            PL+RA++DKLATLRLPIWLTE+DI+   G+E Q +YLE VLRE FSHP+V+GIMLWTA+ 
Sbjct  61   PLMRAVIDKLATLRLPIWLTEVDISSSVGKELQGVYLEQVLREGFSHPSVNGIMLWTALH  120

Query  320  PKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            PKGC++MCLTD N  NLPAGDVVD LLKEW++  ++G T EHGSYSF GFLGEYKV+V Y
Sbjct  121  PKGCYEMCLTDENFKNLPAGDVVDKLLKEWESGEMKGVTGEHGSYSFYGFLGEYKVNVGY  180

Query  140  GNRTATSTFSLNRGEETRHFRIQL  69
            G+R A  TFSL R  ET+HF I L
Sbjct  181  GDRAANFTFSLPRSGETKHFSIHL  204



>ref|NP_195577.2| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 gb|AAO42885.1| At4g38650 [Arabidopsis thaliana]
 dbj|BAE99535.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86958.1| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Length=562

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E D LATLF NDFNVVETCSD KSTVD YI+
Sbjct  332  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDSLATLFFNDFNVVETCSDEKSTVDEYIA  391

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL++  G+ MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      +Q
Sbjct  392  RVRELQRYDGVRMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISSSLDHRSQ  451

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTD+   NLPAGDVVD  L EW+T 
Sbjct  452  AIYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDDKFRNLPAGDVVDQKLLEWKTG  511

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HGS+SF GFLGEY+V + Y  +T  S+FSL++G ET+H R+Q+
Sbjct  512  EVKATTDDHGSFSFFGFLGEYRVGIMYQGKTVNSSFSLSQGPETKHVRLQI  562



>ref|XP_006851910.1| hypothetical protein AMTR_s00041p00160040 [Amborella trichopoda]
 gb|ERN13377.1| hypothetical protein AMTR_s00041p00160040 [Amborella trichopoda]
Length=547

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 180/230 (78%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLGP+AT  FF+TA  +DP ATLFMNDFNVVETC D  STVD Y+S
Sbjct  318  DVSNEMLHFDFYESRLGPNATAYFFETAKRSDPWATLFMNDFNVVETCGDENSTVDVYVS  377

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL  GG  MDGIGLE HF+ PN PL+R+ILDKLATL LPIWLTE+DI+K    ETQA
Sbjct  378  RLRELMDGGYVMDGIGLEAHFTRPNVPLMRSILDKLATLGLPIWLTEVDISKTLDHETQA  437

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP+++GIMLWTA+ P GC+QMCLTDNNL+NLP G VVD LLKEW+T+ 
Sbjct  438  TYLEEVLREGFSHPSINGIMLWTALHPNGCYQMCLTDNNLHNLPTGVVVDKLLKEWETKE  497

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G T + GS+ F  FLGEYKV   +G +T  S+ S+ +G+ET H  I +
Sbjct  498  VKGLTGDRGSFDFQAFLGEYKVIATFGAKTVESSLSVCQGDETLHMIIPI  547



>ref|XP_010531544.1| PREDICTED: uncharacterized protein LOC104807819 [Tarenaya hassleriana]
Length=559

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 183/230 (80%), Gaps = 0/230 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE+RLG  A+  FF+ A E D LATLF+N+FNVVETC D KSTVD YI 
Sbjct  330  DVSNEMLHFDFYEKRLGEKASSGFFEAAREEDGLATLFLNEFNVVETCGDEKSTVDEYIG  389

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ G+ MDGIGLE HF+ PN  L+R  LDKLATL LPIWLTE+DI+ +  Q TQA
Sbjct  390  RVRELQRDGVWMDGIGLEAHFTVPNVALMRGTLDKLATLGLPIWLTELDISSRLDQHTQA  449

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTD NL NLPAG+VVD +L+EW+T  
Sbjct  450  LYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDGNLQNLPAGEVVDRMLREWRTSE  509

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            ++G +D+H S SF GFLGEY+V+V YG R+  STFSL+   ET+H R+++
Sbjct  510  VKGASDDHASLSFFGFLGEYRVTVTYGGRSVNSTFSLSPSPETKHVRLRI  559



>emb|CDY12095.1| BnaC03g60110D [Brassica napus]
Length=487

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 184/233 (79%), Gaps = 3/233 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+ E F  A E D LATLF+NDFNVVETCSD +STVD YI+
Sbjct  255  DVSNEMLHFDFYESRLGKNASYELFAAARELDSLATLFLNDFNVVETCSDERSTVDEYIT  314

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            +++EL++   GG+ MDG+GLEGHF+ PN  L+RA LDKLATL LP+WLTEIDI+      
Sbjct  315  RVRELERYDGGGMRMDGVGLEGHFTRPNVALMRANLDKLATLELPVWLTEIDISSTLDHR  374

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            TQAIYLE VLRE FSHP+V+GI+LWTA+ P GC+QMCLTD+  +NLPAGDVVD  L EW 
Sbjct  375  TQAIYLEQVLREGFSHPSVNGIILWTALHPNGCYQMCLTDDKFHNLPAGDVVDQKLLEWT  434

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            T  ++  TD+HG++SF+GFLGEY+VS+ Y  +T  S+FSL+R  ET+H R+++
Sbjct  435  TGEVKAKTDDHGTFSFLGFLGEYRVSIMYEGKTVNSSFSLSRDPETKHVRLRI  487



>ref|XP_010446374.1| PREDICTED: uncharacterized protein LOC104729170 [Camelina sativa]
Length=561

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E DPLATLF+NDFNVVETCSD +STVD YI+
Sbjct  331  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDPLATLFLNDFNVVETCSDERSTVDEYIA  390

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL++  G+ MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      TQ
Sbjct  391  RVRELQRYDGVQMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISNTLDHRTQ  450

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTD+   NLPAG+VVD  L EW+T 
Sbjct  451  AIYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDDKFRNLPAGEVVDQKLIEWKTG  510

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HG+ SF GFLGEY+V V Y  +T  +TFSL+R  ET+H R+Q+
Sbjct  511  EVKATTDDHGTSSFHGFLGEYRVCVVYQGKTVNTTFSLSRSPETKHVRLQI  561



>ref|XP_006411655.1| hypothetical protein EUTSA_v10024805mg [Eutrema salsugineum]
 gb|ESQ53108.1| hypothetical protein EUTSA_v10024805mg [Eutrema salsugineum]
Length=561

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 182/233 (78%), Gaps = 3/233 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF+ A E D LATLF+NDFNVVETC D +STVD YI+
Sbjct  329  DVSNEMLHFDFYESRLGENASYGFFEAAREIDSLATLFLNDFNVVETCIDERSTVDEYIA  388

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            +++EL++   GG+ MDG+GLEGHF+ PN  L+RA LDKLATL LPIWLTEIDI+      
Sbjct  389  RVRELQRYGDGGVRMDGVGLEGHFTVPNAALMRANLDKLATLELPIWLTEIDISSTLDHH  448

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            TQAIYLE VLRE FSHP+V+GIMLWTA+ P GC+QMCLTD+N  NLPAGD VD  L EW+
Sbjct  449  TQAIYLEQVLREGFSHPSVNGIMLWTALHPNGCYQMCLTDDNFRNLPAGDTVDKKLLEWK  508

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            T  L+  TD+HGS+SF GFLGEY+V + Y  +T  S+FSL+R  ET+H R+Q+
Sbjct  509  TGELKATTDDHGSFSFFGFLGEYEVGIIYQGKTVNSSFSLSRDPETKHVRLQI  561



>ref|XP_009622124.1| PREDICTED: LOW QUALITY PROTEIN: probable endo-1,4-beta-xylanase 
C [Nicotiana tomentosiformis]
Length=399

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLH+D YEQRLG + +LEFFKTA   DPLA L MND+NVVETC D  STVD YIS
Sbjct  196  DVDNEMLHYDFYEQRLGTNTSLEFFKTAQNLDPLAKLLMNDYNVVETCYDMNSTVDAYIS  255

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+++LKQGG+ MDGIGLEGHF+ PNPPLIRA+LDKLATL LPIWLTEIDI+    + TQA
Sbjct  256  KLRDLKQGGVFMDGIGLEGHFTVPNPPLIRAVLDKLATLELPIWLTEIDISNTLDKXTQA  315

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE VLRE FSHP V+GIMLWTA+   GC+QMCLTDN  +NLPAGDV+DNLLKEWQT  
Sbjct  316  RYLEMVLREGFSHPNVNGIMLWTALHTNGCYQMCLTDNYFHNLPAGDVIDNLLKEWQTGV  375

Query  218  LEGGTDEHGSYSFMGFLGEY  159
            + G TDEHGS+SF GFLGEY
Sbjct  376  VNGQTDEHGSFSFSGFLGEY  395



>ref|XP_004969072.1| PREDICTED: uncharacterized protein LOC101763135 [Setaria italica]
Length=568

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT EFF TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  333  DVSNEMLHFDFYENRLGGNATAEFFSTAKRADPLATLFLNDFNVVEVCDDLSSSADSYVS  392

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L  GG++ +GIGLEGHF  PN P +RA+LDKL TLRLPIWLTEIDI+  + Q+TQA
Sbjct  393  RLRQLADGGVTFEGIGLEGHFGKPNIPYVRAVLDKLGTLRLPIWLTEIDISSSFDQKTQA  452

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+     C+QMCLTD N  NLPAGDVVD LL+EWQT+
Sbjct  453  AYLEEVLREGFAHPSVDGIMLWTAMGRNASCYQMCLTDANFTNLPAGDVVDRLLEEWQTR  512

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             + G T++ GS++F  FLGEYK+SV Y N T+  TFSL R ++T+H  ++L
Sbjct  513  EVLGATNDRGSFNFSAFLGEYKLSVTYQNLTSEGTFSLARSDDTKHINVRL  563



>ref|XP_010436964.1| PREDICTED: uncharacterized protein LOC104720780 isoform X2 [Camelina 
sativa]
Length=508

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E DPLATLF+NDFNVVETCSD +STVD YI+
Sbjct  278  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDPLATLFLNDFNVVETCSDERSTVDEYIA  337

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL++  G+ MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      TQ
Sbjct  338  RVRELQRYDGVQMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISNSLDHRTQ  397

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTD+   NL AGDVVD  L EW+T 
Sbjct  398  AIYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDDKFRNLLAGDVVDQKLIEWKTG  457

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HG+ SF GFLGEY+V + Y  +T  ++FSL+R  ET+H R+Q+
Sbjct  458  EVKATTDDHGTSSFHGFLGEYRVGIVYQGKTVNTSFSLSRSPETKHVRLQI  508



>ref|XP_002446197.1| hypothetical protein SORBIDRAFT_06g003350 [Sorghum bicolor]
 gb|EES10525.1| hypothetical protein SORBIDRAFT_06g003350 [Sorghum bicolor]
Length=574

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT +FF TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  335  DVSNEMLHFDFYENRLGGNATADFFSTAKRADPLATLFLNDFNVVEACDDLSSSADSYVS  394

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L   G++ +GIGLEGHF  PN P +RA+LDKL TLRLP+WLTEIDI+  + Q TQA
Sbjct  395  RLRQLADAGVTFEGIGLEGHFGKPNIPYVRAVLDKLGTLRLPVWLTEIDISGAFDQRTQA  454

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+     C+QMCLTD N  NLPAGDVVD LL EWQT+
Sbjct  455  AYLEEVLREGFAHPSVDGIMLWTAMGANASCYQMCLTDANFTNLPAGDVVDRLLGEWQTK  514

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             + G T++ GS++F  FLGEY++SV Y NRTA +TFSL R ++T+H  I+L
Sbjct  515  EVLGATNDRGSFNFSAFLGEYRLSVTYLNRTADATFSLARSDDTKHINIRL  565



>ref|XP_006283442.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
 gb|EOA16340.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
Length=402

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E D LATLF+NDFNVVETCSD +STVD YI+
Sbjct  172  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDSLATLFLNDFNVVETCSDERSTVDEYIA  231

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K++EL++  G  MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      TQ
Sbjct  232  KVRELQRYDGAQMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISSSLDHRTQ  291

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
              YLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTD+   NLPAGDVVD  L EW+T 
Sbjct  292  GNYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDDKFRNLPAGDVVDQKLVEWKTG  351

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HGS +F GFLGEY V + Y  ++ ++TFSL+R  ET+H R+Q+
Sbjct  352  GVKATTDDHGSLTFYGFLGEYSVGIVYQGKSVSTTFSLSRSPETKHVRLQI  402



>ref|XP_010436963.1| PREDICTED: uncharacterized protein LOC104720780 isoform X1 [Camelina 
sativa]
Length=556

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E DPLATLF+NDFNVVETCSD +STVD YI+
Sbjct  326  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDPLATLFLNDFNVVETCSDERSTVDEYIA  385

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL++  G+ MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      TQ
Sbjct  386  RVRELQRYDGVQMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISNSLDHRTQ  445

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTD+   NL AGDVVD  L EW+T 
Sbjct  446  AIYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDDKFRNLLAGDVVDQKLIEWKTG  505

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HG+ SF GFLGEY+V + Y  +T  ++FSL+R  ET+H R+Q+
Sbjct  506  EVKATTDDHGTSSFHGFLGEYRVGIVYQGKTVNTSFSLSRSPETKHVRLQI  556



>ref|XP_009615209.1| PREDICTED: endo-1,4-beta-xylanase A-like [Nicotiana tomentosiformis]
Length=561

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 180/231 (78%), Gaps = 2/231 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHF+ YE +LGP+ATL+ FK  H  DPLATLF+N++NVVE C D K++VD YI 
Sbjct  332  DVNNELLHFNFYEGKLGPNATLDMFKKVHREDPLATLFLNEYNVVERC-DSKASVDRYIE  390

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K KELK GG+++ GIGLE HF+ PNPP +RA+LDKLATL+LPIWLTE+D++K YG E QA
Sbjct  391  KFKELKNGGVTVAGIGLESHFAIPNPPFMRAVLDKLATLKLPIWLTEVDVSKMYGLEEQA  450

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDN-LLKEWQTQ  222
            +YLE +LRE FSHP+V+GIMLWT+ S  GC+Q CLTD    NLP GDVVD  LLKEWQT+
Sbjct  451  MYLEQILREGFSHPSVNGIMLWTSRSVGGCYQTCLTDEKFQNLPTGDVVDKLLLKEWQTK  510

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G TDE GSYSF GFLGEY VSV Y ++   S FSL RG ET+H  +Q+
Sbjct  511  KKHGKTDEFGSYSFRGFLGEYNVSVVYNHKVINSYFSLGRGVETKHITLQI  561



>ref|XP_006422633.1| hypothetical protein CICLE_v10030219mg, partial [Citrus clementina]
 gb|ESR35873.1| hypothetical protein CICLE_v10030219mg, partial [Citrus clementina]
Length=496

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNE+LHFD YEQRLGP A L FF+TAH++DPLATLFMN++NVVETCSD  S VD+YIS
Sbjct  299  DVSNEILHFDFYEQRLGPKAALHFFQTAHQSDPLATLFMNEYNVVETCSDVNSMVDSYIS  358

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL++ G+S DGIGL+GHF+ PN PL+RAI+DK+ TL+LPIWLTE+DI+ K  +E QA
Sbjct  359  RLRELRRSGVSTDGIGLQGHFTVPNLPLMRAIIDKMTTLKLPIWLTEVDISSKLSKEKQA  418

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
            +YLE VLRE FSHP+VSGIMLW A+ P GC+QMCLTDNNL NLPAGDVVD LLKE QT  
Sbjct  419  VYLEQVLREGFSHPSVSGIMLWAALHPNGCYQMCLTDNNLQNLPAGDVVDKLLKECQTGE  478

Query  218  LEGGTDEHGSYSFMGFLG  165
            + G TD HGSYSF GFLG
Sbjct  479  VTGHTDAHGSYSFYGFLG  496



>ref|XP_010431807.1| PREDICTED: uncharacterized protein LOC104716145 [Camelina sativa]
Length=556

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E DPLATLF+NDFNVVETCSD +STVD YI+
Sbjct  326  DVSNEMLHFDFYESRLGKNASYGFFAAAREIDPLATLFLNDFNVVETCSDERSTVDEYIA  385

Query  578  KMKELK-QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            +++EL+  GG  MD IGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      TQ
Sbjct  386  RVRELQWYGGAQMDIIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISNSLDNRTQ  445

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYLE VLR+ FSHP+VSGIMLWTA+ P GC++MCLTD+   NLPAGD+VD  L EW+T 
Sbjct  446  AIYLEQVLRDGFSHPSVSGIMLWTALHPYGCYEMCLTDDKFRNLPAGDMVDQKLIEWKTG  505

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HG+ SF GFLGEY+V + Y  +T  ++FSL+R  ET+H R+Q+
Sbjct  506  EVKATTDDHGTSSFDGFLGEYRVGIIYQGKTVNTSFSLSRSHETKHVRLQI  556



>ref|XP_009799022.1| PREDICTED: endo-1,4-beta-xylanase A-like [Nicotiana sylvestris]
Length=557

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 179/231 (77%), Gaps = 2/231 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHF+ YE +LGP+ATL+ FK  H  DPLATLF+N++NVVE C D K++VD YI 
Sbjct  328  DVNNELLHFNFYEGKLGPNATLDMFKKVHREDPLATLFLNEYNVVERC-DSKASVDRYIE  386

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K KELK GG+++ GIGLE HF+ PNPP +RA+LDKLATL+LPIWLTE+D++K Y  E QA
Sbjct  387  KYKELKNGGVTVGGIGLESHFAIPNPPFMRAVLDKLATLKLPIWLTEVDVSKMYELEEQA  446

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDN-LLKEWQTQ  222
            +YLE +LRE FSHP+V+GIMLWT+ S  GC+Q CLTD    NLP GDVVD  LLKEWQT+
Sbjct  447  MYLEQILREGFSHPSVNGIMLWTSRSVGGCYQTCLTDEKFQNLPTGDVVDKLLLKEWQTK  506

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G TDE GSYSF GFLGEY VSV Y ++   S FSL RG ET+H  +Q+
Sbjct  507  KKHGKTDEFGSYSFRGFLGEYNVSVVYNHKVVNSYFSLGRGVETKHITVQI  557



>emb|CDX90288.1| BnaA08g16960D [Brassica napus]
Length=564

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 182/233 (78%), Gaps = 3/233 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+ E F  A E D LATLF+NDFNVVETCSD +STVD YI+
Sbjct  332  DVSNEMLHFDFYESRLGKNASYELFAAARELDSLATLFLNDFNVVETCSDERSTVDEYIA  391

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            +++EL++   GG+ MDG+GLEGHF+ PN  L+RA LDKLATL LP+WLTEIDI+      
Sbjct  392  RVRELERYDGGGMRMDGVGLEGHFTRPNVALMRANLDKLATLELPVWLTEIDISSTLDHR  451

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            TQAIYLE VLRE FSHP+V+GI+LWTA+ P GC+QMCLTD+   NLP GDVVD  L EW 
Sbjct  452  TQAIYLEQVLREGFSHPSVNGIILWTALHPNGCYQMCLTDDKFINLPTGDVVDKKLLEWT  511

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            T  ++  TD+HG++SF+GFLGEY+VS+ Y  +T  S+FSL+R  ET+H R+++
Sbjct  512  TGEVKAKTDDHGTFSFLGFLGEYRVSIIYEGKTVNSSFSLSRDPETKHVRLRI  564



>ref|XP_006283441.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
 gb|EOA16339.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
Length=560

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+  FF  A E D LATLF+NDFNVVETCSD +STVD YI+
Sbjct  330  DVSNEMLHFDFYETRLGKNASYGFFAAAREIDSLATLFLNDFNVVETCSDERSTVDEYIA  389

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K++EL++  G  MDGIGLEGHF+ PN  L+RAILDKLATL+LPIWLTEIDI+      TQ
Sbjct  390  KVRELQRYDGAQMDGIGLEGHFTTPNVALMRAILDKLATLQLPIWLTEIDISSSLDHRTQ  449

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
              YLE VLRE FSHP+V+GIMLWTA+ P GC++MCLTD+   NLPAGDVVD  L EW+T 
Sbjct  450  GNYLEQVLREGFSHPSVNGIMLWTALHPYGCYEMCLTDDKFRNLPAGDVVDQKLVEWKTG  509

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             ++  TD+HGS +F GFLGEY V + Y  ++ ++TFSL+R  ET+H R+Q+
Sbjct  510  GVKATTDDHGSLTFYGFLGEYSVGIVYQGKSVSTTFSLSRSPETKHVRLQI  560



>ref|XP_009109536.1| PREDICTED: uncharacterized protein LOC103835171 [Brassica rapa]
Length=564

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 182/233 (78%), Gaps = 3/233 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +A+ E F  A E D LATLF+NDFNVVETCSD +STVD YI+
Sbjct  332  DVSNEMLHFDFYESRLGKNASYELFAAARELDSLATLFLNDFNVVETCSDERSTVDEYIA  391

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            ++KEL++   GG+ MDG+GLEGHF+ PN  L+RA LDKLATL LP+WLTEIDI+      
Sbjct  392  RVKELERYDGGGMRMDGVGLEGHFTRPNVALMRANLDKLATLELPVWLTEIDISSTLDHR  451

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            TQA+YLE VLRE FSHP+V+GI+LWTA+ P GC+QMCLTD+   NLPAGDVVD  L EW 
Sbjct  452  TQALYLEQVLREGFSHPSVNGIILWTALHPNGCYQMCLTDDKFINLPAGDVVDKKLLEWT  511

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            T  ++  TD+ G++SF+GFLGEY+VS+ Y  +T  S+FSL+R  ET+H R+++
Sbjct  512  TGEVKAKTDDRGTFSFLGFLGEYRVSIIYEGKTVNSSFSLSRDPETKHVRLRI  564



>ref|XP_006652135.1| PREDICTED: uncharacterized protein LOC102708887 [Oryza brachyantha]
Length=577

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT+EFF TA  ADPLATLF+NDFNV+E C D  S+ D+Y+S
Sbjct  343  DVSNEMLHFDFYENRLGSNATVEFFNTAKRADPLATLFLNDFNVIEVCDDLSSSADSYVS  402

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L  GG++ +GIGLEGHFS PN P +RA+LDKL TLRLPIWLTEIDI+  +  +TQA
Sbjct  403  RLRQLADGGVTFEGIGLEGHFSKPNIPYVRAVLDKLGTLRLPIWLTEIDISSSFDPKTQA  462

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+     C+QMCLT+ N +NLPAGDVVD LL EWQ++
Sbjct  463  AYLEEVLREGFAHPSVDGIMLWTAMDANASCYQMCLTNQNFSNLPAGDVVDKLLGEWQSK  522

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G T++ GS++F  FLGEYK+SV Y N TA  TFSL   ++T+H  I+L
Sbjct  523  ETLGTTNDRGSFNFSAFLGEYKLSVTYHNLTAEGTFSLAHSDDTKHINIRL  573



>ref|NP_001055145.1| Os05g0304900 [Oryza sativa Japonica Group]
 dbj|BAF17059.1| Os05g0304900 [Oryza sativa Japonica Group]
Length=480

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT++FF TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  246  DVSNEMLHFDFYENRLGGNATVDFFDTAKRADPLATLFLNDFNVVEVCDDLSSSADSYVS  305

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L  GG++ +GIGLEGHF  PN P +RA+LDKL TLRLPIWLTEIDI+  +  +TQA
Sbjct  306  RLRQLADGGVTFEGIGLEGHFGKPNIPYVRAVLDKLGTLRLPIWLTEIDISSSFDPKTQA  365

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+     C+QMCLT+ N  NLPAGDVVD LL EWQT+
Sbjct  366  AYLEEVLREGFAHPSVDGIMLWTAMDTNASCYQMCLTNQNFTNLPAGDVVDKLLGEWQTK  425

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G T++ GS++F  FLGEYK+SV Y N TA  TFSL   ++T+H  I+L
Sbjct  426  ETLGTTNDRGSFNFSAFLGEYKLSVTYLNLTAEGTFSLAHSDDTKHINIRL  476



>ref|XP_003581580.1| PREDICTED: uncharacterized protein LOC100828464 [Brachypodium 
distachyon]
Length=569

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 178/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHF  YE RLG +AT EFF+TA  ADPLATLF+NDFNVVE C D  S+ D Y++
Sbjct  337  DVSNEMLHFGFYEDRLGRNATAEFFRTARRADPLATLFLNDFNVVEVCDDLSSSADEYVA  396

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            +++EL   G++ +GIGLEGHF  PN P +RA+LDKL TLRLP+WLTE+DI+    Q+TQA
Sbjct  397  RLRELADAGVTFEGIGLEGHFGKPNVPYVRAVLDKLGTLRLPVWLTEVDISSSLDQKTQA  456

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V G+MLWTA+   G C+QMCLTD N++NLPAGDVVD LL EWQT+
Sbjct  457  AYLEEVLREGFAHPSVDGMMLWTAMDANGSCYQMCLTDRNMSNLPAGDVVDKLLGEWQTR  516

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             + G T++ GS++F  FLGEYK+ V Y N +A  TFSL R ++T+H  I+L
Sbjct  517  EVLGATNDRGSFNFSAFLGEYKLYVAYLNSSAEGTFSLARSDDTKHISIRL  567



>ref|XP_006367794.1| PREDICTED: uncharacterized protein LOC102602944 [Solanum tuberosum]
Length=541

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 175/231 (76%), Gaps = 2/231 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YE++LGP ATL+ FK+    DPLATLF+N++N+VE C D K+ VD YI 
Sbjct  312  DVNNELLHFDFYEKKLGPKATLDMFKSMQREDPLATLFLNEYNIVERC-DSKANVDRYID  370

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
              KELK+GG+ + GIGLE HFSAPNP  +RA+LDKLATL+LPIWLTE+D++  YGQE QA
Sbjct  371  TFKELKKGGVKVAGIGLESHFSAPNPAFMRAVLDKLATLKLPIWLTEVDVSSMYGQEEQA  430

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDN-LLKEWQTQ  222
            ++LE +LRE FSHP+V+GIMLWTA SP GC+Q CLTD    NLP GDV+D  LL EW T 
Sbjct  431  VFLEQILREAFSHPSVNGIMLWTARSPGGCYQTCLTDEKFQNLPTGDVIDQLLLNEWTTG  490

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            T  G T+E GSY+F GFLGE+KVS+ Y      STFSL  G +T+H  I +
Sbjct  491  TKRGKTNEFGSYNFRGFLGEFKVSILYNRTIVNSTFSLGHGVDTKHITIHV  541



>gb|EEC78941.1| hypothetical protein OsI_19385 [Oryza sativa Indica Group]
Length=526

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT++FF TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  292  DVSNEMLHFDFYENRLGGNATVDFFDTAKRADPLATLFLNDFNVVEVCDDLSSSADSYVS  351

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L  GG++ +GIGLEGHF  PN P +RA+LDKL TLRLPIWLTEIDI+  +  +TQA
Sbjct  352  RLRQLADGGVTFEGIGLEGHFGKPNIPYVRAVLDKLGTLRLPIWLTEIDISSSFDPKTQA  411

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+     C+QMCLT+ N  NLPAGDVVD LL EWQT+
Sbjct  412  AYLEEVLREGFAHPSVDGIMLWTAMDTNASCYQMCLTNQNFTNLPAGDVVDKLLGEWQTK  471

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G T++ GS++F  FLGEYK+SV Y N TA  TFSL   ++T+H  I+L
Sbjct  472  ETLGTTNDRGSFNFSAFLGEYKLSVTYLNLTAEGTFSLAHSDDTKHINIRL  522



>gb|EMT25110.1| Endo-1,4-beta-xylanase Z [Aegilops tauschii]
Length=562

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT +FF+TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  330  DVSNEMLHFDFYESRLGRNATTDFFRTAKRADPLATLFLNDFNVVEVCDDLSSSADSYVS  389

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L   G++ +GIGLE HF  PN P +RA+LDKL TLRLPIWLTE+DI+     +TQA
Sbjct  390  RLRQLADAGVTFEGIGLEAHFGKPNIPYVRAVLDKLGTLRLPIWLTEVDISNALDPKTQA  449

Query  398  IYLETVLREVFSHPAVSGIMLWTAI-SPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+ +   C+QMCLTD N  NLPAGDVVD LL EWQT+
Sbjct  450  AYLEEVLREGFAHPSVDGIMLWTAMDASAACYQMCLTDGNFTNLPAGDVVDRLLGEWQTR  509

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             + G T++ GS++F  FLGEYK+SV Y N +A  TFSL R ++T+H  I+L
Sbjct  510  EVLGATNDRGSFNFSAFLGEYKLSVTYLNSSAEGTFSLARSDDTKHITIRL  560



>gb|EEE63172.1| hypothetical protein OsJ_17981 [Oryza sativa Japonica Group]
Length=526

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT+++F TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  292  DVSNEMLHFDFYENRLGGNATVDYFDTAKRADPLATLFLNDFNVVEVCDDLSSSADSYVS  351

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L  GG++ +GIGLEGHF  PN P +RA+LDKL TLRLPIWLTEIDI+  +  +TQA
Sbjct  352  RLRQLADGGVTFEGIGLEGHFGKPNIPYVRAVLDKLGTLRLPIWLTEIDISSSFDPKTQA  411

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+     C+QMCLT+ N  NLPAGDVVD LL EWQT+
Sbjct  412  AYLEEVLREGFAHPSVDGIMLWTAMDTNASCYQMCLTNQNFTNLPAGDVVDKLLGEWQTK  471

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
               G T++ GS++F  FLGEYK+SV Y N TA  TFSL   ++T+H  I+L
Sbjct  472  ETLGTTNDRGSFNFSAFLGEYKLSVTYLNLTAEGTFSLAHSDDTKHINIRL  522



>gb|EMS66498.1| Endo-1,4-beta-xylanase Z [Triticum urartu]
Length=552

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT +FF+TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  320  DVSNEMLHFDFYESRLGRNATTDFFRTAKRADPLATLFLNDFNVVEVCDDLSSSADSYVS  379

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            ++++L   G++ +GIGLE HF+ PN P +RA+LDKL TLRLPIWLTE+DI+     +TQA
Sbjct  380  RLRQLADAGVTFEGIGLEAHFAKPNIPYVRAVLDKLGTLRLPIWLTEVDISNALDPKTQA  439

Query  398  IYLETVLREVFSHPAVSGIMLWTAI-SPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             YLE VLRE F+HP+V GIMLWTA+ +   C+QMCLTD N   LPAGDVVD LL EWQT+
Sbjct  440  AYLEEVLREGFAHPSVDGIMLWTAMDASAACYQMCLTDGNFTTLPAGDVVDRLLGEWQTR  499

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             + G T++ GS++F  FLGEYK+SV Y N +A  TFSL R ++T+H  I+L
Sbjct  500  EVLGATNDRGSFNFSAFLGEYKLSVTYLNSSAEGTFSLARSDDTKHITIRL  550



>ref|XP_008661494.1| PREDICTED: uncharacterized protein LOC100216852 isoform X1 [Zea 
mays]
 gb|AFW57913.1| hypothetical protein ZEAMMB73_662182 [Zea mays]
Length=575

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 178/232 (77%), Gaps = 2/232 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT +FF TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  338  DVSNEMLHFDFYEDRLGGNATADFFSTARRADPLATLFLNDFNVVEACDDLSSSADSYVS  397

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            ++++L    G++ +GIGLEGHF+ PN P +RA+LDKL TLRLP+WLTE+D++  +   TQ
Sbjct  398  RLRQLADDAGVTFEGIGLEGHFAKPNVPYVRAVLDKLGTLRLPVWLTEVDVSAAFDHATQ  457

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQT  225
            A YLE VLRE F+HPAV GI+LWTA+     C+QMCLTD +  NLPAGDVVD LL EWQT
Sbjct  458  AAYLEDVLREGFAHPAVDGIVLWTAMGANATCYQMCLTDADFTNLPAGDVVDRLLGEWQT  517

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + + G TD+ GS++F  F GEY++SV Y NRTA +TFSL R ++T+H  I+L
Sbjct  518  KEVLGATDDRGSFNFSAFYGEYRLSVTYLNRTADATFSLPRSDDTKHINIRL  569



>ref|NP_001152556.1| hydrolase, hydrolyzing O-glycosyl compounds precursor [Zea mays]
 gb|ACG48190.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
Length=571

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 178/232 (77%), Gaps = 2/232 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YE RLG +AT +FF TA  ADPLATLF+NDFNVVE C D  S+ D+Y+S
Sbjct  334  DVSNEMLHFDFYEDRLGGNATADFFSTARRADPLATLFLNDFNVVEACDDLSSSADSYVS  393

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            ++++L    G++ +GIGLEGHF+ PN P +RA+LDKL TLRLP+WLTE+D++  +   TQ
Sbjct  394  RLRQLADDAGVTFEGIGLEGHFAKPNVPYVRAVLDKLGTLRLPVWLTEVDVSAAFDHATQ  453

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEWQT  225
            A YLE VLRE F+HPAV GI+LWTA+     C+QMCLTD +  NLPAGDVVD LL EWQT
Sbjct  454  AAYLEDVLREGFAHPAVDGIVLWTAMGANATCYQMCLTDADFTNLPAGDVVDRLLGEWQT  513

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            + + G TD+ GS++F  F GEY++SV Y NRTA +TFSL R ++T+H  I+L
Sbjct  514  KEVLGATDDRGSFNFSAFHGEYRLSVTYLNRTADATFSLPRSDDTKHINIRL  565



>ref|XP_010327543.1| PREDICTED: endo-1,4-beta-xylanase A-like [Solanum lycopersicum]
Length=488

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 175/231 (76%), Gaps = 2/231 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE+LHFD YE++LGP ATL+ FK+    DPL TLF+N++N+VE C D K+ VD+YI 
Sbjct  259  DVNNELLHFDFYEKKLGPKATLDMFKSMQREDPLTTLFLNEYNIVERC-DSKANVDSYID  317

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            + KELK+GG+ + GIGLE HFSAPNP  +RA+LDKLATL+LP+WLTE+D++  YGQE QA
Sbjct  318  RFKELKKGGVKVAGIGLESHFSAPNPAFMRAVLDKLATLKLPMWLTEVDVSNMYGQEEQA  377

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNL-LKEWQTQ  222
            ++LE +LRE FSHP+V+GIMLWTA S  GC+Q CLTD    NLP GDV+D L L EW T 
Sbjct  378  VFLEQILREAFSHPSVNGIMLWTARSIGGCYQTCLTDEKFQNLPTGDVIDQLVLNEWTTG  437

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
            T  G T+E GSY+F GFLGE+KVS+ Y      STFSL  G +T+H  I +
Sbjct  438  TKRGKTNEFGSYNFRGFLGEFKVSIIYNRTIVNSTFSLGHGVDTKHITIHV  488



>ref|XP_002989316.1| hypothetical protein SELMODRAFT_129690, partial [Selaginella 
moellendorffii]
 gb|EFJ09590.1| hypothetical protein SELMODRAFT_129690, partial [Selaginella 
moellendorffii]
Length=554

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 150/212 (71%), Gaps = 2/212 (1%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLHF+ +E +LG +A +E +K A E DP  TLF+NDFNV+E   D  S  D Y+ 
Sbjct  323  DVLNEMLHFNFFESKLGSNAAVEIYKFAQEIDPETTLFLNDFNVIEVPQDSMSLPDNYVH  382

Query  578  KMKELKQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            ++ E+K  GI   GIGLEGHFS  PN   +RA+LDKLATL LPIWLTE+DI      E Q
Sbjct  383  RLLEMKAAGIKKLGIGLEGHFSGKPNLVYMRAVLDKLATLELPIWLTEVDIMNSVDSENQ  442

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYL+ VLRE FSHPAV GI+LWTA+ P GC++MCLTD N  NLPAG+ VD  LK  +T 
Sbjct  443  AIYLQQVLREAFSHPAVKGIVLWTALHPYGCYRMCLTDQNFKNLPAGNTVDVFLKNIRTV  502

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTA  126
             L G TD  GS+SF GF GEY++SV + NRT+
Sbjct  503  GLSGTTDHEGSFSFQGFHGEYEISVTH-NRTS  533



>ref|XP_002980942.1| hypothetical protein SELMODRAFT_420481 [Selaginella moellendorffii]
 gb|EFJ18127.1| hypothetical protein SELMODRAFT_420481 [Selaginella moellendorffii]
Length=586

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 143/212 (67%), Gaps = 20/212 (9%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NEMLHF+ +E +LG +A +E +K A E DP  TLF+NDFNV+E              
Sbjct  373  DVLNEMLHFNFFESKLGSNAAVEIYKFAQEIDPETTLFLNDFNVIE--------------  418

Query  578  KMKELKQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
                +K  GI   GIGLEGHFS  PN   +RA+LDKLATL LPIWLTE+DI      E Q
Sbjct  419  ----MKAAGIKKLGIGLEGHFSGKPNLVYMRAVLDKLATLELPIWLTEVDIMNSVDSENQ  474

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            AIYL+ VLRE FSHPAV GI+LWTA+ P GC++MCLTD N  NLPAG++VD  LK  +T 
Sbjct  475  AIYLQQVLREAFSHPAVKGIVLWTALHPYGCYRMCLTDQNFKNLPAGNIVDVFLKNIRTV  534

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTA  126
             L G TD  GS+SF GF GEY++SV + NRT+
Sbjct  535  GLSGTTDHEGSFSFQGFHGEYEISVTH-NRTS  565



>ref|NP_001173304.1| Os03g0201901 [Oryza sativa Japonica Group]
 dbj|BAH92032.1| Os03g0201901 [Oryza sativa Japonica Group]
Length=412

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 146/237 (62%), Gaps = 11/237 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E R G +A+  F++ AH+ D  A + MN+FN +E   D       Y+ 
Sbjct  180  DVVNENLHFDFFEGRFGWEASAAFYRKAHQMDGGALMSMNEFNTLEQPGDLTVLPGKYLR  239

Query  578  KMKELK----QGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+ ++K     G  +  GIGLEGHFSA PN P IRA LD +A    PIWLTEID+     
Sbjct  240  KLWQIKAFPGNGNAARMGIGLEGHFSAQPNIPYIRAALDTMAQANAPIWLTEIDVAPG--  297

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE +LREV++HPAV GI+LWTA  P+GC+ MCLTDNN  NLPAGDVVD L+ E
Sbjct  298  -PDQARHLEQILREVYAHPAVHGIILWTAWHPQGCYVMCLTDNNFKNLPAGDVVDKLIWE  356

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEETRHFRIQL  69
            W+T++  G  D  G Y    F G+YKV+V +   N T   + S++R E    F I +
Sbjct  357  WKTRSHVGVADADGYYETELFHGDYKVTVTHPAANSTVAQSLSVDR-ESDNEFTIHV  412



>ref|XP_004985301.1| PREDICTED: uncharacterized protein LOC101779072 [Setaria italica]
Length=571

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 145/231 (63%), Gaps = 9/231 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E + G DA+  F++ AH+ D  A + MN+FN +E   DP +    Y+ 
Sbjct  338  DVVNENLHFSFFEGKFGWDASAAFYRKAHQMDGNALMSMNEFNTLEQPGDPNAVPGKYLG  397

Query  578  KMKELKQ-GGISMDG---IGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K+ ++K+  G + DG   IGLEGHFS PN P IRA LD ++   +PIWLTEID+      
Sbjct  398  KLFQIKKFPGNTNDGRMAIGLEGHFSTPNIPYIRAALDTMSKAGVPIWLTEIDVAPG---  454

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA  LE +LREV+SHPAV GI+LWTA   +GC+ MCLTDNN  NLP GDVVD L++EW
Sbjct  455  PNQAANLEKILREVYSHPAVHGIILWTAWHQQGCYVMCLTDNNFRNLPTGDVVDKLIREW  514

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEETRH  84
            QT++  G  D  G Y    F G+Y+V+V +   N T   + S++R  +  H
Sbjct  515  QTRSHAGVADADGYYEAELFHGDYEVTVSHPAANSTVVQSLSVDRKTDPNH  565



>ref|XP_007042651.1| Glycosyl hydrolase family 10 protein, putative [Theobroma cacao]
 gb|EOX98482.1| Glycosyl hydrolase family 10 protein, putative [Theobroma cacao]
Length=578

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 136/211 (64%), Gaps = 9/211 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG DA+  F+K AH+ DP  TLFMN+FN +E   D  ST   Y+ 
Sbjct  341  DVVNENLHFNFFESKLGEDASSTFYKMAHDIDPSTTLFMNEFNTIEESGDSASTPAKYLD  400

Query  578  KMKELKQGGISMDG----IGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K+K   Q  +  +G    IGLE HFS PN P IR+ LD LA  +LPIWLTE+D+      
Sbjct  401  KLKS-AQAMLGANGNQMAIGLESHFSVPNLPYIRSSLDTLAATKLPIWLTEVDVK---SD  456

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA++LE VLRE   HP V+GI++W+A   +GC++MCLTDNN  NL  GDVVD LLKEW
Sbjct  457  PNQAMFLEQVLREGHDHPGVAGIIIWSAWKSQGCYRMCLTDNNFQNLATGDVVDKLLKEW  516

Query  230  QTQ-TLEGGTDEHGSYSFMGFLGEYKVSVEY  141
              + TLEG TD  G +    F GEY+V + +
Sbjct  517  GIKTTLEGNTDADGFFEASLFHGEYEVKITH  547



>ref|XP_007042652.1| Glycosyl hydrolase family 10 protein [Theobroma cacao]
 gb|EOX98483.1| Glycosyl hydrolase family 10 protein [Theobroma cacao]
Length=574

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 136/216 (63%), Gaps = 6/216 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG  A+ +F+K AH  D    LF+ND+N +E   D KS    Y+ 
Sbjct  342  DVVNENLHFSFFESKLGKQASAKFYKLAHLVDGTVPLFLNDYNTIEDSRDGKSAAAKYLQ  401

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++E+K       S  GIGLEGHFS PN P +RA +D LA   LPIWLTE+D+       
Sbjct  402  KLREIKAFPGNSNSRMGIGLEGHFSTPNLPYMRASIDTLAATGLPIWLTELDVQ---SSP  458

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE VLRE  SHP V GI++W A  P+GC++MCLTDN+  NLP GDVVD LL++W 
Sbjct  459  NQAKYLEQVLREAHSHPKVDGIVMWAAWKPQGCYRMCLTDNSFKNLPTGDVVDKLLQQWD  518

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
            ++ L G TD  G +    F G+Y+V+V + +  A S
Sbjct  519  SKALLGFTDSDGFFEASLFHGDYEVNVTHPSSLAHS  554



>gb|EEC74705.1| hypothetical protein OsI_10421 [Oryza sativa Indica Group]
Length=579

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 146/237 (62%), Gaps = 11/237 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E R G +A+  F++ AH+ D  A + MN+FN +E   D       Y+ 
Sbjct  347  DVVNENLHFDFFEGRFGWEASAAFYRKAHQMDGGALMSMNEFNTLEQPGDLTVLPGKYLR  406

Query  578  KMKELK----QGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+ ++K     G  +  GIGLEGHFSA PN P IRA LD +A    PIWLTEID+     
Sbjct  407  KLWQIKAFPGNGNAARMGIGLEGHFSAQPNIPYIRAALDTMAQANAPIWLTEIDVAPG--  464

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE +LREV++HPAV GI+LWTA  P+GC+ MCLTDNN  NLPAGDVVD L+ E
Sbjct  465  -PDQARHLEQILREVYAHPAVHGIILWTAWHPQGCYVMCLTDNNFKNLPAGDVVDKLIWE  523

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEETRHFRIQL  69
            W+T++  G  D  G Y    F G+YKV+V +   N T   + S++R E    F I +
Sbjct  524  WKTRSHVGVADADGYYETELFHGDYKVTVTHPAANSTVAQSLSVDR-ESDNEFTIHV  579



>ref|XP_002465685.1| hypothetical protein SORBIDRAFT_01g043720 [Sorghum bicolor]
 gb|EER92683.1| hypothetical protein SORBIDRAFT_01g043720 [Sorghum bicolor]
Length=584

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 145/229 (63%), Gaps = 9/229 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E + G DA+ EF++ AH+ D  A + MN++N +E   DP +    Y+ 
Sbjct  351  DVVNENLHFNYFEGKFGWDASAEFYRKAHQLDAQALMSMNEYNTLEWPGDPMAGPSKYLG  410

Query  578  KMKELKQ-GGISMDG---IGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K+ ++K+  G + D    IGLEGHFS P+ P IRA LD ++    PIWLTEID+      
Sbjct  411  KLFQIKKFPGNANDARMAIGLEGHFSVPSIPYIRAALDTMSKANAPIWLTEIDVAPG---  467

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA YLE +LREV++HPAV GI+LWTA  P+GC+ MCLTD+N  NLP GDVVD L+ EW
Sbjct  468  PNQAHYLEQILREVYAHPAVHGIILWTARHPQGCYVMCLTDSNFRNLPTGDVVDKLIAEW  527

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEET  90
            +T +  G  D  G Y    F G+YKV+V +   N T   + S++R  +T
Sbjct  528  KTHSHAGVADADGYYEAELFHGDYKVTVSHPVANSTVVQSLSVDRETDT  576



>gb|ABF94510.1| 1,4-beta-xylanase, putative, expressed [Oryza sativa Japonica 
Group]
Length=579

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 146/237 (62%), Gaps = 11/237 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E R G +A+  F++ AH+ D  A + MN+FN +E   D       Y+ 
Sbjct  347  DVVNENLHFDFFEGRFGWEASAAFYRKAHQMDGGALMSMNEFNTLEQPGDLTVLPGKYLR  406

Query  578  KMKELK----QGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+ ++K     G  +  GIGLEGHFSA PN P IRA LD +A    PIWLTEID+     
Sbjct  407  KLWQIKAFPGNGNAARMGIGLEGHFSAQPNIPYIRAALDTMAQANAPIWLTEIDVAPG--  464

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE +LREV++HPAV GI+LWTA  P+GC+ MCLTDNN  NLPAGDVVD L+ E
Sbjct  465  -PDQARHLEQILREVYAHPAVHGIILWTAWHPQGCYVMCLTDNNFKNLPAGDVVDKLIWE  523

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEETRHFRIQL  69
            W+T++  G  D  G Y    F G+YKV+V +   N T   + S++R E    F I +
Sbjct  524  WKTRSHVGVADADGYYETELFHGDYKVTVTHPAANSTVAQSLSVDR-ESDNEFTIHV  579



>ref|XP_006651142.1| PREDICTED: uncharacterized protein LOC102719572 [Oryza brachyantha]
Length=579

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 145/237 (61%), Gaps = 11/237 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E R G +A+  F++ AH+ D  A + MN+FN +E   D       Y+ 
Sbjct  347  DVVNENLHFDFFEGRFGWEASAAFYRKAHQMDGGALMSMNEFNTLEQPGDLTVVPGKYLR  406

Query  578  KMKELK----QGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+ ++K     G  +   IGLEGHFSA PN P IRA LD +A    PIWLTEID+     
Sbjct  407  KLWQIKAFPGNGNAARMAIGLEGHFSAQPNIPYIRAALDTMAQANAPIWLTEIDVAPG--  464

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE +LREV+SHPAV GI+LWTA  P+GC+ MCLTDNN  NLPAGDVVD L+ E
Sbjct  465  -PDQARHLEQILREVYSHPAVHGIILWTAWHPQGCYVMCLTDNNFRNLPAGDVVDKLIWE  523

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEETRHFRIQL  69
            W+T++  G  D  G Y    F G+YKV+V +   N T   + S++R E    F I +
Sbjct  524  WKTRSHVGVADADGYYETEMFHGDYKVTVTHPAANSTVAQSLSVDR-ESDNEFTIHV  579



>ref|XP_006487065.1| PREDICTED: uncharacterized protein LOC102624921, partial [Citrus 
sinensis]
Length=565

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 136/220 (62%), Gaps = 8/220 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG DA+  FF   H  D   TLFMND+N +E   D K+T  TY+ 
Sbjct  328  DVVNENLHFSFFESKLGQDASGVFFNRVHSLDGATTLFMNDYNTIEDSRDGKATPATYLQ  387

Query  578  KMKELKQ--GGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++++ Q  G  ++  GIGLE HFS PN P +RA +D L    LPIWLTE+D+       
Sbjct  388  KLRQISQFPGNQNLRIGIGLESHFSTPNIPYMRASIDTLGATGLPIWLTEVDVQ---SSP  444

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE +LRE  +HP V GI++W A  P GC++MCLTDNN  NL  GDVVD LL EW 
Sbjct  445  NQAQYLEQILREAHAHPKVQGIVVWAAWKPSGCYRMCLTDNNFKNLATGDVVDKLLHEWG  504

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
            ++ LEG TD  G +    F G+Y+V +    + A + FS+
Sbjct  505  SKRLEGKTDADGFFDTTLFHGDYEVKIT--RQAANTIFSM  542



>ref|NP_001169055.1| putative glycosyl hydrolase family 10 protein precursor [Zea 
mays]
 gb|ACN31540.1| unknown [Zea mays]
 gb|AFW89314.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=575

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E R G DA+ E ++ AH+ D  A + MN+FN +E   DPK+    Y+ 
Sbjct  342  DVVNENLHFRFFEDRFGRDASAELYRKAHQMDGQALVSMNEFNTLEWPGDPKAGPSKYLG  401

Query  578  KMKELKQ-GGISMDG---IGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K+ ++K+  G + D    IGL+GHFS P+ P IRA LD L+    PIWLTEID+      
Sbjct  402  KLFQIKEFPGNTNDARMAIGLQGHFSVPSIPYIRAALDTLSRANAPIWLTEIDVAPG---  458

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA +LE +LREV++HPAV GI+LWTA   +GC+ MCLTDNN  NLP GDVVD L+ EW
Sbjct  459  PNQAYHLEQILREVYAHPAVHGIILWTARHRQGCYVMCLTDNNFQNLPTGDVVDRLIAEW  518

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNR  102
            +T +  G  D  G Y    F G+YKV+V +   N T   + S++R
Sbjct  519  KTHSHAGVADADGYYEAELFHGDYKVTVSHPAANSTVVQSLSVDR  563



>ref|XP_008652268.1| PREDICTED: uncharacterized protein LOC103632224 [Zea mays]
 tpg|DAA43928.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=580

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 144/229 (63%), Gaps = 9/229 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E + G DA+ EF++ AH+ D  A + MN++N +E   D  +    Y+ 
Sbjct  347  DVVNENLHFQFFEDKFGWDASAEFYRRAHQMDGQALMSMNEYNTLEWPGDTLAGPSKYLG  406

Query  578  KMKELKQ-GGISMDG---IGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K+ ++K+  G + D    IGLEGHFS P+ P IRA LD ++    PIWLTEID+      
Sbjct  407  KLFQIKKFPGNANDARMAIGLEGHFSVPSIPYIRAALDTMSKANAPIWLTEIDVAPG---  463

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA YLE +LREV++HPAV GI+LWTA  P+GC+ MCLTD+N  NLP GDVVD L+ EW
Sbjct  464  PNQAHYLEQILREVYAHPAVHGIILWTARHPQGCYVMCLTDDNFRNLPTGDVVDKLIAEW  523

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEET  90
            +T +L G  D  G Y    F G+YKV+V +   N T   + S++R  +T
Sbjct  524  KTHSLAGVADADGYYEAELFHGDYKVTVSHPVANSTVVQSLSIDRETDT  572



>ref|XP_009783073.1| PREDICTED: uncharacterized protein LOC104231720 [Nicotiana sylvestris]
Length=577

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 135/215 (63%), Gaps = 4/215 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF   EQ LG +A+  ++K A+E D  A  F+NDFN +E   D  S    Y+ 
Sbjct  342  DVVNENVHFSFLEQMLGKNASAVYYKKANEIDSKAIPFLNDFNTIEHGFDGTSNPAKYLE  401

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+KEL+  G +   GIGL+GHF  PN P IR+ LD LA+  LPIW+TE+D+     QE  
Sbjct  402  KIKELRSHGYNGPLGIGLQGHFVTPNLPYIRSSLDILASTGLPIWITELDVANTTNQE--  459

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             +YLE ++REV +HP V GIM+W   +PKGC++MCLTDNN  NLP GDVVD ++KEW   
Sbjct  460  -VYLEEIIREVHAHPGVKGIMMWAPWNPKGCYRMCLTDNNFKNLPTGDVVDKIIKEWNHH  518

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATST  117
               G TDE+G +    F GEY+  + + ++    T
Sbjct  519  DFSGNTDENGFFEASLFHGEYQFEISHPDQVKYDT  553



>gb|KCW55100.1| hypothetical protein EUGRSUZ_I01059, partial [Eucalyptus grandis]
Length=552

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 133/206 (65%), Gaps = 5/206 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +H   +E RLGP A+   +KTA   DP  TLF+N++N +E   D  ++   Y  
Sbjct  320  DVVNENIHLSFFESRLGPQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDTVASPTAYAK  379

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+++  G    GIGL+GHF+ P+ P +R+ +D L  L LP+WLTE+D+      E QA
Sbjct  380  KIKDIQSSGGGNLGIGLQGHFNVPDLPYMRSAIDALGALGLPMWLTEVDVQSG---ENQA  436

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--QT  225
            +YLE VLRE  +HP ++GI+LWTA  P+GC++MCLTDNN  NLP GDVVD LLKEW    
Sbjct  437  MYLEQVLREAHAHPKINGIVLWTAWKPEGCYRMCLTDNNFRNLPTGDVVDKLLKEWGGGG  496

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSV  147
            Q L G T   G+     F G+Y+V+V
Sbjct  497  QVLSGTTGPDGALEASLFHGDYQVTV  522



>gb|EMT33548.1| Endo-1,4-beta-xylanase A [Aegilops tauschii]
Length=542

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 141/230 (61%), Gaps = 15/230 (7%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E++ G  A+  F++ AH  D  A + MNDFN +E   D       Y++
Sbjct  307  DVVNENLHFDFFEEKFGAGASAAFYQKAHGMDGGALMSMNDFNTLEQPGDQNGLPAKYLN  366

Query  578  KMKELKQG------GISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKK  420
            K+ ++K        G+ M  IGLEGHF A PN P +RA LD L+   +PIWLTEID+ + 
Sbjct  367  KLSQIKDAFPGNGIGVRM-AIGLEGHFGATPNIPYVRAALDTLSQAGVPIWLTEIDVQRG  425

Query  419  YGQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLL  240
                 QA +LE VLREV+SHPAV GI+LWTA  P+GC+ MCLTD+N NNLP GD VD L+
Sbjct  426  ---PDQAYHLEQVLREVYSHPAVHGIVLWTAWHPQGCYVMCLTDDNFNNLPVGDTVDKLI  482

Query  239  KEWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY----GNRTATSTFSLNR  102
             EW+T +  G  D  G Y    F G+Y+V+V +     N T   + S++R
Sbjct  483  AEWKTSSHVGVADADGHYEAELFHGDYQVTVTHPAAAANSTVVQSLSVDR  532



>ref|XP_010030622.1| PREDICTED: endo-1,4-beta-xylanase-like [Eucalyptus grandis]
Length=572

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 133/206 (65%), Gaps = 5/206 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +H   +E RLGP A+   +KTA   DP  TLF+N++N +E   D  ++   Y  
Sbjct  340  DVVNENIHLSFFESRLGPQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDTVASPTAYAK  399

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K+++  G    GIGL+GHF+ P+ P +R+ +D L  L LP+WLTE+D+      E QA
Sbjct  400  KIKDIQSSGGGNLGIGLQGHFNVPDLPYMRSAIDALGALGLPMWLTEVDVQSG---ENQA  456

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--QT  225
            +YLE VLRE  +HP ++GI+LWTA  P+GC++MCLTDNN  NLP GDVVD LLKEW    
Sbjct  457  MYLEQVLREAHAHPKINGIVLWTAWKPEGCYRMCLTDNNFRNLPTGDVVDKLLKEWGGGG  516

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSV  147
            Q L G T   G+     F G+Y+V+V
Sbjct  517  QVLSGTTGPDGALEASLFHGDYQVTV  542



>ref|XP_006422817.1| hypothetical protein CICLE_v10030382mg [Citrus clementina]
 gb|ESR36057.1| hypothetical protein CICLE_v10030382mg [Citrus clementina]
Length=580

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 137/221 (62%), Gaps = 10/221 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG +A+  FF   H  D   TLFMND+N +E   D K+T   Y+ 
Sbjct  343  DVVNENLHFSFFESKLGQNASGVFFNRVHSLDGATTLFMNDYNTIEDSRDGKATPAMYLQ  402

Query  578  KMKELKQ--GGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++++ +  G  ++  GIGLE HFS PN P +RA +D L    LPIWLTE+D+       
Sbjct  403  KLRQISEFPGNQNLRIGIGLESHFSTPNIPYMRASIDTLGATGLPIWLTEVDVQ---SSP  459

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE +LRE  +HP V GI++W A  P GC++MCLTDNN  NL  GDVVD LL EW 
Sbjct  460  NQAQYLEQILREAHAHPKVQGIVVWAAWKPSGCYRMCLTDNNFKNLATGDVVDKLLHEWG  519

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATST-FSL  108
            ++ LEG TD  G +    F G+Y+V +   NR A +T FS+
Sbjct  520  SKRLEGKTDADGFFDTTLFHGDYEVKI---NRQAANTIFSM  557



>ref|XP_003561934.2| PREDICTED: uncharacterized protein LOC100835383 [Brachypodium 
distachyon]
Length=579

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 136/222 (61%), Gaps = 8/222 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HFD YE + G  A+  F++ AH+ D  A + MND+N +E   D       Y+ 
Sbjct  347  DVVNENVHFDFYEGKFGWQASPAFYRKAHQIDGGALMSMNDYNTLEQPGDTNCLPSKYLR  406

Query  578  KMKELK----QGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+ ++K     G  +   IGLEGHFSA PN P +RA LD +A   +PIW+TEID+     
Sbjct  407  KLWQIKGFPGNGNAARMAIGLEGHFSAEPNIPYVRAALDAMAQANVPIWVTEIDVQPG--  464

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE V+REV+SHPAV GI+LWTA  P+GC+ MCLTDN   NLP GDVVD L+ E
Sbjct  465  -PNQAWHLEQVMREVYSHPAVHGIVLWTAWHPQGCYVMCLTDNGFRNLPVGDVVDKLIGE  523

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
            W+T +  G  D  G Y    F GEYKV+V +    +T+  SL
Sbjct  524  WKTHSHVGVADAEGYYEAELFHGEYKVTVAHPAANSTAVQSL  565



>gb|EMS46048.1| Endo-1,4-beta-xylanase C [Triticum urartu]
Length=611

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E++ G  A+  F++ AH  D  A + MNDFN +E  +DP      Y++
Sbjct  376  DVVNENLHFDFFEEKFGAGASAAFYQKAHGMDGGALMSMNDFNTLEQPTDPNGLPSKYLN  435

Query  578  KMKELKQG------GISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKK  420
            K+ ++K        G+ M  IGLEGHF A P+ P +RA LD L+   +PIW+TE+D+  K
Sbjct  436  KLSQIKDAFPGNGIGVRM-AIGLEGHFGATPSIPYVRAALDTLSQAGVPIWVTEVDV--K  492

Query  419  YGQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLL  240
             G + QA +LE VLREV+SHPAV GI+LWTA  P GC+ MCLTD+N NNLP GD VD L+
Sbjct  493  AGPD-QAYHLEQVLREVYSHPAVHGIVLWTAWHPTGCYVMCLTDDNFNNLPVGDTVDKLI  551

Query  239  KEWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY----GNRTATSTFSLNR  102
             EW+T +  G  D  G Y    F G+Y+V+V +     N T   + S++R
Sbjct  552  AEWKTTSHVGVADADGHYDAELFHGDYQVTVTHPAAAANSTVVQSLSVDR  601



>gb|EEE58525.1| hypothetical protein OsJ_09814 [Oryza sativa Japonica Group]
Length=992

 Score =   208 bits (529),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 145/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E R G +A+  F++ AH+ D  A + MN+FN +E   D       Y+ 
Sbjct  347  DVVNENLHFDFFEGRFGWEASAAFYRKAHQMDGGALMSMNEFNTLEQPGDLTVLPGKYLR  406

Query  578  KMKELK----QGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+ ++K     G  +  GIGLEGHFSA PN P IRA LD +A    PIWLTEID+     
Sbjct  407  KLWQIKAFPGNGNAARMGIGLEGHFSAQPNIPYIRAALDTMAQANAPIWLTEIDVAPG--  464

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE +LREV++HPAV GI+LWTA  P+GC+ MCLTDNN  NLPAGDVVD L+ E
Sbjct  465  -PDQARHLEQILREVYAHPAVHGIILWTAWHPQGCYVMCLTDNNFKNLPAGDVVDKLIWE  523

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSLNRGEETRHFRIQ  72
            W+T++  G  D  G Y    F G+YKV+V +   N T   + S++R E    F I 
Sbjct  524  WKTRSHVGVADADGYYETELFHGDYKVTVTHPAANSTVAQSLSVDR-ESDNEFTIH  578


 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG DA+ E F+   + D    LFMN+FN +E  +D       Y++
Sbjct  868  DVVNENLHFNFFEGKLGKDASAEIFRDVAKLDSKPILFMNEFNTIEEPNDAAPLPTKYVA  927

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDIN  426
            K+K++++   + D   GIGLE HF+APN P +R  +D LA  ++PIWLTE+D+ 
Sbjct  928  KLKQIREFPGNADLKYGIGLESHFAAPNIPYMRGSIDTLAQAKVPIWLTEVDVK  981



>dbj|BAJ94973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 142/230 (62%), Gaps = 15/230 (7%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHFD +E + G  A+  F++ AH  D  A + MNDFN +E  +D       Y+S
Sbjct  350  DVVNENLHFDYFEDKFGAGASAAFYQKAHGMDGGALMSMNDFNTLEQPADQSGLPSKYLS  409

Query  578  KMKELKQG------GISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKK  420
            K+ ++K        G+ M  IGLEGHF A PN P +RA LD L+   +PIWLTEID+  K
Sbjct  410  KLSQIKDAFPGNGVGVRM-AIGLEGHFGATPNIPYVRAALDTLSQAGVPIWLTEIDV--K  466

Query  419  YGQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLL  240
             G + QA +LE VLREV+SHPAV GI+LWTA  P+GC+ MCLTD+N NNLP GD VD L+
Sbjct  467  PGPD-QAHHLEQVLREVYSHPAVHGIVLWTAWHPQGCYVMCLTDDNFNNLPVGDTVDKLI  525

Query  239  KEWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY----GNRTATSTFSLNR  102
             EW+T +  G  D  G Y    F G+Y V+V +     N T   + S++R
Sbjct  526  AEWKTSSHVGVADADGHYDAELFHGDYNVTVTHPAAAANSTVVQSLSVHR  575



>ref|XP_009406783.1| PREDICTED: endo-1,4-beta-xylanase C-like [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 135/205 (66%), Gaps = 5/205 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +H   YE +LG +A+  F++ AH+ DP A +F+NDFN +E   D K+T + Y+ 
Sbjct  329  DVVNENIHNTYYEDKLGENASSIFYQQAHQLDPNALMFLNDFNTLEAPVDDKATPEKYLQ  388

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            ++++++  G +    IGLE HF+ P+   +R+ LDKLA   +PIWLTE+D+        +
Sbjct  389  RLQQIRSFGNLPRMAIGLESHFTIPDISYVRSALDKLAGANVPIWLTELDV----ANSNE  444

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            + YLE VLRE +SHPAV GI++W A  P+GC++MCLTDNN  NLP GDVVD L+ EW++ 
Sbjct  445  SKYLEDVLREAYSHPAVQGIVMWGAWHPQGCWRMCLTDNNFKNLPTGDVVDKLIFEWKSD  504

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSV  147
             L   TD  G Y    F GEYK++V
Sbjct  505  NLAATTDADGLYRVELFHGEYKITV  529



>gb|KHG02913.1| endo-1,4-beta-xylanase c [Gossypium arboreum]
Length=529

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 137/229 (60%), Gaps = 7/229 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGPDA   F+K A   D    LFMN+FN +E   D  ST   Y+ 
Sbjct  291  DVVNENLHFNFFESKLGPDAAATFYKMAAGIDHSIPLFMNEFNTLEQKGDAASTPAKYLE  350

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K ++           IGLE HF  P+ P IR+ LD LA   LPIWLTEID+  K G  
Sbjct  351  KLKNIQTFMGAEAKRMAIGLECHFDVPSLPYIRSSLDTLAATNLPIWLTEIDV--KSG-P  407

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            +QA+YLE VLRE  SHP VSG+++W+A  P GC++MCLTDNN  NL  GDVVD LLKEW 
Sbjct  408  SQAMYLEQVLREGHSHPGVSGMIIWSAWKPNGCYRMCLTDNNFKNLATGDVVDKLLKEWG  467

Query  227  TQ-TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRH  84
             + T+E  TD  G +    F GEY+V +      A S+ S     E RH
Sbjct  468  IKATVEAKTDAAGFFEASLFHGEYEVKISDPVEAANSSVSQRFKVEPRH  516



>ref|NP_001173303.1| Os03g0201400 [Oryza sativa Japonica Group]
 dbj|BAH92031.1| Os03g0201400 [Oryza sativa Japonica Group]
Length=339

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 142/234 (61%), Gaps = 12/234 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATL-FMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF  +E+R G DA+  F+  A   D  +TL FMN++N +E   D  +    Y+
Sbjct  107  DVVNENLHFSFFERRFGWDASTAFYAAARMLDTGSTLMFMNEYNTLEQPGDMAALPARYV  166

Query  581  SKMKEL----KQGGISMDGIGLEGHFSAP-NPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             ++K++     Q G  M  IGLEGHF+AP N P +RA LD LA   +P+WLTE+D+    
Sbjct  167  QRLKQIIGGYPQNGAGM-AIGLEGHFTAPVNIPYMRAALDTLAQAGVPVWLTEVDVG---  222

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
            G  +QA YLE +LRE ++HPAV G++LW A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  223  GGASQAYYLEEILREAYAHPAVQGVILWAAWRPQGCYVMCLTDNDFNNLPQGDVVDRLIT  282

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHF  81
            EW T    G TD  G +      GEYKV+V +   N + + +  +  G  + +F
Sbjct  283  EWSTAPRAGTTDAEGFFQAELAHGEYKVTVTHPSLNTSVSQSVKVEMGSGSHYF  336



>gb|KCW55101.1| hypothetical protein EUGRSUZ_I01060, partial [Eucalyptus grandis]
Length=553

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LGP A+   +KTA   DP  TLF+N++N +E   D  S+   Y +
Sbjct  320  DVVNENLHFSFFESKLGPQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDRTSSPTAYAN  379

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K ++  G    GIGLE HF+ P+ P +R+ +D L  L LP+WLTE+D+    G   +A
Sbjct  380  KVKSIQSLGGRNLGIGLESHFNVPDLPYMRSAIDTLGALGLPMWLTEVDVQS--GPNQKA  437

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--QT  225
            +YLE VLRE  +HP ++GI++WTA  P+GC++MCLTDNN  NLP GDVVD LLKEW    
Sbjct  438  MYLEQVLREAHAHPKINGIVMWTAWKPEGCYRMCLTDNNFRNLPTGDVVDKLLKEWGGGR  497

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSV  147
            + L G T   G+     F G+Y+V+V
Sbjct  498  KELSGMTSPDGTLEASLFHGDYQVTV  523



>ref|XP_008787230.1| PREDICTED: endo-1,4-beta-xylanase D-like [Phoenix dactylifera]
Length=535

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 142/235 (60%), Gaps = 8/235 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E RLG +A+  F + AH       +F+ND+N +E   DP ST   Y+ 
Sbjct  304  DVVNEDLHFSSFEDRLGKNASNIFHQKAHSLGSNTLMFLNDYNTLEQPGDPTSTPGKYLE  363

Query  578  KMKELKQ--GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQET  405
            K++E+K   G      IGLEGHF APN P +R+ LD LA  ++PIWLTE+D+ +      
Sbjct  364  KLREVKSYPGNDYNMAIGLEGHFGAPNIPYMRSALDVLAGAKVPIWLTEVDVTQ---DPN  420

Query  404  QAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQT  225
            QA YLE +LRE +SHPAV+GI+LW    P+ C +MCLTDNN NN P GDVVD L+ EW++
Sbjct  421  QANYLEEILREAYSHPAVNGIVLWAGWHPESCNRMCLTDNNFNNHPTGDVVDKLIAEWRS  480

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRH---FRIQL  69
              + G TD  G +    F GEY++S+      ++S  SL     + H    R+Q+
Sbjct  481  GNVTGKTDADGFFETQLFHGEYEMSISDPTANSSSVQSLKVESGSPHGAVIRVQV  535



>ref|XP_006841091.1| hypothetical protein AMTR_s00086p00056140 [Amborella trichopoda]
 gb|ERN02766.1| hypothetical protein AMTR_s00086p00056140 [Amborella trichopoda]
Length=501

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 141/234 (60%), Gaps = 7/234 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  YE RLG + T ++F+   + D  ATLFMND+N +E   D  ST D YI 
Sbjct  269  DVMNENLHFHFYEDRLGSNITDQYFQKVGQIDEKATLFMNDYNTLEQSEDHDSTPDKYIG  328

Query  578  KMKELKQ--GGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+KE++   G   +  GIGLE HF  PN P +RA LD L    LP+W+TE+D+       
Sbjct  329  KLKEIQAFLGNNRVPLGIGLESHFQKPNMPYVRATLDLLGATGLPVWITELDVTP---DP  385

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA  LE +LRE +SHP V GI++WT   P+GC+ MCLTDNN  NLP GDVVD L+KEW 
Sbjct  386  NQAQNLEAILRETYSHPYVQGIIMWTGWHPEGCYNMCLTDNNFKNLPTGDVVDKLIKEWG  445

Query  227  TQ-TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRHFRIQL  69
             + +L G TD  G +  +   G+Y++ +   N  ++ST  L    ++    +Q+
Sbjct  446  IKRSLVGKTDRDGIFETLVPHGKYEIIITNPNTNSSSTHILEVTMDSEEHHVQV  499



>gb|AAN10199.1| endoxylanase [Carica papaya]
Length=584

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 157/242 (65%), Gaps = 16/242 (7%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG +A+  F+  AH+ DP  TLFMN++N VE   D ++T   Y+ 
Sbjct  344  DVVNENLHFSFFESKLGANASAVFYGEAHKTDPSTTLFMNEYNTVEDSRDGQATPAKYLE  403

Query  578  KMKELKQ--GGISMDGIGLEGHFSA--PNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++ ++   G  +M GIGLE HFS+  PN P +R+ +D LA   LP+WLTE+D+ +  G 
Sbjct  404  KLRSIQSLPGNGNM-GIGLESHFSSSPPNIPYMRSAIDTLAATGLPVWLTEVDV-QSGGN  461

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
            + Q+  LE +LRE  SHP V GI++W+A SP GC++MCLTDNN +NLP GDVVD LL+EW
Sbjct  462  QAQS--LEQILREAHSHPKVRGIVIWSAWSPNGCYRMCLTDNNFHNLPTGDVVDKLLREW  519

Query  230  -QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATS----TFSLNR-GEETRHFRI  75
                T++G TD++G +    F G+Y  KV V + ++  +S    TF LN   +E++  R+
Sbjct  520  GGGATVKGKTDQNGFFQSSLFHGDYEIKVQVNHPSKLPSSSSHHTFKLNSTDDESKQTRL  579

Query  74   QL  69
             L
Sbjct  580  LL  581



>ref|XP_009406772.1| PREDICTED: endo-1,4-beta-xylanase C-like [Musa acuminata subsp. 
malaccensis]
Length=571

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 134/207 (65%), Gaps = 5/207 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E +LG +A+  F++ AH+ DP A +F+NDFN +E   D   T + Y+ 
Sbjct  342  DVVNENVHFSYFESQLGQNASSIFYQQAHQLDPHALMFLNDFNTLEVPVDGNVTPEKYLQ  401

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+++++  G +S   IGLEGHF  P+   +R+ LDKLA   +PIWLTE+D+        Q
Sbjct  402  KLRQIQSFGNLSRMAIGLEGHFGRPDISYMRSALDKLAGANVPIWLTEVDV----AHSNQ  457

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
              YLE +LRE +SHPAV GI++W A  P+GC++MCLTDNN  NLP GDVVD L+ EW++ 
Sbjct  458  TKYLEDILREAYSHPAVQGIVMWGAWHPQGCWRMCLTDNNFKNLPTGDVVDKLIFEWRSD  517

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEY  141
             +   TD  G      F GEY++++ +
Sbjct  518  NVTATTDADGLLRAELFHGEYEITINH  544



>ref|XP_010315176.1| PREDICTED: endo-1,4-beta-xylanase C-like [Solanum lycopersicum]
Length=315

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 134/218 (61%), Gaps = 7/218 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF   E  LG +A+  ++K A+E D  A  F+NDFN +E   D  S    Y+ 
Sbjct  80   DVVNENVHFSFLENILGKNASAVYYKKANEIDSRAIPFLNDFNTIEHGFDGTSNPAKYLE  139

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+++L+  G +   GIG++GHF  PN P IR+ LD LA+  LPIW+TE+D+     QE  
Sbjct  140  KIRDLRSHGYNGPLGIGVQGHFVKPNLPYIRSSLDMLASAGLPIWITELDVANTTNQE--  197

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             +YLE ++REV +HP + GIM+W    PKGC++MCLTDNN  NL  GD+VD ++KEW  Q
Sbjct  198  -VYLEEIIREVHAHPGLKGIMIWAPWGPKGCYRMCLTDNNFKNLATGDIVDKIIKEWSHQ  256

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
               G T+E+G      F GEY+V +   N     T++L
Sbjct  257  GFSGTTNENGIIETSLFHGEYQVEI---NHHEKQTYAL  291



>gb|KJB47306.1| hypothetical protein B456_008G020100 [Gossypium raimondii]
 gb|KJB47307.1| hypothetical protein B456_008G020100 [Gossypium raimondii]
Length=579

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 136/229 (59%), Gaps = 7/229 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH + +E +LGPDA+  F+K A   D    LFMN+FN +E   D  ST   Y+ 
Sbjct  341  DVVNENLHSNFFESKLGPDASATFYKMAAGIDHSIPLFMNEFNTLEQKGDAASTPAKYLE  400

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K ++           IGLE HF  P+ P IR+ LD LA   LPIWLTEID+       
Sbjct  401  KLKNIQTFMGAEAKRMAIGLECHFDVPSLPYIRSSLDTLAATNLPIWLTEIDVQSG---S  457

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA+YLE VLRE  SHP VSG+++W+A +P GC++MCLTDNN  NL  GDVVD LLKEW 
Sbjct  458  NQAMYLEQVLREGHSHPGVSGMIIWSAWNPNGCYRMCLTDNNFKNLATGDVVDKLLKEWG  517

Query  227  TQ-TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLNRGEETRH  84
             + T+EG TD  G +    F GEY+V +      A S+ S     E RH
Sbjct  518  IKATVEGKTDAAGFFEASLFHGEYEVKISDPVEAANSSVSQRFKVEPRH  566



>ref|XP_004983257.1| PREDICTED: uncharacterized protein LOC101782274 [Setaria italica]
Length=581

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 133/210 (63%), Gaps = 8/210 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+ + +    + D  A LFMN+FN +E   DP      Y++
Sbjct  350  DVVNENLHFNFFETKLGPNASAQIYNQVGQLDRNAILFMNEFNTLEQPGDPNPVPAKYVA  409

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KM +++     GG+ + G+GLE HFS PN P IR+ LD LA L+LP+WLTE+D+ K    
Sbjct  410  KMNQIRSYPGNGGLKL-GVGLESHFSTPNLPYIRSALDTLAKLKLPMWLTEVDVVK---S  465

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  +LE VLRE F+HP V GI++W A   KGC+ MCLTDN+  NLP GD+VD L+ EW
Sbjct  466  PNQVKFLEQVLREGFAHPNVDGIVMWAAWHAKGCYVMCLTDNSFKNLPVGDLVDKLIAEW  525

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            +T      TD+ G+      LGEYK +V +
Sbjct  526  KTHRASATTDDKGAVELDLPLGEYKFTVSH  555



>ref|XP_009406807.1| PREDICTED: endo-1,4-beta-xylanase A-like [Musa acuminata subsp. 
malaccensis]
Length=571

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 135/207 (65%), Gaps = 5/207 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E +LG +A+  F++ AH+ DP A +F+ND+N +E   D   T D ++ 
Sbjct  342  DVVNENVHFSYFESQLGQNASSVFYQQAHQLDPNALMFLNDYNTLEAPVDGNVTPDKFLQ  401

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+ +++  G +S   IGLEGHF  P+   +R+ LDKLA   +PIWLTE+D+    G   Q
Sbjct  402  KLWQIQSFGNLSRMAIGLEGHFGTPDISYMRSALDKLAGANVPIWLTEVDV----GHANQ  457

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            +  LE +LRE +SHPAV GI++W A  P+GC++MCLTDNN  NLP GDVVD L+ EW++ 
Sbjct  458  SKDLEDILREAYSHPAVQGIVMWGAWHPQGCWRMCLTDNNFKNLPTGDVVDKLIFEWKSD  517

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEY  141
             L   TD  G +    F GEYK+++ +
Sbjct  518  NLAATTDVEGLHRAELFHGEYKITINH  544



>ref|XP_004985305.1| PREDICTED: uncharacterized protein LOC101780535 [Setaria italica]
Length=579

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 140/239 (59%), Gaps = 13/239 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPL-ATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF  YE R G DA+  F+  A   D   A +FMN+FN +E   D  +  D Y+
Sbjct  345  DVVNENLHFSFYEGRFGWDASTAFYAAARLLDTGNALMFMNEFNTLEQPGDMAALPDRYL  404

Query  581  SKMKEL----KQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
             +++++     + G  M  IGLEGHF+ PN P +RA LD LA   +PIWLTE+D+    G
Sbjct  405  QRLRQIVAAYPENGAGM-AIGLEGHFTNPNIPYMRAALDTLAQAGIPIWLTEVDVA---G  460

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE VLRE ++HPAV GI+LW+A  P+GC+ MCLTDNN  NLP GDVVD L+ E
Sbjct  461  SPAQAQHLEEVLREAYAHPAVQGIVLWSAWRPEGCYVMCLTDNNFKNLPQGDVVDRLIAE  520

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY---GNRTATST-FSLNRGEETRHFRIQL  69
            W+     G TDE G +      GEYKV+V +    N  + S    L  G E     IQ+
Sbjct  521  WRAAPRAGATDEQGFFEADLVHGEYKVTVSHPALNNSVSRSVKVELGSGSENYFVDIQV  579



>ref|XP_003621871.1| Endo-1,4-beta-xylanase C [Medicago truncatula]
 gb|AES78089.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=570

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 130/209 (62%), Gaps = 6/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG + +   F   H  D   TLFMN++N +E   D  ST  TYI 
Sbjct  334  DVVNENLHFSFFESKLGQNFSARMFNEVHNIDGQTTLFMNEYNTIEDSRDGLSTPPTYIE  393

Query  578  KMKELKQGGISMD-GIGLEGHF--SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+KE++     +  GIGLE HF  S PN P +RA LD L    LPIW+TE+D+     Q 
Sbjct  394  KIKEIQSVNSQLPLGIGLESHFPNSPPNLPYMRASLDTLRATGLPIWITELDV---ASQP  450

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA+Y E VLRE  SHP + GI++WTA SP+GC+++CLTDNN  NLPAGDVVD L+ EW 
Sbjct  451  NQALYFEQVLREAHSHPGIQGIVMWTAWSPQGCYRICLTDNNFKNLPAGDVVDQLINEWG  510

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
                 G TD++G +    F G+Y++ + +
Sbjct  511  RAEKSGTTDQNGYFEASLFHGDYEIEINH  539



>gb|KFK30012.1| hypothetical protein AALP_AA7G206300 [Arabis alpina]
Length=294

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 136/224 (61%), Gaps = 11/224 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E  LGP A+   +  AH  DP  TL+MN++N +E   D  ST   Y+ 
Sbjct  60   DVMNENLHFSFFESMLGPSASNLIYAMAHANDPKTTLYMNEYNTIERPKDLASTPARYLQ  119

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF+ PN P +R+ LD  A   LPIWLTE+D+  K   
Sbjct  120  KLRELQNIRVAGKIPL-GIGLESHFTTPNIPYMRSALDTFAATGLPIWLTEVDV--KASS  176

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA+Y E VLRE  +HP V G++ W+  +P GCF MCLTD N NNLP GDVVD LL+EW
Sbjct  177  NVQAMYFEQVLREGHAHPKVQGMVTWSGYNPAGCFVMCLTDGNFNNLPTGDVVDKLLREW  236

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
                 +T+ G TD  G +    FLG+Y ++  +    + +++S+
Sbjct  237  GGLGGKTI-GVTDTDGFFEASLFLGDYNLNFSHPLTNSEASYSI  279



>ref|XP_010030623.1| PREDICTED: uncharacterized protein LOC104420481 [Eucalyptus grandis]
Length=675

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LGP A+   +KTA   DP  TLF+N++N +E   D  S+   Y +
Sbjct  346  DVVNENLHFSFFESKLGPQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDRTSSPTAYAN  405

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K+K ++  G    GIGLE HF+ P+ P +R+ +D L  L LP+WLTE+D+        QA
Sbjct  406  KVKSIQSLGGRNLGIGLESHFNVPDLPYMRSAIDTLGALGLPMWLTEVDVQSG---PNQA  462

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--QT  225
            +YLE VLRE  +HP ++GI++WTA  P+GC++MCLTDNN  NLP GDVVD LLKEW    
Sbjct  463  MYLEQVLREAHAHPKINGIVMWTAWKPEGCYRMCLTDNNFRNLPTGDVVDKLLKEWGGGR  522

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSV  147
            + L G T   G+     F G+Y+V+V
Sbjct  523  KELSGMTSPDGTLEASLFHGDYQVTV  548



>emb|CAN61986.1| hypothetical protein VITISV_034670 [Vitis vinifera]
Length=356

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 135/209 (65%), Gaps = 9/209 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E RLG  AT   F+   + D   TLFMN+++ +E      ++ D Y+ 
Sbjct  122  DVVNENLHFSFFESRLGAKATGVAFQKTRQLDGRTTLFMNEYDTIEKSGKGSASPDKYLQ  181

Query  578  KMKELK---QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++E++   +GG ++ GIGLEGHF  PN P +R+ +DKLA  + PIW+TE+D++      
Sbjct  182  KLREIQSFLRGGGNL-GIGLEGHFRTPNIPYMRSAIDKLAAAKFPIWITELDVD-----P  235

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            +Q ++L+ VLRE  +HPA+ GI++W A  P+GCF+MCLTD+N  N P GDVVD LL++W 
Sbjct  236  SQPMHLDQVLREAHAHPAIHGIVMWAAWKPEGCFRMCLTDSNFKNTPTGDVVDKLLQQWT  295

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
               L G TD  G +    F G+Y+V++ +
Sbjct  296  HAGLVGTTDADGFFETSLFHGDYEVAITH  324



>ref|XP_002461545.1| hypothetical protein SORBIDRAFT_02g004490 [Sorghum bicolor]
 gb|EER98066.1| hypothetical protein SORBIDRAFT_02g004490 [Sorghum bicolor]
Length=567

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 131/210 (62%), Gaps = 8/210 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP A+ + F+   + D    LFMN+FN +E   DP  T   Y++
Sbjct  333  DVVNENLHFNFFETKLGPGASAQIFQQVGQLDRNPILFMNEFNTLEQPGDPNPTPAKYVA  392

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KM +++     GG+ + G+GLE HFS PN P +R+ LD LA L+LP+WLTE+D+ K    
Sbjct  393  KMTQIRSYPGNGGLKL-GVGLESHFSTPNIPYMRSSLDTLAKLKLPMWLTEVDVVKG---  448

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q   LE VLRE + HP V+GI++W A   KGC+ MCLTDN+  NLP GDVVD L+ EW
Sbjct  449  PNQVKNLEQVLREGYGHPGVNGIVMWAAWHAKGCYVMCLTDNSFKNLPVGDVVDKLIAEW  508

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            +T      TD  G+      LGEYK +V +
Sbjct  509  KTHRASATTDRDGAVELDLPLGEYKFTVRH  538



>ref|XP_008648082.1| PREDICTED: xylanase1 isoform X1 [Zea mays]
 tpg|DAA46845.1| TPA: xylanase1 [Zea mays]
Length=584

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 142/232 (61%), Gaps = 11/232 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP A+ + ++   + D  A LFMN+FN +E   DP      Y++
Sbjct  351  DVVNENLHFNFFETKLGPMASAQIYQQVGQLDRNAILFMNEFNTLEQPGDPNPVPAKYVA  410

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KM +++     GG+ + G+GLE HFS PN P +R+ LD LA L+LP+WLTE+D+ K    
Sbjct  411  KMNQIRGYAGNGGLKL-GVGLESHFSTPNIPYMRSSLDTLAKLKLPMWLTEVDVVK---S  466

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE F+HP V GI++W A   +GC+ MCLTDN+  NLP GD+VD L+ EW
Sbjct  467  PNQVKYLEQVLREGFAHPNVDGIVMWAAWHARGCYVMCLTDNSFKNLPVGDLVDKLIAEW  526

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL---NRGEETRH  84
            +T      TD +G+      LG++K +V + +  A +  ++   N    ++H
Sbjct  527  KTHRASATTDHNGAVELHLPLGDFKFTVSHPSLKAAAVQTMTVDNSASASQH  578



>tpg|DAA46846.1| TPA: xylanase1 [Zea mays]
Length=589

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 142/232 (61%), Gaps = 11/232 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP A+ + ++   + D  A LFMN+FN +E   DP      Y++
Sbjct  356  DVVNENLHFNFFETKLGPMASAQIYQQVGQLDRNAILFMNEFNTLEQPGDPNPVPAKYVA  415

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KM +++     GG+ + G+GLE HFS PN P +R+ LD LA L+LP+WLTE+D+ K    
Sbjct  416  KMNQIRGYAGNGGLKL-GVGLESHFSTPNIPYMRSSLDTLAKLKLPMWLTEVDVVK---S  471

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE F+HP V GI++W A   +GC+ MCLTDN+  NLP GD+VD L+ EW
Sbjct  472  PNQVKYLEQVLREGFAHPNVDGIVMWAAWHARGCYVMCLTDNSFKNLPVGDLVDKLIAEW  531

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL---NRGEETRH  84
            +T      TD +G+      LG++K +V + +  A +  ++   N    ++H
Sbjct  532  KTHRASATTDHNGAVELHLPLGDFKFTVSHPSLKAAAVQTMTVDNSASASQH  583



>dbj|BAK07928.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 145/236 (61%), Gaps = 12/236 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LH+  +E++ G DA+  F+  A   D   A +FMN++N +E   D  +    Y+
Sbjct  340  DVVNENLHYSFFERQFGWDASTAFYAAARLLDAGSALMFMNEYNTLEQPGDAAAAPGRYV  399

Query  581  SKMKEL----KQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
             +++++     + G  M  IGLEGHF+ PN P +RA LD L+ + LP+WLTE+D+    G
Sbjct  400  DRLRQIIASYPENGAGM-AIGLEGHFTTPNIPYMRAALDSLSQIGLPVWLTEVDVA---G  455

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA +LE VLRE ++HPAV G++LW+A  P+GC+ MCLTDNN  NLP GDVVD LL E
Sbjct  456  GPMQAQHLEEVLREAYAHPAVQGVILWSAWRPQGCYVMCLTDNNFKNLPQGDVVDRLLAE  515

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQ  72
            W+T    G TDE G +      G+YKV+V +   N + + + +++ G    HF IQ
Sbjct  516  WRTAAQTGTTDEQGYFQAEVAHGDYKVTVSHPSLNTSVSQSVTVDLG-SGNHFFIQ  570



>gb|ABF94504.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ25956.1| hypothetical protein OsJ_09811 [Oryza sativa Japonica Group]
Length=567

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 142/234 (61%), Gaps = 12/234 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATL-FMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF  +E+R G DA+  F+  A   D  +TL FMN++N +E   D  +    Y+
Sbjct  335  DVVNENLHFSFFERRFGWDASTAFYAAARMLDTGSTLMFMNEYNTLEQPGDMAALPARYV  394

Query  581  SKMKEL----KQGGISMDGIGLEGHFSAP-NPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             ++K++     Q G  M  IGLEGHF+AP N P +RA LD LA   +P+WLTE+D+    
Sbjct  395  QRLKQIIGGYPQNGAGM-AIGLEGHFTAPVNIPYMRAALDTLAQAGVPVWLTEVDVG---  450

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
            G  +QA YLE +LRE ++HPAV G++LW A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  451  GGASQAYYLEEILREAYAHPAVQGVILWAAWRPQGCYVMCLTDNDFNNLPQGDVVDRLIT  510

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHF  81
            EW T    G TD  G +      GEYKV+V +   N + + +  +  G  + +F
Sbjct  511  EWSTAPRAGTTDAEGFFQAELAHGEYKVTVTHPSLNTSVSQSVKVEMGSGSHYF  564



>ref|XP_010274469.1| PREDICTED: endo-1,4-beta-xylanase D-like [Nelumbo nucifera]
Length=576

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 131/208 (63%), Gaps = 5/208 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF   E RLG +A+  F++ AH+ D  A +F+NDFN +E   D KST   Y+ 
Sbjct  342  DVVNENLHFSFLEDRLGWNASAAFYQRAHQLDDRAIMFLNDFNTIEDSRDGKSTPAMYLQ  401

Query  578  KMKELKQ--GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQET  405
            K+K+++   G     GIGLEGHF  P+   IRA LD LA  +LPIW+TE+D+        
Sbjct  402  KLKQIQSFPGSRMSLGIGLEGHFHTPDIAYIRAALDTLAATKLPIWITELDVGS---DPN  458

Query  404  QAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQT  225
            QA YLE +LRE  +HP + GI++W A  P+GC++MCLTDNN  NLP G+VVD ++ EW  
Sbjct  459  QAKYLEEILRETHAHPGLQGIIIWAAWRPEGCYRMCLTDNNFKNLPTGEVVDKVIGEWTH  518

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
              L G TD +G +    F G++ V++ +
Sbjct  519  AHLAGLTDSNGYFETSLFHGDHVVTITH  546



>dbj|BAK07199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 140/235 (60%), Gaps = 11/235 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+   ++   + D  A LFMN+FN +E   DP  T   YI+
Sbjct  333  DVLNENLHFNFFETKLGPNASPMIYQQVGQIDHNAVLFMNEFNTLEQPMDPNGTPTKYIA  392

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++     GG+ M G+GLE HFS PN P +R  LD LA L+LP+W+TE+D+ K    
Sbjct  393  KMKLIQGYPGNGGLKM-GVGLESHFSTPNVPYVRGALDTLAQLKLPMWMTEVDVVKG---  448

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE + HP V GI++W A    GC+ MCLTDNN  NLP G +VD L++EW
Sbjct  449  PNQVKYLEQVLREGYGHPGVEGIVMWAAWHANGCYVMCLTDNNFKNLPVGALVDKLIEEW  508

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS---TFSLNRGEETRHFRI  75
            +T      TD +G        G+YK+ V + +  ATS   T      E+T + ++
Sbjct  509  KTHKTSATTDANGLVELDLAHGDYKLMVNHPSSLATSHTITVDAASSEQTINLKV  563



>emb|CDY49378.1| BnaA03g50670D [Brassica napus]
Length=572

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 136/226 (60%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP A+   F  AH  DP   +FMN+FN +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKMGPQASYNIFALAHSIDPRTPMFMNEFNTLEQPGDSASSPARYLG  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF+ PN P +R+ LD LA   LPIWLTE+D+      
Sbjct  397  KLRELQSIRVAGNIQL-GIGLESHFNTPNIPYMRSALDTLAATGLPIWLTEVDVQAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V G++ W+  SP GC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVQAKYFEQVLREGHAHPQVKGMVTWSGYSPSGCYKMCLTDGNFRNLPTGDVVDKLLREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               + QT  G TD  G +    F G+Y +S+ +   N TA+ +F L
Sbjct  514  GGLRGQT-TGLTDADGFFEASLFHGDYDISIAHPLTNSTASHSFKL  558



>gb|KEH27913.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=570

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 129/212 (61%), Gaps = 6/212 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH   +E +LG + T   F   H  D   TLFMND+N +E   D  ST   YI 
Sbjct  334  DVINENLHSSFFESKLGQNFTSRMFNEVHNVDGNTTLFMNDYNTIEDSRDGLSTPPKYIQ  393

Query  578  KMKELKQGGISMD-GIGLEGHFS--APNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++E++     +  GIGLE HF    PN P +RA LD LA   LPIW+TE+D+     Q 
Sbjct  394  KIREIQSWNKQLPLGIGLESHFPNFPPNLPYMRASLDILAATGLPIWITELDVA---SQP  450

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE VLRE  SHP + GI++WTA SP+GCF+MCLTDNN  NLP GDVVD L+ EW 
Sbjct  451  NQAGYLEQVLREAHSHPGIRGIVMWTAWSPQGCFRMCLTDNNFKNLPTGDVVDKLIYEWG  510

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNR  132
             + L G TD++G      F G+YK+ + +  +
Sbjct  511  RKILSGTTDKNGFLKASLFHGDYKMEISHSAK  542



>ref|XP_010691571.1| PREDICTED: endo-1,4-beta-xylanase-like [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   196 bits (499),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 135/207 (65%), Gaps = 9/207 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV+NE LHF+ +E +LG + T  FF+   + D   TLF+ND+N +E   DP S+   YI 
Sbjct  347  DVNNENLHFNFFESKLGENTTDVFFQKTQQLDGRTTLFINDYNTIEDERDPSSSPSKYIQ  406

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+KE++    G IS+ GIGLEGHF  PN P +R+ +D LA+ +LPIW+TE+D+    G  
Sbjct  407  KLKEIQSFVGGAISL-GIGLEGHFITPNIPYVRSAIDTLASTKLPIWITELDVQ---GGS  462

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKG-CFQMCLTDNNLNNLPAGDVVDNLLKEW  231
             Q  Y E +LREV SHP + GI++W   SP+G C++MCL D N  N+PAG+V+D LL EW
Sbjct  463  NQVTYFEQILREVHSHPGIQGIVIWGPWSPQGQCYKMCLVDPNFQNMPAGEVLDKLLGEW  522

Query  230  Q-TQTLEGGTDEHGSYSFMGFLGEYKV  153
            Q  +T    TD +G ++   F G+Y+V
Sbjct  523  QHYKTFYATTDSNGFFNISLFHGDYEV  549



>ref|XP_006346513.1| PREDICTED: uncharacterized protein LOC102598712 [Solanum tuberosum]
Length=1126

 Score =   200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 137/217 (63%), Gaps = 4/217 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF   E  LG +A+  ++K A+E D  A  F+NDFN +E   D  S    Y+ 
Sbjct  349  DVVNENVHFSFLENILGKNASAIYYKKANEIDSKAIPFLNDFNTIEHEFDGTSNPAKYLE  408

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+++L+  G +   GIG++GHF  PN P IR+ LD LA+  LPIW+TE+D+     QE  
Sbjct  409  KIRDLRSHGYNGPLGIGVQGHFVKPNLPYIRSSLDMLASAGLPIWITELDVANTTNQE--  466

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             +YLE ++REV +HP V GIM+W    PKGC++MCLTDNN  NLP GD+VD ++KEW  Q
Sbjct  467  -VYLEEIIREVHAHPGVKGIMIWAPWGPKGCYRMCLTDNNFKNLPTGDIVDKIIKEWSHQ  525

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFS  111
               G T+E+G +    F GEY+V +++  +   ++ +
Sbjct  526  GFSGTTNENGIFETSLFHGEYQVEIKHHEKQTYASMA  562


 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 131/207 (63%), Gaps = 4/207 (2%)
 Frame = -1

Query  758   DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
             DV NE LHF  +E +LG +A+  F++ A + D    LF+N++N +E  SD +S+   Y++
Sbjct  890   DVMNENLHFKFFESKLGANASATFYRLASQFDNKTPLFLNEYNTIEVPSDGQSSPANYLN  949

Query  578   KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
              +K+L+ GG +   GIGLEGHF AP    IRA LD LA+ +LP+W+TE+D+     ++ Q
Sbjct  950   MIKQLRTGGYTGPLGIGLEGHFGAPTIAYIRAGLDTLASAKLPMWITELDVRP---EQNQ  1006

Query  401   AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
             A  L+ V++E+  HPAV G+++W+A  P GCF+MCLTDNN  NLP GDVVD        +
Sbjct  1007  AQVLDQVIKEIVGHPAVQGLIIWSAWKPTGCFRMCLTDNNFKNLPTGDVVDKARATLSHE  1066

Query  221   TLEGGTDEHGSYSFMGFLGEYKVSVEY  141
              L G T+  G +    F G+YK  V +
Sbjct  1067  GLIGTTNAEGYFETSLFHGDYKAIVTH  1093



>ref|XP_010315494.1| PREDICTED: uncharacterized protein LOC101254648 [Solanum lycopersicum]
Length=596

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 138/214 (64%), Gaps = 4/214 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LGP A+  F++ A + D    LF+ND+N +E  SD +S+   Y+S
Sbjct  360  DVMNENLHFKFFESKLGPSASATFYRLASQFDNKTPLFLNDYNTIEVPSDGQSSPANYLS  419

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
             +K+++ GG +   GIGLEGHF AP+ P IRA LD LA+ +LP+W+TE+D+     ++ Q
Sbjct  420  MIKQVRTGGYAGTLGIGLEGHFGAPSIPYIRAGLDTLASAKLPMWITELDVRP---EQNQ  476

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            A  L+ V++E+ +HPAV G+++W+A  P GCF+MCLTDNN  NLP GDVVD        +
Sbjct  477  AQVLDQVIKEIIAHPAVQGLIIWSAWKPNGCFRMCLTDNNFKNLPTGDVVDKARTSLSHE  536

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
             L G T+  G +    F G+YK  V + + T +S
Sbjct  537  GLIGTTNAEGYFETSLFHGDYKAIVTHPSITDSS  570



>ref|XP_006285354.1| hypothetical protein CARUB_v10006745mg, partial [Capsella rubella]
 gb|EOA18252.1| hypothetical protein CARUB_v10006745mg, partial [Capsella rubella]
Length=540

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 130/212 (61%), Gaps = 9/212 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP ++   +  AH  DP  T+FMN++N +E   DP S+   Y+ 
Sbjct  312  DVVNENLHFSFFESKMGPQSSYNVYAMAHALDPRTTMFMNEYNTLEHPQDPSSSPARYLQ  371

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++EL+    GG    GIGLE HFS PN P +R+ LD L    LPIWLTE+D++      
Sbjct  372  KLRELQSIRVGGNIPLGIGLESHFSTPNLPYMRSALDTLGATGLPIWLTEVDVDAP--PN  429

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW-  231
             +  Y E VLRE  SHP V GI++WT  SP GC++MCLTD N  NLP GDVVD LL+EW 
Sbjct  430  VRPWYFEQVLREGHSHPKVQGIVMWTGYSPAGCYRMCLTDGNFKNLPTGDVVDKLLREWG  489

Query  230  --QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
              ++QT  G  D  G +    F G+Y +S+ +
Sbjct  490  GFRSQTT-GVADADGFFEASLFHGDYDLSISH  520



>gb|KFK30013.1| hypothetical protein AALP_AA7G206400 [Arabis alpina]
Length=575

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 135/226 (60%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E+++GP A+   +K A   DP  T F+N++N +E   DP S+   Y+ 
Sbjct  337  DVVNENLHFSYFEKKMGPKASYNIYKMAQAFDPTTTKFINEYNTLEEPRDPDSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G IS+ GIGLE HF  PN P +R+ LD LA   LPIWLTE+D+     Q
Sbjct  397  KLRELRSIRVAGNISL-GIGLESHFKTPNLPYMRSALDTLAATGLPIWLTEVDVEAP--Q  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V GI+ W+  SP GC++MCLTD N  NLP GDVVD LL EW
Sbjct  454  NVQAKYFEQVLREGHAHPQVKGIVTWSGYSPTGCYRMCLTDGNFKNLPTGDVVDKLLHEW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSL  108
               + QT  G TD +G +    F G+Y  K+     +  A+  F L
Sbjct  514  GGFRRQTT-GVTDANGYFEASLFHGDYDLKIGHSLSDSKASHNFKL  558



>gb|KEH30535.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=571

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 129/209 (62%), Gaps = 6/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG D + + F   H  DP  TLF+N+FN +E   D  S+   YI 
Sbjct  334  DVVNENLHFSFFEGKLGQDFSAKAFNKVHNIDPQTTLFINEFNTIEDSRDGLSSPSNYIQ  393

Query  578  KMKELKQGGISMD-GIGLEGHFSAP--NPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K+++     +  GIGLE HFS+   N P +RA +D L   RLPIW+TE+D+     Q 
Sbjct  394  KIKQIQSVNRQLPLGIGLESHFSSLPLNFPYMRASIDTLTASRLPIWITELDVA---SQP  450

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             Q  YLE  LRE  SHP V GI++WTA +P+GC++MCLTDNN  NLP GDVVD L+ EW 
Sbjct  451  NQVQYLEQALREAHSHPGVQGIVMWTAWTPQGCYKMCLTDNNFKNLPTGDVVDKLISEWG  510

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
               + G TD++G      F G+YK+ + +
Sbjct  511  KAQVLGTTDQNGLLELSLFHGDYKIQINH  539



>ref|XP_006651140.1| PREDICTED: uncharacterized protein LOC102718726 [Oryza brachyantha]
Length=569

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 141/234 (60%), Gaps = 12/234 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATL-FMNDFNVVETCSDPKSTVDTYI  582
            DV NE LH+  +E+R G DA+  F+  A   D  +TL FMN++N +E   D  +    Y+
Sbjct  337  DVVNENLHYSFFERRFGWDASTAFYAAARMLDGGSTLMFMNEYNTLEQPGDMAALPARYM  396

Query  581  SKMKELKQG----GISMDGIGLEGHFSAP-NPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             ++K++  G    G  M  IGLEGHF+AP N P +RA LD LA   +P+WLTE+D+    
Sbjct  397  QRLKQITSGYPQNGAGM-AIGLEGHFTAPVNIPYMRAALDTLAQAGIPVWLTEVDVA---  452

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
            G  +QA YLE VLRE ++HPAV G++LW A  P+GC+ MCLTDN  NNLP GDVVD L+ 
Sbjct  453  GSPSQAYYLEEVLREAYAHPAVQGVILWAAWRPQGCYVMCLTDNEFNNLPQGDVVDRLIT  512

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHF  81
            EW T    G TD  G +      GEYKV+V +   N + + +  +  G  + +F
Sbjct  513  EWSTAPRTGTTDAEGFFQADLAHGEYKVTVTHPSLNTSVSQSVKVELGSGSHYF  566



>ref|XP_006412307.1| hypothetical protein EUTSA_v10027468mg, partial [Eutrema salsugineum]
 gb|ESQ53760.1| hypothetical protein EUTSA_v10027468mg, partial [Eutrema salsugineum]
Length=569

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 137/225 (61%), Gaps = 11/225 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP A+   +  AH  DP  T+FMN+FN +E   D  S+   Y+ 
Sbjct  338  DVVNENLHFSFFESKMGPKASYNTYAEAHIIDPRTTMFMNEFNTLEQPGDSASSPARYLQ  397

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++EL+   +S     GIGLE HFS PN P +R+ LD LA   LPIWLTE+D++      
Sbjct  398  KLRELQSIRVSGSIPLGIGLESHFSTPNIPYMRSALDTLAATGLPIWLTEVDVDAP--PN  455

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW-  231
             +A Y E VLRE  +HP V G++ WT  SP GC++MCLTD N  NLP GDVVD LL+EW 
Sbjct  456  VRAKYFEQVLREGHAHPQVKGMVTWTGYSPTGCYRMCLTDGNFRNLPTGDVVDKLLREWG  515

Query  230  --QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
              + QT  G TD  G +    F G+Y +++ +   N +A+ +F L
Sbjct  516  GLRGQTT-GLTDADGFFEASLFHGDYDLNIAHPLANSSASHSFKL  559



>gb|ACL53900.1| unknown [Zea mays]
 gb|AFW89315.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=430

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 142/238 (60%), Gaps = 12/238 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +FMN+FN VE   D  +    Y+
Sbjct  195  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAALPARYL  254

Query  581  SKMKEL----KQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             +++++     + G  M  IGLEGHF+  PN P +RA LD LA   +P+WLTE+D+    
Sbjct  255  QRLQQIIAAYPENGAGM-AIGLEGHFTTNPNIPYMRAALDTLAQAGIPVWLTEVDVAPG-  312

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
               +QA +LE VLRE ++HPAV GI++W+A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  313  --PSQAQHLEEVLREAYAHPAVQGIVIWSAWRPEGCYVMCLTDNSFNNLPQGDVVDRLIA  370

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            EW+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  371  EWRATPRAGSTDAQGYFEAELVHGEYKVTVSHPALNSSISRSVKVELGSGSDHYFIDM  428



>ref|XP_002532418.1| Endo-1,4-beta-xylanase C precursor, putative [Ricinus communis]
 gb|EEF29959.1| Endo-1,4-beta-xylanase C precursor, putative [Ricinus communis]
Length=569

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 9/219 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG +A+  F+  A +AD   TLF+N++N +E   D  ++   Y+ 
Sbjct  335  DVVNENLHFNFFESKLGQNASSVFYNLAQKADGSTTLFLNEYNTIEESGDGNASPAKYLQ  394

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++++K      I    IGLE HFS PN P +R+ +D LA    PIWLTE+D+       
Sbjct  395  KLRDIKSFPGNEILNLAIGLEAHFSTPNLPYMRSSIDTLAAANFPIWLTEVDVQ---SNP  451

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE VL EV SHP V+GI++W+A SP+GC++MCLTDNN  NLP GDVVD L+ +W 
Sbjct  452  NQAQYLEQVLTEVHSHPKVAGIVIWSAWSPQGCYRMCLTDNNFKNLPTGDVVDKLMGKWS  511

Query  227  -TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTF  114
              ++L G TD  G +    F G+Y V++   N+ + S+F
Sbjct  512  GVKSLSGMTDADGFFETSLFQGDYDVTIH--NQASNSSF  548



>ref|XP_010647914.1| PREDICTED: uncharacterized protein LOC100248080 [Vitis vinifera]
 ref|XP_010647915.1| PREDICTED: uncharacterized protein LOC100248080 [Vitis vinifera]
 ref|XP_010647916.1| PREDICTED: uncharacterized protein LOC100248080 [Vitis vinifera]
Length=578

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 138/216 (64%), Gaps = 9/216 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E RLG  AT   F+   + D   TLFMN+++ +E      ++ D Y+ 
Sbjct  344  DVVNENLHFSFFESRLGAKATGVAFQKTRQLDGRTTLFMNEYDTIEKSGKGSASPDKYLQ  403

Query  578  KMKELK---QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++E++   +GG ++ GIGLEGHF  PN P +R+ +DKLA  + PIW+TE+D++      
Sbjct  404  KLREIQSFLRGGGNL-GIGLEGHFRTPNIPYMRSAIDKLAAAKFPIWITELDVDP-----  457

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            +Q ++L+ VLRE  +HPA+ GI++W A  P+GCF+MCLTD+N  N P GDVVD LL++W 
Sbjct  458  SQPMHLDQVLREAHAHPAIHGIVMWAAWKPEGCFRMCLTDSNFKNTPTGDVVDKLLQQWT  517

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
               L G TD  G +    F G+Y+V++ +   T +S
Sbjct  518  HAGLVGTTDADGFFETSLFHGDYEVAITHPTVTNSS  553



>gb|EMT18410.1| Endo-1,4-beta-xylanase C [Aegilops tauschii]
Length=641

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 137/221 (62%), Gaps = 8/221 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+   ++   + D  A LFMN+FN +E   DP  T   Y++
Sbjct  408  DVVNENLHFNFFETKLGPNASPLIYQQVGQIDHTAILFMNEFNTLEQPMDPNGTPTKYVA  467

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++     GG    G+GLE HF+ PN P +R  LD LA L+LPIW+TE+D+ K    
Sbjct  468  KMKLIQGYPGNGGFKF-GVGLESHFTTPNLPYMRGALDTLAQLKLPIWMTEVDVVKG---  523

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  +LE VLRE ++HP V GI++W A  P GC+ MCLTDN+  NLP GD+VD L+ EW
Sbjct  524  PNQVKFLEQVLREGYAHPGVQGIVMWAAWHPYGCYVMCLTDNSFKNLPVGDLVDKLIAEW  583

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
            +T      TD +G        G+YK++V++ ++T   + ++
Sbjct  584  KTHKTSPATDANGMVELDLAHGDYKLTVDHPSQTTAVSHTM  624



>ref|XP_002867151.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43410.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 134/226 (59%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP A+   FK A   DP  T FMN++N +E   D  S+   Y+ 
Sbjct  338  DVVNENLHFSYFEDKMGPKASYNIFKMAQAFDPTTTKFMNEYNTLEESRDSDSSPARYLQ  397

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G IS+ GIGLE HF  PN P +R+ LD LA   LPIWLTE+D+      
Sbjct  398  KLRELRSIRVCGNISL-GIGLESHFKTPNIPYMRSALDTLAATGLPIWLTEVDVEAP--P  454

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V GI+ W+  SP GC++MCLTD N  NLP GDVVD LL EW
Sbjct  455  NVQAKYFERVLREGHAHPQVKGIVTWSGYSPSGCYRMCLTDGNFKNLPTGDVVDKLLHEW  514

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               + QT  G TD  G +    F G+Y + +++   N  A+ +F L
Sbjct  515  GGFRRQTT-GVTDADGYFEASLFHGDYDLKIDHPLTNSKASHSFKL  559



>ref|XP_010274480.1| PREDICTED: endo-1,4-beta-xylanase D-like [Nelumbo nucifera]
Length=579

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 134/209 (64%), Gaps = 6/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E RLG +A+  F+K AH+ D  A +F+N++N +E   D  S+   YI 
Sbjct  346  DVVNENLHFSFFEDRLGRNASAAFYKKAHQLDDRAIMFLNEYNTIEDSRDGTSSPAKYIQ  405

Query  578  KMKELKQ--GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQET  405
            K+KE++   GG    GIGL+GHF+ P+   +R+ LD LA  +LPIW+TE+D+    G   
Sbjct  406  KLKEIQSYAGGRIPLGIGLQGHFNTPDIAYMRSALDTLAATKLPIWITELDVE---GGPN  462

Query  404  QAIYLETVLREVFSHPAVSGIMLWTAIS-PKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            QA YLE +LRE  SHPA+ GI++W A   P+ C +MCLTDNN  NLP G+VVD L+ EW 
Sbjct  463  QAKYLEEILREAHSHPAIKGIVIWGAWPYPEQCRRMCLTDNNFKNLPTGNVVDKLIGEWT  522

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
              +L G TD +G +    F G+Y V++ +
Sbjct  523  HASLAGLTDSNGYFETSLFHGDYVVTITH  551



>ref|XP_009138241.1| PREDICTED: uncharacterized protein LOC103862299 [Brassica rapa]
Length=572

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 135/226 (60%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP A+   F  AH  DP  T+FMN+F+ +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKMGPQASYNIFALAHSIDPRTTMFMNEFDTLEQPGDSASSPARYLG  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF+ PN P +R+ LD LA   LPIWLTE+D+      
Sbjct  397  KLRELQSIRVAGNIQL-GIGLESHFNIPNIPYMRSALDTLAATGLPIWLTEVDVQAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V G++ W+  SP GC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVQAKYFEQVLREGHAHPQVKGMVTWSGYSPSGCYKMCLTDGNFRNLPTGDVVDKLLREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               + QT  G TD  G +      G+Y +S+ +   N TA+  F L
Sbjct  514  GGLRGQTT-GLTDADGFFEASLLHGDYDISIAHPLTNSTASHRFKL  558



>ref|XP_010315175.1| PREDICTED: endo-1,4-beta-xylanase C-like [Solanum lycopersicum]
Length=432

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 131/202 (65%), Gaps = 4/202 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LGP A+  F+  A + D    LF+ND+N +E  SD +S+   Y++
Sbjct  196  DVMNENLHFKFFESKLGPSASATFYHLASQFDNKTPLFLNDYNTIEVPSDGQSSPANYLN  255

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
             +K+++ GG +   GIGLEGHF AP+ P IRA LD LA+ +LP+W+TE+D+     ++ Q
Sbjct  256  MIKQVRTGGYTGTLGIGLEGHFGAPSIPYIRAGLDTLASAKLPMWITELDVRP---EQNQ  312

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            A  L+ V++E+  HPAV G+++W+A  PKGCF+MCLTDNN  NLP GDVVD        +
Sbjct  313  AQVLDQVIKEIVGHPAVQGLIIWSAWKPKGCFRMCLTDNNFKNLPTGDVVDKARATLSHE  372

Query  221  TLEGGTDEHGSYSFMGFLGEYK  156
             L G T+  G +    F G+YK
Sbjct  373  GLIGTTNAEGYFETSLFHGDYK  394



>emb|CDY28323.1| BnaC03g66360D [Brassica napus]
Length=557

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 136/226 (60%), Gaps = 12/226 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP A+   F+ AH  DP  T+FMN+FN +E   D  S+   Y+ 
Sbjct  321  DVVNENLHFSFFENKMGPKASYNVFEQAHAVDPTTTMFMNEFNTLEQPGDGVSSPAKYLQ  380

Query  578  KMKELKQ----GGISMDGIGLEGHF-SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K++EL+     G I + GIGLE HF S PN P +R+ LD L    LPIWLTE+D+     
Sbjct  381  KLRELQSIRAPGNIPL-GIGLESHFFSTPNIPYMRSALDTLGATGLPIWLTEVDVAAP--  437

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA Y E VLRE  +HP V+G++ W+  +PKGCF+MCLTD N  NLP GDVVD LL+E
Sbjct  438  PNVQANYFEQVLREGHAHPKVTGMVTWSGYNPKGCFRMCLTDGNFRNLPTGDVVDKLLRE  497

Query  233  WQ--TQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
            W        G TD  G +    F G+Y +S+ +   N TA+ +F L
Sbjct  498  WGGLRGKTTGLTDADGYFEASLFHGDYDLSIAHPLTNSTASHSFKL  543



>gb|KJB32238.1| hypothetical protein B456_005G231200 [Gossypium raimondii]
Length=579

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 136/216 (63%), Gaps = 8/216 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG  AT  F++ AH  D    LF N++N +E   D  +T   Y+ 
Sbjct  349  DVVNENLHFSFFESKLGDQATPNFYRLAHAVDWSVPLFSNEYNTIEDSRDGAATPAKYLQ  408

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+++++  G++ +   GIGLE HF  PN   +RA LD L    LPIWLTE+D+       
Sbjct  409  KLRQIQ--GLTRNAKMGIGLESHFGTPNLAYMRASLDTLGATGLPIWLTELDV---LSGP  463

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE +L E +SHP V GI++W A  P+GC++MCLTDNN NNL  G+VVDNLL++W+
Sbjct  464  NQAKYLEQILMEAYSHPKVDGIVIWAAWKPQGCYRMCLTDNNFNNLATGNVVDNLLRQWR  523

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
            ++ + G TD  G +    F G+Y++++ + + +A S
Sbjct  524  SRAVSGLTDTRGFFEATLFHGDYEINITHPSSSAHS  559



>ref|XP_002532417.1| Endo-1,4-beta-xylanase precursor, putative [Ricinus communis]
 gb|EEF29958.1| Endo-1,4-beta-xylanase precursor, putative [Ricinus communis]
Length=318

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 135/219 (62%), Gaps = 9/219 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E +LG +A+   +K A + D  ATLF+N+FN +E   D  S+   Y+ 
Sbjct  80   DVVNENMHFSFFESKLGQNASAVLYKMAQKVDGNATLFLNEFNTIEDSRDDASSRTKYLK  139

Query  578  KMKELK--QGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
             +KE+K   G  ++  GIGLE HF+ PN P +RA +D LA   LPIWLTE+D+       
Sbjct  140  TLKEIKGYPGNENLKLGIGLESHFNTPNLPYMRASIDILAAANLPIWLTEVDVE---SSP  196

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW-  231
             QA YLE VLRE   HP V+GI+LW+A  P+GC++MCLTD+N  NLP GDVVD L+ EW 
Sbjct  197  NQAQYLEEVLREAHGHPKVTGIILWSAWKPEGCYRMCLTDHNFKNLPTGDVVDKLMGEWF  256

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTF  114
              ++  G  D +G +      GEY V + +  + + S+F
Sbjct  257  GIESSSGMADANGFFEISLSHGEYLVKIHH--QASNSSF  293



>ref|XP_010447186.1| PREDICTED: uncharacterized protein LOC104729864 [Camelina sativa]
Length=576

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 137/226 (61%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E +LGP A+   F  AH  DP  T+F+N+FN +E   D KS+   Y+ 
Sbjct  337  DVVNENIHFSFFESKLGPHASRNIFTMAHLVDPKTTMFINEFNTLEQPRDLKSSPARYLE  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF  PN P IR+ LD L    LPIWLTE+DI+     
Sbjct  397  KLRELQSIQVAGKIPL-GIGLESHFGTPNIPFIRSALDTLGATGLPIWLTELDIDAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +A Y E VLRE  +HP V GI++WT  S KGC++MCLTD N  NLP GDVVD L++EW
Sbjct  454  NIRAKYFEQVLREGHAHPKVKGIVMWTGYSAKGCYRMCLTDGNFRNLPTGDVVDRLIREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSV--EYGNRTATSTFSL  108
                TQT  G TD +G +    F G+Y +++     N  A+  F+L
Sbjct  514  GGLHTQT-TGVTDANGLFEASLFHGDYDLNIFSPVTNSKASYNFTL  558



>ref|XP_009758358.1| PREDICTED: uncharacterized protein LOC104211061 [Nicotiana sylvestris]
Length=580

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 139/219 (63%), Gaps = 5/219 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG  A+  F++ A + D  A LF+NDFN +E   D  S+   Y++
Sbjct  343  DVVNENLHFNFFESKLGQGASANFYRLASQFDK-APLFLNDFNTIEEQKDGASSPANYLA  401

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+K+L+ GG +   GIGLEGHF+ PN P IR+ LD LA+ +LPIW+TE+D++       Q
Sbjct  402  KIKQLRAGGYNGPLGIGLEGHFNTPNQPYIRSSLDTLASAKLPIWITELDVSSG---PNQ  458

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            A +L+ +++EV  HPAV G+++W+A  P GCF+MCLTDNN  NLP GDVVD +      +
Sbjct  459  AQFLDQIIKEVVGHPAVQGLIIWSAWKPNGCFRMCLTDNNFKNLPTGDVVDRVRTTLSHE  518

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSLN  105
             L G T+  G +    F G+Y+  V +    A S+F  N
Sbjct  519  GLIGTTNSDGYFETSLFHGDYQAIVTHPLLLADSSFQHN  557



>ref|XP_010436270.1| PREDICTED: uncharacterized protein LOC104719990 [Camelina sativa]
Length=576

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 137/226 (61%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E +LGP+A+   F  AH  DP  T+F+N+FN +E   D KS+   Y+ 
Sbjct  337  DVVNENIHFSFFESKLGPNASRNIFTMAHFVDPKTTMFINEFNTLEYPQDLKSSPARYLE  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF  PN P IR+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELQSIQVAGKIPL-GIGLESHFGTPNIPFIRSALDTLGATGLPIWLTELDVDAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +  Y E VLRE  +HP V GI++WT  S KGC++MCLTD N  NLP GDVVD L++EW
Sbjct  454  NVRGKYFEQVLREGHAHPKVKGIVMWTGYSAKGCYRMCLTDGNFRNLPTGDVVDRLIREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSL  108
               +TQT  G TD +G +    F G+Y   +S    N  A+  F+L
Sbjct  514  GGLRTQT-TGVTDANGLFEASLFHGDYDLNISSPITNSKASYNFTL  558



>ref|XP_002468320.1| hypothetical protein SORBIDRAFT_01g043760 [Sorghum bicolor]
 gb|EER95318.1| hypothetical protein SORBIDRAFT_01g043760 [Sorghum bicolor]
Length=573

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 141/237 (59%), Gaps = 11/237 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +F+N++N +E   D  +    Y+
Sbjct  339  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDTGSALMFLNEYNTLEQPGDMAALPARYL  398

Query  581  SKMKEL----KQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
             +++++     + G  M  IGLEGHF+ PN P +RA LD LA   +P+WLTE+D+     
Sbjct  399  QRLQQIIAAYPENGAGM-AIGLEGHFTKPNIPYMRAALDTLAQAGIPVWLTEVDVAPG--  455

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
              +QA +LE VLRE ++HPAV GI++W+A  P+GC+ MCLTDNN  NLP GDVVD L+ E
Sbjct  456  -PSQAQHLEEVLREAYAHPAVQGIVIWSAWQPQGCYVMCLTDNNFKNLPQGDVVDRLIAE  514

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            W+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  515  WRASPRAGATDAQGYFEADLVHGEYKVTVSHPALNSSISRSVKVELGSGSEHYFIDM  571



>ref|XP_010530701.1| PREDICTED: uncharacterized protein LOC104807213 [Tarenaya hassleriana]
Length=577

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 141/233 (61%), Gaps = 14/233 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE L F  ++ RLGP A  E +  AH AD   TLFMN++N +E  +D   +   Y+ 
Sbjct  337  DVVNEQLPFSFFDSRLGPTAPGEIYNLAHAADSGVTLFMNEYNTLEEPNDKSCSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            ++++++      GI M GIGLE HF +PN P +R+ LD LA   LPIW+TE+DIN    +
Sbjct  397  RLRDIQSYKDNNGIPM-GIGLESHFKSPNIPYVRSALDTLAATGLPIWITELDINSSPDK  455

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
            + Q  YLE +LREV SHP V GI+LW  + P GC+ MCLTD N  NLP GDVVD L+ EW
Sbjct  456  QPQ--YLEQILREVHSHPQVKGIVLWAGLGPTGCYHMCLTDGNYKNLPTGDVVDKLIGEW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRT-ATSTFSLNRGEET  90
               + QT+ G  D  G +    F G+Y  K+S  + ++T AT  F L+   ET
Sbjct  514  GGFRKQTV-GVADRDGFFEASLFHGDYEVKISKPFASQTAATHVFKLSSEVET  565



>ref|XP_002465686.1| hypothetical protein SORBIDRAFT_01g043730 [Sorghum bicolor]
 gb|EER92684.1| hypothetical protein SORBIDRAFT_01g043730 [Sorghum bicolor]
Length=572

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 131/211 (62%), Gaps = 6/211 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E++LG DA+ E FK   + DP   LFMN+FN +E   D       Y++
Sbjct  344  DVVNENLHFSFFEEKLGKDASGEIFKEVAKLDPKPILFMNEFNTIEQPCDKAPLPTKYLA  403

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+++++    + D   GIGLE HF+ PN P +R  LD LA  ++PIWLTE+D+ K     
Sbjct  404  KLRQIQSYPGNEDLKYGIGLESHFAKPNIPYMRGSLDTLAAAKVPIWLTEVDVTK---GP  460

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             Q  +LE V+RE F HP V GI++W A   KGC+ MCLTDNN  NLP GD+VD LL EW+
Sbjct  461  KQVEFLEEVMREGFGHPGVKGIVMWAAWHAKGCYVMCLTDNNFKNLPQGDLVDRLLDEWR  520

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGN  135
                +  TD +G +    F GEY+V+V++ +
Sbjct  521  KVPEKPMTDSNGVFEAELFHGEYQVTVKHAS  551



>gb|EMS62252.1| Endo-1,4-beta-xylanase C [Triticum urartu]
Length=674

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 134/221 (61%), Gaps = 8/221 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP A+   ++   + D  A LFMN+FN +E   DP  T   Y++
Sbjct  441  DVVNENLHFNFFETKLGPSASPMIYQQVGQIDHTAVLFMNEFNTLEQPMDPNGTPTKYVA  500

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++      G    G+GLE HF+ PN P +R  LD LA L+LP+W+TE+D+ K    
Sbjct  501  KMKLIQGYPGNAGFKF-GVGLESHFTTPNLPYVRGALDTLAQLKLPMWMTEVDVVKG---  556

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  +LE VLRE + HP V GI++W A  P GC+ MCLTDN+  NLP GD+VD L+ EW
Sbjct  557  PNQVKFLEQVLREAYGHPGVQGIVMWAAWHPYGCYVMCLTDNSFKNLPVGDLVDKLIAEW  616

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
            +T      TD +G        G+YK++V++ ++T   + ++
Sbjct  617  KTHKTSAATDANGMLELDLAHGDYKLTVDHPSQTTAVSHTM  657



>emb|CDY28324.1| BnaC03g66350D [Brassica napus]
Length=573

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 133/225 (59%), Gaps = 11/225 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF   E + GP A+   F  AH  DP  T+FMN++N +E   DP +T   Y+ 
Sbjct  337  DVVNENLHFSFLESKFGPKASYNVFAQAHALDPKTTMFMNEYNTLEQPGDPVATPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGL+ HFS PN P +R+ +D LA   LPIWLTE+D+      
Sbjct  397  KLRELQSIHMAGNIPL-GIGLQCHFSTPNIPYMRSAIDTLAATGLPIWLTEVDVAAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E +LRE  +HP V G++ W   +PKGC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVQANYFEQILREGHAHPQVKGMVTWAGYNPKGCYRMCLTDGNFRNLPTGDVVDKLLREW  513

Query  230  Q--TQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               +    G TD  G +    F G+Y + + +   N TA+ +F L
Sbjct  514  GGLSGQTTGLTDADGFFEASLFHGDYNLDISHPLTNSTASHSFQL  558



>ref|XP_006651141.1| PREDICTED: uncharacterized protein LOC102719284 [Oryza brachyantha]
Length=557

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 129/210 (61%), Gaps = 9/210 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG DA+ E FK   + D    LFMN+FN +E  +DP      Y++
Sbjct  329  DVVNENLHFSFFEGKLGKDASAEIFKDVAKLDDKPILFMNEFNTIEQPNDPAPLPTKYLA  388

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K+ ++++    GG+   GIGLE HFS PN P +R  LD LA  ++PIWLTE+D+ K    
Sbjct  389  KLNKIREYPGNGGLKY-GIGLESHFSTPNIPYMRGSLDTLAQAKVPIWLTEVDVAK---C  444

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  +LE V+RE F+HPAV GI+LW A   KGC+ MCLTDNN  NLP GD +D LL EW
Sbjct  445  PKQVEHLEEVMREGFAHPAVKGIVLWGAWHAKGCYVMCLTDNNFKNLPVGDAIDKLLHEW  504

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            +     G TD  G      F GEY V+V++
Sbjct  505  KAGH-SGKTDSKGVLEAELFHGEYNVTVKH  533



>emb|CDY48434.1| BnaA08g11430D [Brassica napus]
Length=573

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 136/226 (60%), Gaps = 12/226 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++GP  +   F+ AH  DP  T+FMN+FN +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFENKMGPKVSYNVFEQAHAVDPTTTMFMNEFNTLEQPGDAVSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHF-SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K++EL+     G IS+ GIGLE HF + PN P +R+ LD L    LPIWLTE+D+     
Sbjct  397  KLRELQSIRVPGNISL-GIGLESHFFNTPNIPYMRSALDTLGATGLPIWLTEVDVAAP--  453

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA Y E VLRE  +HP V+G++ W+  +P+GCF+MCLTD N  NLP GDVVD LL+E
Sbjct  454  PNVQANYFEQVLREGHAHPKVTGMVTWSGYNPRGCFRMCLTDGNFRNLPTGDVVDKLLRE  513

Query  233  WQ--TQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
            W        G TD  G +    F G+Y +S+ +   N TA+ +F L
Sbjct  514  WGGLRGKTTGLTDADGYFEASLFHGDYDLSIAHPLTNSTASHSFKL  559



>gb|EMS55293.1| Endo-1,4-beta-xylanase C [Triticum urartu]
Length=585

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 133/217 (61%), Gaps = 8/217 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+   ++   + D  A LFMN+FN +E   DP  T   YI+
Sbjct  355  DVLNENLHFNFFETKLGPNASPMIYQQVGQIDHNAILFMNEFNTLEQPMDPNGTPTKYIA  414

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++     GG+ + G+GLE HFS PN P +R  LD LA L+LP+W+TE+D+ K    
Sbjct  415  KMKLIQGYPGNGGLKL-GVGLESHFSTPNIPYVRGALDTLAQLKLPMWMTEVDVVKG---  470

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE ++HP V GI++W A    GC+ MCLTDN+  NLP G +VD L+ EW
Sbjct  471  PNQVKYLEQVLREGYAHPGVQGIVMWAAWHANGCYVMCLTDNSFKNLPVGALVDKLIAEW  530

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
            +T      TD +G        G+YK++V + +  A S
Sbjct  531  KTHATSATTDANGLVELDLAHGDYKLTVNHPSSLAAS  567



>ref|XP_008658023.1| PREDICTED: putative glycosyl hydrolase family 10 protein isoform 
X2 [Zea mays]
 gb|ACL53134.1| unknown [Zea mays]
 gb|AFW89317.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=555

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 142/238 (60%), Gaps = 12/238 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +FMN+FN VE   D  +    Y+
Sbjct  320  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAALPARYL  379

Query  581  SKMKEL----KQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             +++++     + G  M  IGLEGHF+  PN P +RA LD LA   +P+WLTE+D+    
Sbjct  380  QRLQQIIAAYPENGAGM-AIGLEGHFTTNPNIPYMRAALDTLAQAGIPVWLTEVDVAPG-  437

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
               +QA +LE VLRE ++HPAV GI++W+A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  438  --PSQAQHLEEVLREAYAHPAVQGIVIWSAWRPEGCYVMCLTDNSFNNLPQGDVVDRLIA  495

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            EW+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  496  EWRATPRAGSTDAQGYFEAELVHGEYKVTVSHPALNSSISRSVKVELGSGSDHYFIDM  553



>ref|XP_010111686.1| Endo-1,4-beta-xylanase C [Morus notabilis]
 gb|EXC31477.1| Endo-1,4-beta-xylanase C [Morus notabilis]
Length=581

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 138/225 (61%), Gaps = 16/225 (7%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH + +E ++G +A+  F+  A  ADP  T+F+N++N +E   D K+T   Y+ 
Sbjct  336  DVVNENLHNNFFESKMGNNASATFYNWAFRADPETTMFLNEYNTIENPGDGKATPRMYLQ  395

Query  578  KMKELK------QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
            K++E++      +G +   GIGLE HF   N   +R+ +D LA   LPIW+TE+D+    
Sbjct  396  KLREIQGFPGNYKGKM---GIGLEAHFGTLNIAYVRSAIDVLAATGLPIWITELDVQ---  449

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
                QAIYLE +LRE+ SHP V GI++W+A  P+GC+QMCLTDNN  NLP GDVVD L+ 
Sbjct  450  SSPKQAIYLEQILRELHSHPGVKGIVIWSAWRPQGCWQMCLTDNNFKNLPTGDVVDKLMH  509

Query  236  EWQTQ---TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFS  111
            EW  Q    L G TD  G Y    F G+Y+V + +     +S+FS
Sbjct  510  EWGYQNRVVLSGTTDASGFYETSLFHGDYEVKISHP-EVISSSFS  553



>gb|KHN39897.1| Endo-1,4-beta-xylanase C [Glycine soja]
Length=420

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 131/212 (62%), Gaps = 10/212 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG   +   F  AH  D   TLF+N++N +E   D  S    YI 
Sbjct  180  DVVNENLHFSFFEGKLGQAFSGRIFHEAHNIDGQTTLFLNEYNTIEDSRDGVSIPARYIQ  239

Query  578  KMKELK----QGGISMDGIGLEGHFSAP--NPPLIRAILDKLATLRLPIWLTEIDINKKY  417
            K+K+++      G+ + GIGLE HFS P  N P +RA +D LA  RLPIW+TE+D+    
Sbjct  240  KLKKIQSYPGNAGLPI-GIGLEAHFSGPGINFPYLRASIDYLAATRLPIWITELDVA---  295

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
             Q  Q+ Y E  LRE+  HP V GI++WTA SP+GC+++CL DNN  NLPAG+VVD LL 
Sbjct  296  SQPRQSQYFELALRELHGHPMVRGIVMWTAWSPQGCYRICLVDNNFRNLPAGNVVDRLLS  355

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            EW+   L G TD++G +    F G+Y++ + +
Sbjct  356  EWRLSKLSGMTDQNGFFEANLFHGDYEMEISH  387



>gb|AAO15029.1| anther endoxylanase [Hordeum vulgare subsp. vulgare]
Length=318

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 6/210 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH   YE RLGP+ + E ++   + D  ATLFMN+++ +E   D  +    Y +
Sbjct  83   DVVNENLHGQFYESRLGPNVSAELYQQVAKIDTNATLFMNEYDTLEWALDVTAMASKYAA  142

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KM++++      GI +  +GLE HF  PN P +RA LD LA L++PIWLTE+D++ K  +
Sbjct  143  KMEQIRSYPGNDGIKL-AVGLESHFETPNIPYMRATLDMLAQLKVPIWLTEVDVSPK-TR  200

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE + HP V G++LW A    GC+ MCLTDN+  NLP G+VVD L+ EW
Sbjct  201  PYQVEYLEDVLREGYGHPNVEGMVLWAAWHKHGCWVMCLTDNSFTNLPTGNVVDKLIDEW  260

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            +T  +   TD HG        GEY+ +V +
Sbjct  261  KTHPVAATTDAHGVAELDLVHGEYRFTVTH  290



>ref|XP_010431685.1| PREDICTED: uncharacterized protein LOC104716033 [Camelina sativa]
Length=580

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 137/226 (61%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG  ++   F  AH  DP  T+FMN++N +E   D  S+   Y+ 
Sbjct  340  DVVNENLHFSFFESKLGYKSSYNAFSMAHAFDPRTTMFMNEYNTLEQPQDQSSSPARYLQ  399

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HFS PN P +R+ LD L    LPIWLTE+D++     
Sbjct  400  KLRELQSIRVAGNIPL-GIGLESHFSTPNIPYMRSALDTLGATGLPIWLTEVDVDAP--D  456

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +A Y E VLRE  +HP V GI++WT  SP+GC++MCLTD N  NLP GDVVD L++EW
Sbjct  457  NVRAKYFEQVLREGHAHPKVRGIVMWTGYSPRGCYRMCLTDGNFRNLPTGDVVDRLIREW  516

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSL  108
               ++QT  G TD +G +    F G+Y   +S  +    A+  F+L
Sbjct  517  GGFRSQTT-GVTDANGFFEASLFQGDYVLNISQPFTRSKASYNFTL  561



>dbj|BAK06950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 135/221 (61%), Gaps = 8/221 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF+ +E +LGP+A+   ++   + D  A LFMN+FNV+    DP      YI+
Sbjct  356  DVVNENVHFNFFETKLGPNASPMIYQQVGQIDHTAVLFMNEFNVLSQPMDPNINPAKYIA  415

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++      G+ + GIGLE HFS PN P +R+ LD LA L+LP+W+TE+D+ K   Q
Sbjct  416  KMKLIQGYPGNAGLKL-GIGLESHFSTPNIPYVRSTLDTLAQLKLPMWMTEVDVVKGPNQ  474

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
                  LE VLRE ++HP V GI++W A  P GC+ MCLTDNN  NLP GD+VD L+ EW
Sbjct  475  VKD---LEQVLREGYAHPGVQGIVMWAAWHPYGCYVMCLTDNNFKNLPVGDLVDKLIAEW  531

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
            +T      TD +G        G+YK++V + + T   + ++
Sbjct  532  KTHKTSAATDANGMVEPDLVHGDYKLTVNHPSHTTAVSHTM  572



>ref|XP_008658022.1| PREDICTED: putative glycosyl hydrolase family 10 protein isoform 
X1 [Zea mays]
 gb|AFW89318.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=576

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 142/238 (60%), Gaps = 12/238 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +FMN+FN VE   D  +    Y+
Sbjct  341  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAALPARYL  400

Query  581  SKMKEL----KQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             +++++     + G  M  IGLEGHF+  PN P +RA LD LA   +P+WLTE+D+    
Sbjct  401  QRLQQIIAAYPENGAGM-AIGLEGHFTTNPNIPYMRAALDTLAQAGIPVWLTEVDVAPG-  458

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
               +QA +LE VLRE ++HPAV GI++W+A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  459  --PSQAQHLEEVLREAYAHPAVQGIVIWSAWRPEGCYVMCLTDNSFNNLPQGDVVDRLIA  516

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            EW+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  517  EWRATPRAGSTDAQGYFEAELVHGEYKVTVSHPALNSSISRSVKVELGSGSDHYFIDM  574



>ref|XP_010437711.1| PREDICTED: uncharacterized protein LOC104721431 [Camelina sativa]
Length=576

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 139/227 (61%), Gaps = 13/227 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E +LGP+A+   F  AH  DP  T+F+N+FN +E   D KS+   Y+ 
Sbjct  337  DVVNENIHFSFFESKLGPNASRNIFTMAHFVDPKTTMFINEFNTLEYPQDLKSSPARYLE  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF  PN P IR+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELQSIQVAGKIPL-GIGLESHFGTPNIPFIRSALDTLGATGLPIWLTELDVDAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +A Y E VLRE  +HP V GI++WT  S KGC++MCLTD N  NLP GDVVD L++EW
Sbjct  454  NIRAKYFEQVLREGHAHPKVKGIVMWTGYSVKGCYRMCLTDGNFRNLPTGDVVDRLIREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSV--EYGNRTATSTFSLN  105
               +TQT  G TD +G      F G+Y +++     N  A+  F+L+
Sbjct  514  GGFRTQT-TGVTDANGLLEASLFHGDYDLNIFSPVTNSKASYNFTLS  559



>emb|CDY69164.1| BnaAnng29520D [Brassica napus]
Length=573

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 132/225 (59%), Gaps = 11/225 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF   E + GP A+   F  AH  DP  T+FMN++N +E   D  +T   Y+ 
Sbjct  338  DVVNENLHFSFLESKFGPKASYNVFAQAHALDPTTTMFMNEYNTLEQPGDSVATPARYLQ  397

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGL+ HFS PN P +R+ LD LA   LPIWLTEID+      
Sbjct  398  KLRELQSIHVAGNIPL-GIGLQSHFSTPNIPYMRSALDTLAATGLPIWLTEIDVAAP--P  454

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E +LRE  +HP V G++ W   +PKGC++MCLTD N  NLP GDVVD LL+EW
Sbjct  455  NVQANYFEQILREGHAHPQVKGMVTWAGYNPKGCYRMCLTDGNFRNLPTGDVVDKLLREW  514

Query  230  Q--TQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               +    G TD  G +    F G+Y + + +   N TA+ +F L
Sbjct  515  GGLSGQTTGLTDADGFFEASLFHGDYNLDISHPLTNSTASHSFKL  559



>ref|XP_006661710.1| PREDICTED: uncharacterized protein LOC102721021 [Oryza brachyantha]
Length=580

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 137/220 (62%), Gaps = 11/220 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+   ++   + D  A LFMN+FN +E   DP      YI+
Sbjct  345  DVVNENLHFNYFEGKLGPNASPMIYQQVGQIDRNAILFMNEFNTLEQPGDPNPVPSKYIA  404

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK+++     GG+ + G+GLE HFS PN P +R+ LD LA L+LP+WLTE+D+ K    
Sbjct  405  KMKQIQGYAGNGGLKL-GVGLESHFSTPNIPYMRSALDTLAQLKLPMWLTEVDVVKG---  460

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE ++HP+V+G+++W A   KGC+ MCLTDNN  NLP G++VD L+ EW
Sbjct  461  PNQVKYLEQVLREGYAHPSVNGMIMWAAWHAKGCYVMCLTDNNFKNLPVGNLVDKLIAEW  520

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY---GNRTATS  120
            +T      T   G+       G+Y ++V +   G + A S
Sbjct  521  KTHKTAATTGADGAVELDLPHGDYNLTVSHPSLGTKGAAS  560



>ref|NP_001130600.1| putative glycosyl hydrolase family 10 protein [Zea mays]
 gb|ACF78883.1| unknown [Zea mays]
 gb|ACR35838.1| unknown [Zea mays]
 gb|AFW89319.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=595

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 142/238 (60%), Gaps = 12/238 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +FMN+FN VE   D  +    Y+
Sbjct  360  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAALPARYL  419

Query  581  SKMKEL----KQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             +++++     + G  M  IGLEGHF+  PN P +RA LD LA   +P+WLTE+D+    
Sbjct  420  QRLQQIIAAYPENGAGM-AIGLEGHFTTNPNIPYMRAALDTLAQAGIPVWLTEVDVAPG-  477

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
               +QA +LE VLRE ++HPAV GI++W+A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  478  --PSQAQHLEEVLREAYAHPAVQGIVIWSAWRPEGCYVMCLTDNSFNNLPQGDVVDRLIA  535

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            EW+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  536  EWRATPRAGSTDAQGYFEAELVHGEYKVTVSHPALNSSISRSVKVELGSGSDHYFIDM  593



>ref|XP_009596823.1| PREDICTED: uncharacterized protein LOC104092845 [Nicotiana tomentosiformis]
Length=579

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 134/207 (65%), Gaps = 5/207 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG  A+  F++ A + D  A LF+NDFN +E   D  S+   Y++
Sbjct  343  DVVNENLHFNFFESKLGQGASANFYRLASQFDK-APLFLNDFNTIEEQKDGASSPANYLA  401

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+++L+ GG +   GIGLEGHF+ PN P IR+ LD LA+ +LPIW+TE+D++       Q
Sbjct  402  KIRQLRAGGYNGPLGIGLEGHFTTPNQPYIRSALDTLASAKLPIWITELDVSSS---PNQ  458

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            A +L+ +++EV  HPAV G+++W+  SP GCF+MCLTDNN  NLP GDVVD +      +
Sbjct  459  AQFLDQIIKEVVGHPAVQGLIIWSGWSPNGCFRMCLTDNNFKNLPTGDVVDRVRTTLSHE  518

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEY  141
             L G T+  G +    F G+Y+  V +
Sbjct  519  GLIGTTNSDGYFETSLFHGDYQAVVTH  545



>emb|CDY28325.1| BnaC03g66340D [Brassica napus]
Length=579

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 136/226 (60%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E+++ P A+   FK A   DP +T F+N++N +E   D  S+   Y+ 
Sbjct  341  DVVNENLHFSYFEKKMSPKASYNIFKMAQAFDPTSTKFINEYNTLEEPRDSDSSPAKYLK  400

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++ELK    +G IS+ GIGLE HF  PN P +R+ LD L    LPIWLTE+D+     +
Sbjct  401  KLRELKSIVVRGNISL-GIGLESHFKTPNIPFMRSALDILGATGLPIWLTEVDVEAP--K  457

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V GI+ W   SP GC++MCLTD N  NLP GDVVD LL EW
Sbjct  458  NVQAKYFEQVLREGHAHPRVKGIVTWAGYSPTGCYRMCLTDGNFKNLPTGDVVDKLLHEW  517

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               + QT +G TD  G +    F G+Y + +++   N  A+ +F L
Sbjct  518  GGFRRQT-KGFTDADGFFEASFFNGDYDLKIDHPLTNFKASHSFKL  562



>ref|XP_009406796.1| PREDICTED: uncharacterized protein LOC103989620 [Musa acuminata 
subsp. malaccensis]
Length=572

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 132/208 (63%), Gaps = 6/208 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  +E RLG +A+  F++ AH+ DP A +F+NDFN +E   D K T   Y+ 
Sbjct  342  DVVNENVHFSYFESRLGENASSIFYQQAHQLDPNALMFLNDFNTLEAPEDEKVTPVKYLQ  401

Query  578  KMKELKQ-GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+++++  G      IGLEGHF+ P+   +R+ LD LA   +PIWLTE+D+        +
Sbjct  402  KLQQIQSFGNFPRMAIGLEGHFTTPDISYMRSALDNLAGANVPIWLTEVDV----AHSNE  457

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCF-QMCLTDNNLNNLPAGDVVDNLLKEWQT  225
            + +LE +LRE +SHPAV GI+++   +PKGCF +MCLTD N  NLP GDVVD L+ EW+T
Sbjct  458  SKHLEDILREAYSHPAVQGIVIFGVWNPKGCFSRMCLTDVNFKNLPTGDVVDKLIAEWRT  517

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
              +   TD  G      F GEYK+++ +
Sbjct  518  HNVAATTDADGLLRAELFHGEYKITINH  545



>gb|KFK40660.1| hypothetical protein AALP_AA2G025200 [Arabis alpina]
Length=429

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 135/231 (58%), Gaps = 11/231 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LGP+A+   +  AH  DP  T+FMN++N +E  +   ++   Y+ 
Sbjct  196  DVVNENLHFSFFESKLGPNASNVIYAMAHANDPKTTMFMNEYNTLEKPTGSAASPAKYLK  255

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
             ++EL+     G I + GIGLE HF  PN P +R+ LD LA   LPIWLTE+D+  K  Q
Sbjct  256  TLRELQNIRVAGKIPL-GIGLESHFGTPNIPYMRSALDTLAATGLPIWLTEVDV--KAPQ  312

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V G++ W+  +P GCF MCLTD N  NLP GDVVD LL EW
Sbjct  313  NVQAKYFEQVLREGHAHPQVKGMVTWSGYNPAGCFVMCLTDGNFKNLPTGDVVDKLLHEW  372

Query  230  Q--TQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSLNRGEET  90
                + + G TD  G +    FLG+Y   +S    N   + +F L   E++
Sbjct  373  GGLGRKIIGLTDTDGFFEASLFLGDYDFNISSPVTNSKGSYSFKLTSDEQS  423



>gb|EMT18889.1| Endo-1,4-beta-xylanase C [Aegilops tauschii]
Length=584

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 131/217 (60%), Gaps = 8/217 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+   ++   + D  A LFMN+FN +E   DP  T   YI+
Sbjct  354  DVLNENLHFNFFETKLGPNASPMIYQQVGQIDHNAILFMNEFNTLEQPMDPNGTPTKYIA  413

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++     GG+ + G+GLE HFS PN P +R  LD LA L+LP+W+TE+D+ K    
Sbjct  414  KMKLIQGSPGNGGLKL-GVGLESHFSTPNIPYVRGALDTLAQLKLPMWMTEVDVVKG---  469

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE + HP V GI++W A    GC+ MCLTDN   NLP G +VD L+ EW
Sbjct  470  PNQVKYLEQVLREGYGHPGVQGIVMWAAWHANGCYVMCLTDNTFKNLPVGALVDKLIAEW  529

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
            +T      TD +G        G+YK++V + +  A S
Sbjct  530  KTHATSATTDANGLVELDLAHGDYKLTVNHPSSLAAS  566



>gb|AFW89320.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=625

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 142/238 (60%), Gaps = 12/238 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +FMN+FN VE   D  +    Y+
Sbjct  390  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAALPARYL  449

Query  581  SKMKEL----KQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             +++++     + G  M  IGLEGHF+  PN P +RA LD LA   +P+WLTE+D+    
Sbjct  450  QRLQQIIAAYPENGAGM-AIGLEGHFTTNPNIPYMRAALDTLAQAGIPVWLTEVDVAPG-  507

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
               +QA +LE VLRE ++HPAV GI++W+A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  508  --PSQAQHLEEVLREAYAHPAVQGIVIWSAWRPEGCYVMCLTDNSFNNLPQGDVVDRLIA  565

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            EW+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  566  EWRATPRAGSTDAQGYFEAELVHGEYKVTVSHPALNSSISRSVKVELGSGSDHYFIDM  623



>ref|XP_003571749.1| PREDICTED: uncharacterized protein LOC100833088 [Brachypodium 
distachyon]
Length=590

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 8/210 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LGP+A+ + ++   + D  A LFMN+FN +E   DP  T   Y++
Sbjct  358  DVVNENLHFNFFETKLGPNASPQIYQQVGQIDHNAVLFMNEFNTLEQPMDPNGTPTKYVA  417

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KMK ++     GG+ + G+GLE HFS PN P +R  LD LA L+LP+W+TE+D+ K    
Sbjct  418  KMKLIRGYPGNGGLKL-GVGLESHFSTPNIPYVRGALDTLAQLKLPMWMTEVDVVKG---  473

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE + HP V GI++W A    GC+ MCLTDN+  NLP G +VD L+ EW
Sbjct  474  PNQVKYLEQVLREGYGHPGVQGIIMWAAWHANGCYVMCLTDNSFKNLPVGALVDKLIAEW  533

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            +T      TD +G        G+Y ++V +
Sbjct  534  KTHKTAATTDANGVVDLDLVHGDYSLAVNH  563



>gb|EAY88933.1| hypothetical protein OsI_10417 [Oryza sativa Indica Group]
Length=567

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 138/228 (61%), Gaps = 12/228 (5%)
 Frame = -1

Query  740  LHFDLYEQRLGPDATLEFFKTAHEADPLATL-FMNDFNVVETCSDPKSTVDTYISKMKEL  564
            LHF  +E+R G DA+  F+  A   D  +TL FMN++N +E   D  +    Y+ ++K++
Sbjct  341  LHFSFFERRFGWDASTAFYAAARMLDTGSTLMFMNEYNTLEQPGDMAALPARYVQRLKQI  400

Query  563  ----KQGGISMDGIGLEGHFSAP-NPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
                 Q G  M  IGLEGHF+AP N P +RA LD LA   +P+WLTE+D+    G  +QA
Sbjct  401  IGGYPQNGAGM-AIGLEGHFTAPVNIPYMRAALDTLAQAGVPVWLTEVDVG---GGASQA  456

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQT  219
             YLE +LRE ++HPAV G++LW A  P+GC+ MCLTDN+ NNLP GDVVD L+ EW T  
Sbjct  457  YYLEEILREAYAHPAVQGVILWAAWRPQGCYVMCLTDNDFNNLPQGDVVDRLITEWSTAP  516

Query  218  LEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHF  81
              G TD  G +      GEYKV+V +   N + + +  +  G  + +F
Sbjct  517  RAGTTDAEGFFQAELAHGEYKVTVTHPSLNTSVSQSVKVEMGSGSHYF  564



>emb|CBI22450.3| unnamed protein product [Vitis vinifera]
Length=1130

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 138/216 (64%), Gaps = 9/216 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E RLG  AT   F+   + D   TLFMN+++ +E      ++ D Y+ 
Sbjct  361  DVVNENLHFSFFESRLGAKATGVAFQKTRQLDGRTTLFMNEYDTIEKSGKGSASPDKYLQ  420

Query  578  KMKELK---QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++E++   +GG ++ GIGLEGHF  PN P +R+ +DKLA  + PIW+TE+D++      
Sbjct  421  KLREIQSFLRGGGNL-GIGLEGHFRTPNIPYMRSAIDKLAAAKFPIWITELDVDP-----  474

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
            +Q ++L+ VLRE  +HPA+ GI++W A  P+GCF+MCLTD+N  N P GDVVD LL++W 
Sbjct  475  SQPMHLDQVLREAHAHPAIHGIVMWAAWKPEGCFRMCLTDSNFKNTPTGDVVDKLLQQWT  534

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
               L G TD  G +    F G+Y+V++ +   T +S
Sbjct  535  HAGLVGTTDADGFFETSLFHGDYEVAITHPTVTNSS  570


 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 125/208 (60%), Gaps = 6/208 (3%)
 Frame = -1

Query  758   DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
             DV NE LH   +E +LGP+A+  FF+   + D    LFMN++N +E   DP ST   YI 
Sbjct  895   DVVNENLHTSFFEDKLGPNASAVFFQETRQLDKTTPLFMNEYNTLENGGDPLSTPAKYIQ  954

Query  578   KMKELKQGG--ISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQET  405
             K+++++     I   GIGL+GHF  P+   +R+ LD LA  +LPIW+TE+D+        
Sbjct  955   KLRDIQSFSPDIGSVGIGLQGHFHTPDLAYMRSSLDTLAAAKLPIWITELDVASS---PD  1011

Query  404   QAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQT  225
             QA YLE VL E  +HPAV GI++W A  P+GCF+MCLTD    NL  GDVVD L+ +W T
Sbjct  1012  QASYLEQVLSEAHAHPAVVGIVMWAAWKPEGCFRMCLTDGQFKNLATGDVVDKLISQW-T  1070

Query  224   QTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
                 G T+  G      F G+Y+VS+ +
Sbjct  1071  GRFVGMTNADGFLETSLFHGDYEVSISH  1098



>emb|CDY48433.1| BnaA08g11420D [Brassica napus]
Length=579

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 135/226 (60%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E+++GP A+   FK A   DP  T F+N++N +E   D  S+   ++ 
Sbjct  341  DVVNENLHFSYFEKKMGPKASRNIFKMAQAFDPTTTKFINEYNTLEEPRDLDSSPAKFLK  400

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++ELK    +G IS+ GIGLE HF  PN P +R+ LD L    LPIWLTE+D+     +
Sbjct  401  KLRELKSIVVRGNISL-GIGLESHFKTPNIPFMRSALDILGATDLPIWLTEVDVEAP--K  457

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V GI+ W   SP GC++MCLTD N  NLP GDVVD LL EW
Sbjct  458  NVQAKYFEQVLREGHAHPRVKGIVTWAGYSPTGCYRMCLTDGNFKNLPTGDVVDKLLHEW  517

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               + QT +G TD  G +    F G+Y   +++   N  A+ +F L
Sbjct  518  GGFRRQT-KGLTDADGFFEASLFHGDYDFKIDHPLTNSKASHSFKL  562



>emb|CDO97285.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 140/215 (65%), Gaps = 4/215 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +H + +E +LG  A+  F+  A++ D  A  F+ND+N +E   D  S+   Y++
Sbjct  313  DVVNENIHHNFFESKLGETASSVFYGQANQIDGKAIPFLNDYNTIEKKDDQTSSPPKYLA  372

Query  578  KMKELK-QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K+KE++ QG     GIGLEGHF AP+   +R  +D LA+ +LPIW+TE+D++    Q  Q
Sbjct  373  KIKEIRSQGYQGPLGIGLEGHFGAPDLAYVRTSIDLLASTKLPIWVTELDVSS---QPNQ  429

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            A YL+ ++REV  HPA+ G+++W A SP+GC++MCLTDNN  NLP GDVVD ++KE + +
Sbjct  430  ATYLDQIIREVRGHPAIQGLLIWAAWSPQGCYRMCLTDNNFRNLPTGDVVDKIIKELKHE  489

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATST  117
             L G TD+ G +    + G+Y+  + +    ++S+
Sbjct  490  DLIGTTDDEGHFETSLYHGDYEAIISHPAMPSSSS  524



>ref|XP_009108857.1| PREDICTED: uncharacterized protein LOC103834542 [Brassica rapa]
Length=581

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 135/226 (60%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E+++GP A+   FK A   DP  T F+N++N +E   D  S+   ++ 
Sbjct  343  DVVNENLHFSYFEKKMGPKASRNIFKMAQAFDPTTTKFINEYNTLEEPRDLDSSPAKFLK  402

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++ELK    +G IS+ GIGLE HF  PN P +R+ LD L    LPIWLTE+D+     +
Sbjct  403  KLRELKSIVVRGNISL-GIGLESHFKTPNIPFMRSALDILGATDLPIWLTEVDVEAP--K  459

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V GI+ W   SP GC++MCLTD N  NLP GDVVD LL EW
Sbjct  460  NVQAKYFEQVLREGHAHPRVKGIVTWAGYSPTGCYRMCLTDGNFKNLPTGDVVDKLLHEW  519

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               + QT +G TD  G +    F G+Y   +++   N  A+ +F L
Sbjct  520  GGFRRQT-KGLTDADGFFEASLFHGDYDFKIDHPLTNSKASHSFKL  564



>ref|XP_002867152.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43411.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 138/224 (62%), Gaps = 11/224 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LGP A+   +  AH  DP  T+F+N++N +E  +D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKLGPKASYNTYAMAHAFDPRTTMFLNEYNTLEQPNDLTSSPARYLG  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HFS PN P +R+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELQSIRVAGKIPL-GIGLESHFSTPNIPYMRSALDTLGATGLPIWLTEVDVDAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              ++ Y E VLRE  +HP V G+++WT  SP GC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVRSKYFEQVLREGHAHPKVKGMVMWTGYSPSGCYRMCLTDGNFKNLPTGDVVDKLLREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
                +QT  G TD +G +    F G+Y +++ +    + S+++ 
Sbjct  514  GGLHSQTT-GVTDANGFFEASLFHGDYDLNISHPLTNSKSSYNF  556



>gb|KFK30011.1| hypothetical protein AALP_AA7G206200 [Arabis alpina]
Length=468

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 137/222 (62%), Gaps = 9/222 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH   +E  LGP A+   +  A+  DP  TL+MN++N +E  +D  ST   Y+ 
Sbjct  236  DVMNENLHRSFFESMLGPTASNMIYAMANANDPTTTLYMNEYNTIEKPTDLASTPARYLQ  295

Query  578  KMKELK--QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQET  405
            K++EL+  QG I + GIGLE HF+ PN P +R+ LD  A   LPIWLTE+D+  +     
Sbjct  296  KLRELQNIQGKIPL-GIGLESHFNIPNIPYMRSALDTFAATGLPIWLTEVDV--RASTNL  352

Query  404  QAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--  231
            QA+Y E VLRE  +HP V G++ W+  +P GCF MCLTD N  NLP GDVVD LL+EW  
Sbjct  353  QAMYFEQVLREGHAHPQVKGMVTWSGYNPAGCFAMCLTDGNFKNLPTGDVVDKLLREWGG  412

Query  230  -QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
               +T+ G TD  G +    FLG+Y ++V +    + +++S+
Sbjct  413  LGGKTI-GVTDTDGFFEASLFLGDYNLNVSHPLTNSEASYSI  453



>gb|KCW55102.1| hypothetical protein EUGRSUZ_I01061, partial [Eucalyptus grandis]
Length=523

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG  A+   +KTA   DP  TLF+N++N +E   D  ++   Y  
Sbjct  305  DVVNENLHFSFFESKLGSQASANAYKTAKYMDPSTTLFLNEYNTIEDSRDWATSPTAYAK  364

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ ++  G    GIGLE HF+ P+ P +R+ +D L  L LP+WLTE+D+  + G   +A
Sbjct  365  KVRYIQSLGGGNLGIGLESHFNVPDLPYMRSAIDTLGALGLPMWLTEVDV--QSGPNQKA  422

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--QT  225
            +YLE VLRE  +HP ++GI++WTA  P+GC++MCLTDNN  NLP GDVVD LLKEW    
Sbjct  423  MYLEQVLREAHAHPKINGIVMWTAWKPEGCYRMCLTDNNFRNLPTGDVVDKLLKEWGGGR  482

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSV  147
            Q L G T  +G+     F G+Y+V+V
Sbjct  483  QELSGMTSPNGTLEASLFHGDYQVTV  508



>gb|AHH32689.1| xylanase 3, partial [Phoenix dactylifera]
Length=460

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DVSNEMLHFD YEQRLG +AT +FF TA ++DP ATLFMNDFNV+ETC D  STVD+Y S
Sbjct  324  DVSNEMLHFDFYEQRLGYNATFDFFATAQQSDPYATLFMNDFNVIETCDDVNSTVDSYAS  383

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            ++KE+K+GG  ++GIGLEGHFS PN PL+RA+LDKLATL+LPIWLTEIDI+  + Q+TQ
Sbjct  384  RLKEIKEGGGVLEGIGLEGHFSKPNFPLMRAVLDKLATLKLPIWLTEIDISNSFDQQTQ  442



>ref|XP_009108771.1| PREDICTED: uncharacterized protein LOC103834457 [Brassica rapa]
Length=573

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 131/225 (58%), Gaps = 11/225 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF   E + GP A+   F  AH  DP  T+FMN++N +E   DP +T   Y+ 
Sbjct  338  DVVNENLHFSFLESKFGPKASYNVFAQAHALDPTTTVFMNEYNTLEQPGDPVATPARYLQ  397

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGL+ HFS PN P +R+ LD LA   LP WL E+D+      
Sbjct  398  KLRELQSIHVAGNIPL-GIGLQSHFSTPNIPYMRSALDTLAATGLPNWLAEVDVAAP--P  454

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E +LRE  +HP V G++ W   +PKGC++MCLTD N  NLP GDVVD LL+EW
Sbjct  455  NVQANYFEQILREGHAHPQVKGMVTWAGYNPKGCYRMCLTDGNFRNLPTGDVVDKLLREW  514

Query  230  Q--TQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               +    G TD  G +    F G+Y + + +   N TA+ +F L
Sbjct  515  GGLSGQTTGLTDADGFFEASLFHGDYNLDISHPLTNSTASHSFKL  559



>ref|XP_010436271.1| PREDICTED: uncharacterized protein LOC104719991 [Camelina sativa]
Length=577

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 134/226 (59%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG   +   F  AH  DP  T+FMN++N +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKLGYKTSYNAFSMAHAFDPRTTMFMNEYNTLEQPQDQSSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HFS PN P +R+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELQSIRVAGNIPL-GIGLESHFSTPNIPYMRSALDTLGATGLPIWLTEVDVDAP--D  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +A Y E VLRE  +HP V GI++W   SP GC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVRAKYFEQVLREGHAHPKVRGIVMWAGYSPSGCYRMCLTDGNFRNLPTGDVVDKLLREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSL  108
               ++QT  G TD +G +    F G+Y   +S  +    A+  F+L
Sbjct  514  GGFRSQTT-GVTDANGFFEASLFQGDYVLNISQPFTKSKASYNFTL  558



>ref|XP_011459682.1| PREDICTED: endo-1,4-beta-xylanase 2-like [Fragaria vesca subsp. 
vesca]
Length=548

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 139/219 (63%), Gaps = 9/219 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E R+GP A+   +  A +AD    LF+N++N +E   D K++   YI+
Sbjct  310  DVVNENLHFNFFESRMGPLASGIMYNWALKADGATPLFLNEYNTIEDSRDWKASPKAYIN  369

Query  578  KMKELKQ---GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            +++ +++         GIGLE HF  PN P IRA +D LAT ++PIW+TE+D+       
Sbjct  370  RLRGIQRVLDNYKGRFGIGLESHFVTPNIPYIRASIDYLATAKVPIWITELDVQSG---P  426

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA+YLE +LRE+ SHP V GI++W+A  P+GC++MCLTDNN  NL  G+VVD LL EW 
Sbjct  427  NQALYLEQILRELHSHPQVQGIVIWSAWQPQGCYRMCLTDNNFKNLATGNVVDKLLHEWG  486

Query  227  TQTLE---GGTDEHGSYSFMGFLGEYKVSVEYGNRTATS  120
             ++ E     TD +G +    F G+Y+V++ + + T +S
Sbjct  487  LRSFESTSAATDANGFFEASLFHGDYEVTITHPSVTNSS  525



>ref|NP_001241765.1| 1,4-beta-xylanase precursor [Zea mays]
 gb|ACG36704.1| 1,4-beta-xylanase [Zea mays]
Length=576

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 141/238 (59%), Gaps = 12/238 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADP-LATLFMNDFNVVETCSDPKSTVDTYI  582
            DV NE LHF+ YE R G DA+  F+  A   D   A +FMN+FN VE   D  +    Y+
Sbjct  341  DVVNENLHFNFYEGRFGWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAALPARYL  400

Query  581  SKMKEL----KQGGISMDGIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKY  417
             +++++     + G  M  IGLEGHF+  PN P +RA LD LA   +P+WLTE+D+    
Sbjct  401  QRLQQIIAAYPENGAGM-AIGLEGHFTTNPNIPYMRAALDTLAQAGIPVWLTEVDVAPG-  458

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
               +QA +LE VL E ++HPAV GI++W+A  P+GC+ MCLTDN+ NNLP GDVVD L+ 
Sbjct  459  --PSQAQHLEEVLXEAYAHPAVQGIVIWSAWRPEGCYVMCLTDNSFNNLPQGDVVDRLIA  516

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSLNRGEETRHFRIQL  69
            EW+     G TD  G +      GEYKV+V +   N + + +  +  G  + H+ I +
Sbjct  517  EWRATPRAGSTDAQGYFEAELVHGEYKVTVSHPALNSSISRSVKVELGSGSDHYFIDM  574



>ref|XP_006590847.1| PREDICTED: LOW QUALITY PROTEIN: endo-1,4-beta-xylanase C-like 
[Glycine max]
Length=574

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 131/212 (62%), Gaps = 10/212 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG   +   F  AH  D   TLF+N++N +E   D  S    YI 
Sbjct  334  DVVNENLHFSFFEGKLGQAFSGRIFHEAHNIDGQTTLFLNEYNTIEDSRDGVSIPARYIQ  393

Query  578  KMKELK----QGGISMDGIGLEGHFSAP--NPPLIRAILDKLATLRLPIWLTEIDINKKY  417
            K+K+++      G+ + GIGLE HFS P  N P +RA +D LA  RLPIW+TE+D+    
Sbjct  394  KLKKIQSYPGNAGLPI-GIGLEAHFSGPGINFPYLRASIDYLAATRLPIWITELDVAS--  450

Query  416  GQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLK  237
             Q  Q+ Y E  LRE+  HP V GI++WTA SP+GC+++CL DNN  NLPAG+VVD LL 
Sbjct  451  -QPRQSQYFELALRELHGHPMVRGIVMWTAWSPQGCYRICLVDNNFRNLPAGNVVDRLLS  509

Query  236  EWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            EW+   L G TD++G +    F G+Y++ + +
Sbjct  510  EWRLSKLSGMTDQNGFFEANLFHGDYEMEISH  541



>ref|XP_010451108.1| PREDICTED: uncharacterized protein LOC104733204 [Camelina sativa]
Length=575

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 136/226 (60%), Gaps = 15/226 (7%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG  ++   F  AH  DP  T+FMN++N +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKLGYKSSYNAFSMAHAFDPRTTMFMNEYNTLEQPQDQSSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF+ PN P +R+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELQSIRVAGNIPL-GIGLESHFTTPNIPYMRSALDTLGATGLPIWLTEVDVDAP---  452

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
               A Y E VLRE  +HP V GI++WT  SP+GC++MCLTD N  NLP GDVVD L++EW
Sbjct  453  -DYAKYFEQVLREGHAHPKVKGIVMWTGYSPRGCYKMCLTDGNFRNLPTGDVVDRLIREW  511

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSL  108
               ++QT  G TD +G +    F G+Y   +S  +    A+  F+L
Sbjct  512  GGFRSQTT-GVTDANGFFEASLFQGDYVLNISQPFTKSKASYNFTL  556



>ref|XP_010437712.1| PREDICTED: uncharacterized protein LOC104721432 [Camelina sativa]
Length=577

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 135/224 (60%), Gaps = 11/224 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG   +   F  AH  DP  T+FMN++N +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKLGYKTSYNAFSMAHAFDPRTTMFMNEYNTLEQPQDQSSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HFS PN P +R+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELQSIRVAGNIPL-GIGLESHFSTPNIPYMRSALDTLGATGLPIWLTEVDVDAP--D  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +A Y E VLRE  +HP V GI++W   SP GC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVRAKYFEQVLREGHAHPKVRGIVMWAGYSPSGCYRMCLTDGNFRNLPTGDVVDKLLREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL  108
               ++QT  G TD +G +    F G+Y +++   +  + ++++ 
Sbjct  514  GGFRSQTT-GVTDANGFFEASLFQGDYVLNISQPSTKSKASYNF  556



>ref|XP_007131684.1| hypothetical protein PHAVU_011G033100g [Phaseolus vulgaris]
 gb|ESW03678.1| hypothetical protein PHAVU_011G033100g [Phaseolus vulgaris]
Length=570

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 134/214 (63%), Gaps = 9/214 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF  YE +LG   + + F   H+ D   TLF+ND+N +E  SD +S+   Y+ 
Sbjct  332  DVVNENMHFSFYESKLGKTFSGKIFNEVHKIDGQTTLFLNDYNTIEEISDGESSPARYLQ  391

Query  578  KMKELK----QGGISMDGIGLEGHFS-APNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K+K+++      GI M GIGLE HFS A N P +R+ LD L   RLPIW+TE+D+     
Sbjct  392  KIKQIQSYAGNRGIPM-GIGLESHFSHAINFPYMRSSLDYLGATRLPIWITELDVA---S  447

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
            Q  Q  Y E  L+E  SHP V GI++WTA SP+GC+++CL DNN  NLPAG+VVD  + +
Sbjct  448  QPRQLQYFELALKEAHSHPMVRGIVMWTAWSPQGCYKLCLVDNNFKNLPAGNVVDKFISQ  507

Query  233  WQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNR  132
            W++  L G TD++G      F G+Y++ + + N+
Sbjct  508  WKSNKLSGVTDKNGFLEITLFHGDYEMEILHPNQ  541



>ref|XP_010230224.1| PREDICTED: uncharacterized protein LOC100827817 [Brachypodium 
distachyon]
Length=548

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 135/219 (62%), Gaps = 11/219 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEAD--PLATLFMNDFNVVETCSDPKSTVDTY  585
            DV NE LHF  +E++ G DA+  F+  A   D  P A +FMN+FN +E   D  +    Y
Sbjct  315  DVVNENLHFSFFERQFGWDASTAFYAAARLLDGAPGALMFMNEFNTLEQPGDMAAQPARY  374

Query  584  ISKMKEL----KQGGISMDGIGLEGHFSAP-NPPLIRAILDKLATLRLPIWLTEIDINKK  420
            + ++K++     + G  M  IGLEGHF+ P N P +RA LD L+ + LP+WLTE+D+   
Sbjct  375  VQRLKQIISSYPENGAGM-AIGLEGHFTNPVNIPYMRAALDTLSQVGLPVWLTEVDVAAG  433

Query  419  YGQETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLL  240
                 QA +LE VLRE ++HPAV G++LW+A  P+GC+ MCLTDN+  NLP GDVVD LL
Sbjct  434  ---PQQAAHLEEVLREAYAHPAVQGVILWSAWHPQGCYVMCLTDNSFVNLPQGDVVDRLL  490

Query  239  KEWQTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTAT  123
             EW+T    G TD  G +      GEYKV+V + +  A+
Sbjct  491  AEWKTAAQVGVTDAQGYFQAELVHGEYKVTVTHPSLNAS  529



>gb|ABF94509.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=555

 Score =   188 bits (477),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 129/209 (62%), Gaps = 7/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG DA+ E F+   + D    LFMN+FN +E  +D       Y++
Sbjct  299  DVVNENLHFNFFEGKLGKDASAEIFRDVAKLDSKPILFMNEFNTIEEPNDAAPLPTKYVA  358

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K++++   + D   GIGLE HF+APN P +R  +D LA  ++PIWLTE+D+      +
Sbjct  359  KLKQIREFPGNADLKYGIGLESHFAAPNIPYMRGSIDTLAQAKVPIWLTEVDVKP---CK  415

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             Q  YL+ V+RE F+HPAV GI+LW A   KGC+ MC TDN+  NLP GD +D LLKEW 
Sbjct  416  NQVEYLDEVMREGFAHPAVKGIVLWGAWHAKGCYVMCFTDNSFKNLPVGDAIDKLLKEW-  474

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            T    G TD  G      F GEY  +V++
Sbjct  475  TAGHTGKTDSKGVLEVEIFHGEYNATVKH  503



>gb|EEC74704.1| hypothetical protein OsI_10420 [Oryza sativa Indica Group]
Length=557

 Score =   188 bits (477),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 129/209 (62%), Gaps = 7/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG DA+ E F+   + D    LFMN+FN +E  +D       Y++
Sbjct  326  DVVNENLHFNFFEGKLGKDASAEIFRDVAKLDSKPILFMNEFNTIEEPNDAAPLPTKYVA  385

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K++++   + D   GIGLE HF+APN P +R  +D LA  ++PIWLTE+D+      +
Sbjct  386  KLKQIREFPGNADLKYGIGLESHFAAPNIPYMRGSIDTLAQAKVPIWLTEVDVKP---CK  442

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             Q  YL+ V+RE F+HPAV GI+LW A   KGC+ MC TDN+  NLP GD +D LLKEW 
Sbjct  443  NQVEYLDEVMREGFAHPAVKGIVLWGAWHAKGCYVMCFTDNSFKNLPVGDAIDKLLKEW-  501

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            T    G TD  G      F GEY  +V++
Sbjct  502  TAGHTGKTDSKGVLEVEIFHGEYNATVKH  530



>gb|ABF94508.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=557

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 129/209 (62%), Gaps = 7/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG DA+ E F+   + D    LFMN+FN +E  +D       Y++
Sbjct  326  DVVNENLHFNFFEGKLGKDASAEIFRDVAKLDSKPILFMNEFNTIEEPNDAAPLPTKYVA  385

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K++++   + D   GIGLE HF+APN P +R  +D LA  ++PIWLTE+D+      +
Sbjct  386  KLKQIREFPGNADLKYGIGLESHFAAPNIPYMRGSIDTLAQAKVPIWLTEVDVKP---CK  442

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             Q  YL+ V+RE F+HPAV GI+LW A   KGC+ MC TDN+  NLP GD +D LLKEW 
Sbjct  443  NQVEYLDEVMREGFAHPAVKGIVLWGAWHAKGCYVMCFTDNSFKNLPVGDAIDKLLKEW-  501

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            T    G TD  G      F GEY  +V++
Sbjct  502  TAGHTGKTDSKGVLEVEIFHGEYNATVKH  530



>ref|XP_009778566.1| PREDICTED: probable endo-1,4-beta-xylanase C [Nicotiana sylvestris]
Length=566

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 149/227 (66%), Gaps = 7/227 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE +HF   E +LG +AT  F+K AH+ D  A LF+N++  +E   D  +    Y++
Sbjct  335  DVDNENIHFSYLESQLGENATAYFYKKAHDMDSNAILFLNEYGTIENPDDMVANPVNYLA  394

Query  578  KMKELKQGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQ  402
            K++E++  G +   GIGL+GHF  PN P IR+ LD LAT  LPIW+TE+D++ +     Q
Sbjct  395  KIQEIRSMGYNGPLGIGLQGHFDTPNIPYIRSALDILATADLPIWITELDVSSR---PLQ  451

Query  401  AIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQTQ  222
            A YL  ++ E+ +HPAVSGI++W+   P+GC++MCLTDN+  NLP GDVVDN +++   +
Sbjct  452  AEYLNDIMWELHAHPAVSGIIIWSPWQPQGCYKMCLTDNDFKNLPTGDVVDNFMRQLSHE  511

Query  221  TLEGGTDEHGSYSFMGFLGEYKVSVEY---GNRTATSTFSLNRGEET  90
             L G T+++G +    + G+Y+V +++    +++ T +F++ + +++
Sbjct  512  GLIGTTNDNGYFETSLYHGDYEVIIKHPTTRDQSFTHSFNVAKSQKS  558



>ref|XP_002867153.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43412.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=591

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 138/226 (61%), Gaps = 14/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH   +E + GP+A+   F  AH  DP  T+FMN+F  +E  +D K++   Y+ 
Sbjct  353  DVVNENLHHSFFESKFGPNASNNIFAMAHAIDPRTTMFMNEFYTLEDPTDLKASPAKYLQ  412

Query  578  KMKELK----QGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+    +G I + GIGLE HFS PN P +R+ LD L    LPIWLTEID+  K   
Sbjct  413  KLRELQSIRVRGNIPL-GIGLESHFSTPNIPYMRSGLDILGATGLPIWLTEIDV--KAPS  469

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
            + QA Y E VLRE  +HP V G+++WTA SP  C+ MCLTD N  NLP GDVVD LL+EW
Sbjct  470  DVQAKYFEQVLREGHAHPHVKGMVMWTAYSP-SCYHMCLTDGNFKNLPTGDVVDKLLREW  528

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
               ++QT  G TD  G +    F G+Y +++ +   N  A   F+L
Sbjct  529  GGLRSQTT-GVTDADGFFEASLFHGDYDLNISHPLANSKAYYNFTL  573



>ref|XP_008236353.1| PREDICTED: uncharacterized protein LOC103335128 [Prunus mume]
Length=578

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 142/239 (59%), Gaps = 12/239 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH++ +E +LG  A+   +  A +AD   TLFMN+FN +E   D  ST   Y+ 
Sbjct  341  DVVNENLHWNFFESKLGSKASALMYNWAVKADGANTLFMNEFNTIEESRDGASTPARYLQ  400

Query  578  KMKELKQGGISMDG---IGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K++E++    + +    IGLE HF  PN P IR+ +D LA  RLPIW+TE+D+       
Sbjct  401  KLREIQTFPGNRNARMAIGLESHFVTPNLPYIRSSIDILAATRLPIWITELDVQSG---P  457

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW-  231
             QA YLE VLREV +HP + GI++W A +P+GC++MCLTDNN  NL  G+VVD LL EW 
Sbjct  458  NQAWYLEQVLREVHAHPQIQGIVIWAAWNPQGCYRMCLTDNNFRNLATGNVVDKLLYEWG  517

Query  230  -QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATS-TFSLNRGEET---RHFRIQL  69
             +     G TD +GS+      G+Y++ + + + T +S  F  N    T   +  R+QL
Sbjct  518  LKASASSGATDSNGSFEANLSYGDYELEISHPSATNSSLVFKFNVSSTTASLQPLRLQL  576



>ref|XP_009108772.1| PREDICTED: uncharacterized protein LOC103834458 [Brassica rapa]
Length=573

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 134/226 (59%), Gaps = 12/226 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E  +GP  +   F+ AH  DP  T+FMN+FN +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFENAMGPKVSYNVFEQAHAVDPTTTMFMNEFNTLEQPGDAVSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHF-SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYG  414
            K++EL+     G I + GIGLE HF + PN P +R+ LD L    LPIWLTE+D+     
Sbjct  397  KLRELQSIRVPGNIPL-GIGLESHFFNTPNIPYMRSALDTLGATGLPIWLTEVDVAAP--  453

Query  413  QETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKE  234
               QA Y E VLRE  +HP V+G++ W+  +P+GCF+MCLTD N  NLP GDVVD LL+E
Sbjct  454  PNVQANYFEQVLREGHAHPKVTGMVTWSGYNPRGCFRMCLTDGNFRNLPTGDVVDKLLRE  513

Query  233  WQ--TQTLEGGTDEHGSYSFMGFLGEYKVSVEY--GNRTATSTFSL  108
            W        G TD  G +    F G+Y +S+ +   N TA+ +F L
Sbjct  514  WGGLRGKTTGLTDADGYFEASLFHGDYDLSIAHPLTNCTASHSFKL  559



>ref|XP_006351853.1| PREDICTED: uncharacterized protein LOC102605766, partial [Solanum 
tuberosum]
Length=522

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 140/237 (59%), Gaps = 10/237 (4%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH  L+E+RLG +A+  F+K A   D  AT+F+N+FN +E   D  S    Y+ 
Sbjct  289  DVVNENLHHPLFEERLGKNASAMFYKIASSLDSKATMFLNEFNTLEHPGDMVSIPSKYVE  348

Query  578  KMKELKQGGISMD---GIGLEGHF-SAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++E+K    + +   GIGL+GHF S PN P +RA+ D L   ++PIWLTE+++      
Sbjct  349  KLQEIKAFPGNEELVIGIGLQGHFDSHPNIPYVRAVFDLLGETKMPIWLTELNV---MPC  405

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA YLE ++RE F+HPAV G+M+W    P  C +MCL +  L N P+GDVVD L  EW
Sbjct  406  SNQAYYLEEIMREAFAHPAVKGMMIWIGWKPDRCNEMCLLNYELQNSPSGDVVDKLFAEW  465

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYGNRTATSTFSL---NRGEETRHFRIQL  69
            +T  L G TD+ GS+    F G+Y+++V   N  A  T  +   +   ET H  I L
Sbjct  466  KTTNLTGVTDKEGSFEVKVFHGDYEITVYNPNSGANVTKEVQVYDDKSETLHVSISL  522



>ref|NP_001049300.1| Os03g0201800 [Oryza sativa Japonica Group]
 gb|ABF94507.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11214.1| Os03g0201800 [Oryza sativa Japonica Group]
 dbj|BAG97270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=582

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 129/209 (62%), Gaps = 7/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF+ +E +LG DA+ E F+   + D    LFMN+FN +E  +D       Y++
Sbjct  326  DVVNENLHFNFFEGKLGKDASAEIFRDVAKLDSKPILFMNEFNTIEEPNDAAPLPTKYVA  385

Query  578  KMKELKQGGISMD---GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            K+K++++   + D   GIGLE HF+APN P +R  +D LA  ++PIWLTE+D+      +
Sbjct  386  KLKQIREFPGNADLKYGIGLESHFAAPNIPYMRGSIDTLAQAKVPIWLTEVDVKP---CK  442

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             Q  YL+ V+RE F+HPAV GI+LW A   KGC+ MC TDN+  NLP GD +D LLKEW 
Sbjct  443  NQVEYLDEVMREGFAHPAVKGIVLWGAWHAKGCYVMCFTDNSFKNLPVGDAIDKLLKEW-  501

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            T    G TD  G      F GEY  +V++
Sbjct  502  TAGHTGKTDSKGVLEVEIFHGEYNATVKH  530



>ref|XP_006285227.1| hypothetical protein CARUB_v10006586mg, partial [Capsella rubella]
 gb|EOA18125.1| hypothetical protein CARUB_v10006586mg, partial [Capsella rubella]
Length=562

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 126/213 (59%), Gaps = 11/213 (5%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E R+GP A+   +K     DP +  FMN++N +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFENRMGPKASYNIYKMVQAVDPTSIKFMNEYNTLEEPRDSDSSPARYLQ  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++ELK     G IS+ GIGLE HF  PN P +R+ LD L    LPIWLTE+D++     
Sbjct  397  KLRELKSIQVCGNISL-GIGLESHFKTPNIPYMRSALDTLGATGLPIWLTEVDVDAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V GI+ W   SP GC++MCLTD N  NLP GDVVD L+ EW
Sbjct  454  NVQAKYYEQVLREGHAHPQVKGIVTWAGYSPSGCYRMCLTDGNFKNLPTGDVVDKLVHEW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
               + QT  G TD  G +    F G+Y++ + +
Sbjct  514  GGFRRQTT-GVTDSDGFFEASLFHGDYELKISH  545



>ref|XP_009613540.1| PREDICTED: uncharacterized protein LOC104106642 isoform X2 [Nicotiana 
tomentosiformis]
Length=580

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH  L+E++LG +A+  F+K A   D  AT+F+N+FN +E  +D  S    Y+ 
Sbjct  347  DVVNENLHHPLFEEKLGKNASAIFYKIASSLDTKATMFLNEFNTLEHPADMVSIPSKYVE  406

Query  578  KMKELKQGGISMD---GIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++E+K    + +   GIGL+GHF   PN P IRA+ D L   ++PIWLTE+++      
Sbjct  407  KLREIKAFPGNEELVIGIGLQGHFDPHPNIPYIRAVFDVLGETKMPIWLTELNVEP---C  463

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA +LE ++RE F+HP V G+M+W   SP GC +MCL D+ L N P+GDVVD LL EW
Sbjct  464  PKQAYFLEEIMREAFAHPGVKGMMIWIGWSPNGCHEMCLVDSKLQNSPSGDVVDKLLAEW  523

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSV  147
            +T  L G TD+ G++    F G+Y V+V
Sbjct  524  KTTNLNGVTDKAGAFEVKVFHGDYYVTV  551



>ref|XP_010228324.1| PREDICTED: uncharacterized protein LOC100828321 [Brachypodium 
distachyon]
Length=561

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 125/209 (60%), Gaps = 6/209 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH D YE +LG D + + +    + D  A LFMN++N +E   D  +    Y++
Sbjct  323  DVVNENLHGDFYESKLGADVSAQLYSQVGQIDRQALLFMNEYNTLEVPMDANALASKYMA  382

Query  578  KMKELK--QGGISMD-GIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQE  408
            KM +++   G + M   +GLE HF APN P +RA LD LA L +PIWLTE+D+       
Sbjct  383  KMNQIRFYPGNLGMKLAVGLESHFGAPNIPFMRATLDMLAQLMVPIWLTEVDV---VAGP  439

Query  407  TQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEWQ  228
             QA YLE VLRE + HPAV G+++W A   KGC+ MCLTDN   NLP GDVVD L+ EW+
Sbjct  440  NQAGYLEAVLREGYGHPAVQGMVMWAAWHAKGCYVMCLTDNGFRNLPVGDVVDKLIAEWR  499

Query  227  TQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            T  LE  T  +G+       GEY  +V +
Sbjct  500  THPLEVTTGCNGAAELDLVHGEYNFTVTH  528



>emb|CDX72434.1| BnaC07g44560D [Brassica napus]
Length=877

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 137/226 (61%), Gaps = 13/226 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++G  A+   +  AH  DP  T+FMN++N +E   D  S+   Y+ 
Sbjct  642  DVVNENLHFSFFESKMGAQASYNIYALAHSIDPRTTMFMNEYNTLEQPGDSASSPAKYLG  701

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I + GIGLE HF+ PN P +R+ LD LA   LPIWLTE+D+      
Sbjct  702  KLRELQSIRVAGKIQL-GIGLESHFNTPNIPYMRSALDTLAATGLPIWLTEVDVQAP--P  758

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA Y E VLRE  +HP V G++  +  SP GC++MCLTD N  NLPAGDVVD LL+EW
Sbjct  759  NVQANYFEQVLREGHAHPQVKGMVTRSGYSPSGCYKMCLTDGNFRNLPAGDVVDKLLREW  818

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEYKVSVEYG--NRTATSTFSL  108
               + QT  G TD  G +    F G+Y +++ +   N TA+ +F+L
Sbjct  819  GGLRVQTT-GLTDSDGFFEASLFHGDYDINIAHPLINSTASHSFTL  863


 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 9/141 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E ++G  A+   +  AH  DP  T+FMN++N +E   D  S+   Y+ 
Sbjct  346  DVVNENLHFSFFESKMGAQASYNIYALAHSIDPRTTMFMNEYNTLEQPGDSASSPAKYLG  405

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDI----NK  423
            K++EL+     G I + GIGLE HF+ PN P +R+ LD LA   LPIWLTE+D+    N 
Sbjct  406  KLRELQSIRVAGKIQL-GIGLESHFNTPNIPYMRSALDTLAATGLPIWLTEVDVQAPPNV  464

Query  422  KYGQETQAIYLETVLREVFSH  360
            +    T  I++++V  + F+ 
Sbjct  465  QSEDTTVEIWVDSVSLQPFTQ  485



>ref|XP_010030624.1| PREDICTED: uncharacterized protein LOC104420483 [Eucalyptus grandis]
Length=611

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 131/206 (64%), Gaps = 5/206 (2%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E +LG  A+   +KTA   DP  TLF+N++N +E   D  ++   Y  
Sbjct  346  DVVNENLHFSFFESKLGSQASANAYKTAKYMDPSTTLFLNEYNTIEDSRDWATSPTAYAK  405

Query  578  KMKELKQGGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQETQA  399
            K++ ++  G    GIGLE HF+ P+ P +R+ +D L  L LP+WLTE+D+        QA
Sbjct  406  KVRYIQSLGGGNLGIGLESHFNVPDLPYMRSAIDTLGALGLPMWLTEVDVQSG---PNQA  462

Query  398  IYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW--QT  225
            +YLE VLRE  +HP ++GI++WTA  P+GC++MCLTDNN  NLP GDVVD LLKEW    
Sbjct  463  MYLEQVLREAHAHPKINGIVMWTAWKPEGCYRMCLTDNNFRNLPTGDVVDKLLKEWGGGR  522

Query  224  QTLEGGTDEHGSYSFMGFLGEYKVSV  147
            Q L G T  +G+     F G+Y+V+V
Sbjct  523  QELSGMTSPNGTLEASLFHGDYQVTV  548



>ref|NP_195110.3| Glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 gb|AAQ65092.1| At4g33840/F17I5_30 [Arabidopsis thaliana]
 dbj|BAE99087.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86283.1| Glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Length=576

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 138/232 (59%), Gaps = 13/232 (6%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LHF  +E + GP A+   +  AH  DP   +FMN++N +E   D  S+   Y+ 
Sbjct  337  DVVNENLHFSFFESKFGPKASYNTYTMAHAVDPRTPMFMNEYNTLEQPKDLTSSPARYLG  396

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++EL+     G I +  IGLE HFS PN P +R+ LD      LPIWLTEID++     
Sbjct  397  KLRELQSIRVAGKIPL-AIGLESHFSTPNIPYMRSALDTFGATGLPIWLTEIDVDAP--P  453

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              +A Y E VLRE  +HP V+G+++WT  SP GC++MCLTD N  NLP GDVVD LL+EW
Sbjct  454  NVRANYFEQVLREGHAHPKVNGMVMWTGYSPSGCYRMCLTDGNFKNLPTGDVVDKLLREW  513

Query  230  ---QTQTLEGGTDEHGSYSFMGFLGEY--KVSVEYGNRTATSTFSLNRGEET  90
               ++QT  G TD +G +    F G+Y  ++S    N  A+  F+L   +++
Sbjct  514  GGLRSQTT-GVTDANGLFEAPLFHGDYDLRISHPLTNSKASYNFTLTSDDDS  564



>ref|XP_009613527.1| PREDICTED: uncharacterized protein LOC104106642 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613534.1| PREDICTED: uncharacterized protein LOC104106642 isoform X1 [Nicotiana 
tomentosiformis]
Length=597

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH  L+E++LG +A+  F+K A   D  AT+F+N+FN +E  +D  S    Y+ 
Sbjct  364  DVVNENLHHPLFEEKLGKNASAIFYKIASSLDTKATMFLNEFNTLEHPADMVSIPSKYVE  423

Query  578  KMKELKQGGISMD---GIGLEGHFSA-PNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            K++E+K    + +   GIGL+GHF   PN P IRA+ D L   ++PIWLTE+++      
Sbjct  424  KLREIKAFPGNEELVIGIGLQGHFDPHPNIPYIRAVFDVLGETKMPIWLTELNVEP---C  480

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              QA +LE ++RE F+HP V G+M+W   SP GC +MCL D+ L N P+GDVVD LL EW
Sbjct  481  PKQAYFLEEIMREAFAHPGVKGMMIWIGWSPNGCHEMCLVDSKLQNSPSGDVVDKLLAEW  540

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSV  147
            +T  L G TD+ G++    F G+Y V+V
Sbjct  541  KTTNLNGVTDKAGAFEVKVFHGDYYVTV  568



>dbj|BAK06212.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=573

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 128/210 (61%), Gaps = 6/210 (3%)
 Frame = -1

Query  758  DVSNEMLHFDLYEQRLGPDATLEFFKTAHEADPLATLFMNDFNVVETCSDPKSTVDTYIS  579
            DV NE LH   YE RLGP+ + E ++   + D  ATLFMN+++ +E   D  +    Y +
Sbjct  338  DVVNENLHGQFYESRLGPNVSAELYQQVAKIDTNATLFMNEYDTLEWALDVTAMASKYAA  397

Query  578  KMKELKQ----GGISMDGIGLEGHFSAPNPPLIRAILDKLATLRLPIWLTEIDINKKYGQ  411
            KM++++      GI +  +GLE HF  PN P +RA LD LA L++PIWLTE+D++ K  +
Sbjct  398  KMEQIRSYPGNDGIKL-AVGLESHFETPNIPYMRATLDMLAQLKVPIWLTEVDVSPK-TR  455

Query  410  ETQAIYLETVLREVFSHPAVSGIMLWTAISPKGCFQMCLTDNNLNNLPAGDVVDNLLKEW  231
              Q  YLE VLRE + HP V G++LW A    GC+ MCLTDNN  NLP G+VVD L+ EW
Sbjct  456  PYQVEYLEDVLREGYGHPNVEGMVLWAAWHKHGCWVMCLTDNNFTNLPTGNVVDKLIDEW  515

Query  230  QTQTLEGGTDEHGSYSFMGFLGEYKVSVEY  141
            +T  +   TD HG        GEY+ +V +
Sbjct  516  KTHPVAATTDAHGVAELDLVHGEYRFTVTH  545



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260