BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF036C02

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006430419.1|  hypothetical protein CICLE_v10013010mg             221   6e-70   Citrus clementina [clementine]
ref|XP_006481968.1|  PREDICTED: 14 kDa zinc-binding protein-like        219   6e-69   Citrus sinensis [apfelsine]
ref|XP_009619340.1|  PREDICTED: 14 kDa zinc-binding protein             218   2e-68   Nicotiana tomentosiformis
ref|XP_009777729.1|  PREDICTED: 14 kDa zinc-binding protein             217   2e-68   Nicotiana sylvestris
ref|XP_006339217.1|  PREDICTED: 14 kDa zinc-binding protein-like        214   4e-67   Solanum tuberosum [potatoes]
ref|XP_004249357.1|  PREDICTED: 14 kDa zinc-binding protein             214   5e-67   Solanum lycopersicum
ref|XP_011069986.1|  PREDICTED: 14 kDa zinc-binding protein-like        213   1e-66   Sesamum indicum [beniseed]
gb|KHN34585.1|  14 kDa zinc-binding protein                             211   3e-66   Glycine soja [wild soybean]
ref|NP_001242625.1|  uncharacterized protein LOC100785079               210   6e-66   Glycine max [soybeans]
gb|KDP24045.1|  hypothetical protein JCGZ_26729                         209   1e-65   Jatropha curcas
gb|KJB78446.1|  hypothetical protein B456_013G000500                    209   2e-65   Gossypium raimondii
ref|XP_004294701.1|  PREDICTED: 14 kDa zinc-binding protein             209   4e-65   Fragaria vesca subsp. vesca
ref|XP_010036427.1|  PREDICTED: 14 kDa zinc-binding protein             207   1e-64   Eucalyptus grandis [rose gum]
ref|XP_010251655.1|  PREDICTED: 14 kDa zinc-binding protein             208   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010673250.1|  PREDICTED: 14 kDa zinc-binding protein-like        207   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007028210.1|  HIS triad family protein 3                         206   3e-64   
ref|XP_007202700.1|  hypothetical protein PRUPE_ppa012689mg             206   4e-64   
ref|XP_004489633.1|  PREDICTED: 14 kDa zinc-binding protein-like        206   8e-64   Cicer arietinum [garbanzo]
ref|XP_008240602.1|  PREDICTED: 14 kDa zinc-binding protein             205   1e-63   Prunus mume [ume]
ref|XP_002270641.1|  PREDICTED: 14 kDa zinc-binding protein             205   2e-63   Vitis vinifera
gb|KHN16268.1|  14 kDa zinc-binding protein                             205   2e-63   Glycine soja [wild soybean]
emb|CBI31175.3|  unnamed protein product                                204   2e-63   Vitis vinifera
ref|XP_006402981.1|  hypothetical protein EUTSA_v10006296mg             204   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009116350.1|  PREDICTED: 14 kDa zinc-binding protein             203   4e-63   Brassica rapa
emb|CDP19662.1|  unnamed protein product                                203   4e-63   Coffea canephora [robusta coffee]
ref|XP_006292006.1|  hypothetical protein CARUB_v10018194mg             203   5e-63   Capsella rubella
gb|KFK34892.1|  hypothetical protein AALP_AA5G207000                    203   7e-63   Arabis alpina [alpine rockcress]
ref|NP_001238556.1|  uncharacterized protein LOC100527347               203   7e-63   Glycine max [soybeans]
ref|XP_002876369.1|  hypothetical protein ARALYDRAFT_486090             202   9e-63   
ref|XP_009139095.1|  PREDICTED: 14 kDa zinc-binding protein-like        202   1e-62   Brassica rapa
emb|CDY27209.1|  BnaA09g35930D                                          202   1e-62   Brassica napus [oilseed rape]
ref|XP_011041305.1|  PREDICTED: 14 kDa zinc-binding protein-like        203   1e-62   Populus euphratica
gb|EPS66467.1|  hypothetical protein M569_08307                         201   1e-62   Genlisea aurea
emb|CDY67461.1|  BnaCnng55070D                                          201   2e-62   Brassica napus [oilseed rape]
ref|XP_002520586.1|  histidine triad (hit) protein, putative            201   2e-62   
ref|XP_011010091.1|  PREDICTED: 14 kDa zinc-binding protein-like        202   2e-62   Populus euphratica
ref|XP_004136603.1|  PREDICTED: 14 kDa zinc-binding protein-like        202   3e-62   Cucumis sativus [cucumbers]
ref|XP_002323194.2|  hypothetical protein POPTR_0016s02430g             202   3e-62   Populus trichocarpa [western balsam poplar]
ref|XP_007151511.1|  hypothetical protein PHAVU_004G053100g             201   3e-62   Phaseolus vulgaris [French bean]
ref|XP_009350626.1|  PREDICTED: 14 kDa zinc-binding protein             202   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_003618911.1|  14 kDa zinc-binding protein                        201   4e-62   Medicago truncatula
ref|NP_567038.1|  HIS triad family protein 3                            201   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008443161.1|  PREDICTED: 14 kDa zinc-binding protein             201   6e-62   Cucumis melo [Oriental melon]
ref|XP_006603708.1|  PREDICTED: uncharacterized protein LOC100785...    201   6e-62   Glycine max [soybeans]
ref|XP_011079133.1|  PREDICTED: 14 kDa zinc-binding protein-like ...    199   7e-62   Sesamum indicum [beniseed]
emb|CAB88052.1|  protein kinase C inhibitor-like protein                199   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EYU35642.1|  hypothetical protein MIMGU_mgv1a015436mg                199   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_008392503.1|  PREDICTED: 14 kDa zinc-binding protein             199   3e-61   Malus domestica [apple tree]
gb|AGT16929.1|  hypothetical protein SHCRBa_011_I19_R_310               197   4e-61   Saccharum hybrid cultivar R570
ref|XP_010504557.1|  PREDICTED: 14 kDa zinc-binding protein             198   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009386029.1|  PREDICTED: 14 kDa zinc-binding protein             198   8e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002467940.1|  hypothetical protein SORBIDRAFT_01g036830          197   1e-60   Sorghum bicolor [broomcorn]
ref|XP_010516257.1|  PREDICTED: 14 kDa zinc-binding protein-like        197   1e-60   Camelina sativa [gold-of-pleasure]
gb|AGT16429.1|  zinc-binding protein                                    196   1e-60   Saccharum hybrid cultivar R570
ref|XP_004984542.1|  PREDICTED: 14 kDa zinc-binding protein-like        194   2e-59   Setaria italica
gb|EMS55067.1|  14 kDa zinc-binding protein                             193   2e-59   Triticum urartu
ref|NP_001241703.1|  histidine triad nucleotide binding protein         193   3e-59   Zea mays [maize]
ref|XP_008792458.1|  PREDICTED: 14 kDa zinc-binding protein             194   3e-59   Phoenix dactylifera
dbj|BAJ99840.1|  predicted protein                                      193   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC75152.1|  hypothetical protein OsI_11358                          192   4e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010427477.1|  PREDICTED: 14 kDa zinc-binding protein-like        193   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010525428.1|  PREDICTED: 14 kDa zinc-binding protein             192   4e-59   Tarenaya hassleriana [spider flower]
gb|AFK47543.1|  unknown                                                 193   5e-59   Lotus japonicus
ref|NP_001105498.1|  14 kDa zinc-binding protein                        192   5e-59   
ref|XP_010922940.1|  PREDICTED: 14 kDa zinc-binding protein             193   9e-59   Elaeis guineensis
ref|XP_006650010.1|  PREDICTED: 14 kDa zinc-binding protein-like        191   1e-58   Oryza brachyantha
emb|CDX67650.1|  BnaA07g16900D                                          191   1e-58   
ref|NP_001049967.1|  Os03g0322500                                       191   1e-58   
ref|XP_003558021.1|  PREDICTED: 14 kDa zinc-binding protein             191   2e-58   Brachypodium distachyon [annual false brome]
ref|XP_009104008.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa zinc-...    191   5e-58   
ref|XP_010673252.1|  PREDICTED: 14 kDa zinc-binding protein-like        192   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009406827.1|  PREDICTED: 14 kDa zinc-binding protein-like        189   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554736.1|  PREDICTED: 14 kDa zinc-binding protein-like        189   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_006836159.1|  hypothetical protein AMTR_s00101p00042720          188   7e-57   Amborella trichopoda
ref|XP_011079134.1|  PREDICTED: 14 kDa zinc-binding protein-like ...    187   8e-57   
sp|P42855.1|ZB14_BRAJU  RecName: Full=14 kDa zinc-binding protein...    185   3e-56   Brassica juncea [brown mustard]
ref|XP_004970323.1|  PREDICTED: 14 kDa zinc-binding protein-like        184   3e-55   Setaria italica
gb|ABK23114.1|  unknown                                                 182   6e-55   Picea sitchensis
gb|ABK26444.1|  unknown                                                 182   1e-54   Picea sitchensis
ref|XP_006858221.1|  hypothetical protein AMTR_s00062p00187560          181   7e-54   Amborella trichopoda
gb|KHN05234.1|  14 kDa zinc-binding protein                             180   1e-53   Glycine soja [wild soybean]
ref|NP_001238173.1|  uncharacterized protein LOC100500187               180   1e-53   Glycine max [soybeans]
gb|KDO57337.1|  hypothetical protein CISIN_1g031773mg                   179   3e-53   Citrus sinensis [apfelsine]
ref|XP_002986197.1|  hypothetical protein SELMODRAFT_446557             178   3e-53   Selaginella moellendorffii
gb|EEE55566.1|  hypothetical protein OsJ_03841                          178   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458664.1|  hypothetical protein SORBIDRAFT_03g037730          177   2e-52   
ref|XP_008459016.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    177   4e-52   Cucumis melo [Oriental melon]
ref|XP_008459017.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    176   5e-52   Cucumis melo [Oriental melon]
ref|XP_007138824.1|  hypothetical protein PHAVU_009G240300g             176   7e-52   Phaseolus vulgaris [French bean]
ref|XP_002985009.1|  hypothetical protein SELMODRAFT_121527             174   1e-51   
gb|EYU18944.1|  hypothetical protein MIMGU_mgv1a020861mg                173   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_002437422.1|  hypothetical protein SORBIDRAFT_10g026700          174   2e-51   Sorghum bicolor [broomcorn]
ref|XP_004145437.1|  PREDICTED: 14 kDa zinc-binding protein-like        175   2e-51   Cucumis sativus [cucumbers]
ref|NP_001152228.1|  LOC100285866                                       174   4e-51   Zea mays [maize]
ref|XP_003607898.1|  14 kDa zinc-binding protein                        174   5e-51   Medicago truncatula
ref|XP_004293768.1|  PREDICTED: 14 kDa zinc-binding protein             173   6e-51   Fragaria vesca subsp. vesca
ref|XP_003560429.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    173   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_008603825.1|  hit-like protein                                   172   1e-50   Saprolegnia diclina VS20
gb|KDO29861.1|  hypothetical protein SPRG_04934                         172   1e-50   Saprolegnia parasitica CBS 223.65
ref|XP_004966317.1|  PREDICTED: 14 kDa zinc-binding protein-like        172   1e-50   Setaria italica
ref|XP_010240546.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    173   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_008890341.1|  hypothetical protein PPTG_00663                    172   2e-50   Phytophthora parasitica INRA-310
gb|ABK21571.1|  unknown                                                 172   2e-50   Picea sitchensis
gb|ETI56792.1|  hypothetical protein F443_00793                         171   2e-50   Phytophthora parasitica P1569
gb|EMT11377.1|  14 kDa zinc-binding protein                             171   4e-50   
ref|XP_009523292.1|  hypothetical protein PHYSODRAFT_492857             170   4e-50   Phytophthora sojae
ref|XP_004505299.1|  PREDICTED: 14 kDa zinc-binding protein-like ...    171   4e-50   Cicer arietinum [garbanzo]
ref|XP_006657234.1|  PREDICTED: 14 kDa zinc-binding protein-like        171   5e-50   Oryza brachyantha
dbj|BAJ99076.1|  predicted protein                                      171   8e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010058024.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    171   9e-50   
gb|KDP43155.1|  hypothetical protein JCGZ_00088                         171   1e-49   Jatropha curcas
ref|XP_010538299.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    170   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_004505298.1|  PREDICTED: 14 kDa zinc-binding protein-like ...    170   1e-49   
gb|EEC81142.1|  hypothetical protein OsI_24044                          170   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_009408259.1|  PREDICTED: 14 kDa zinc-binding protein             170   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002276515.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    170   2e-49   Vitis vinifera
emb|CBI27186.3|  unnamed protein product                                170   2e-49   Vitis vinifera
ref|XP_001770419.1|  predicted protein                                  168   3e-49   
ref|XP_008798226.1|  PREDICTED: 14 kDa zinc-binding protein             169   3e-49   Phoenix dactylifera
ref|XP_009102671.1|  PREDICTED: 14 kDa zinc-binding protein-like        169   4e-49   Brassica rapa
emb|CDX77556.1|  BnaA07g06940D                                          169   4e-49   
ref|XP_011085155.1|  PREDICTED: 14 kDa zinc-binding protein             169   4e-49   Sesamum indicum [beniseed]
emb|CDX98244.1|  BnaC07g08540D                                          169   5e-49   
ref|XP_009782765.1|  PREDICTED: 14 kDa zinc-binding protein             167   5e-49   Nicotiana sylvestris
gb|EYU29000.1|  hypothetical protein MIMGU_mgv1a014698mg                168   6e-49   Erythranthe guttata [common monkey flower]
ref|XP_001773357.1|  predicted protein                                  166   7e-49   
ref|XP_009826163.1|  hypothetical protein H257_03668                    167   7e-49   Aphanomyces astaci
ref|XP_008870916.1|  hypothetical protein H310_07318                    167   1e-48   Aphanomyces invadans
ref|XP_009606620.1|  PREDICTED: 14 kDa zinc-binding protein             167   2e-48   Nicotiana tomentosiformis
gb|KJB47944.1|  hypothetical protein B456_008G048400                    167   2e-48   Gossypium raimondii
ref|XP_004233245.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    167   3e-48   Solanum lycopersicum
emb|CDP11254.1|  unnamed protein product                                167   3e-48   Coffea canephora [robusta coffee]
ref|XP_007041080.1|  Histidine triad nucleotide-binding 2, 2 isof...    167   3e-48   
gb|KEH30829.1|  scavenger mRNA decapping enzyme carboxy-term-bind...    167   4e-48   Medicago truncatula
ref|XP_002504781.1|  predicted protein                                  164   5e-48   Micromonas commoda
ref|XP_002895257.1|  14 kDa zinc-binding protein                        164   5e-48   Phytophthora infestans T30-4
ref|XP_006365044.1|  PREDICTED: 14 kDa zinc-binding protein-like        167   5e-48   Solanum tuberosum [potatoes]
gb|KFK44923.1|  hypothetical protein AALP_AA1G320200                    166   6e-48   Arabis alpina [alpine rockcress]
ref|NP_174401.1|  histidine triad nucleotide-binding 2 protein          166   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005851832.1|  hypothetical protein CHLNCDRAFT_133322             164   7e-48   Chlorella variabilis
ref|XP_011000172.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    166   9e-48   Populus euphratica
ref|XP_002321820.2|  zinc-binding family protein                        166   1e-47   
ref|XP_010941662.1|  PREDICTED: 14 kDa zinc-binding protein             166   1e-47   Elaeis guineensis
ref|XP_006305672.1|  hypothetical protein CARUB_v10010389mg             165   2e-47   Capsella rubella
ref|XP_006468491.1|  PREDICTED: 14 kDa zinc-binding protein-like ...    165   2e-47   Citrus sinensis [apfelsine]
ref|XP_007212586.1|  hypothetical protein PRUPE_ppa015962mg             164   2e-47   
emb|CDW80129.1|  histidine triad nucleotide-binding protein 1           162   4e-47   Stylonychia lemnae
gb|EPS72246.1|  hypothetical protein M569_02515                         163   4e-47   Genlisea aurea
ref|XP_010109839.1|  hypothetical protein L484_018496                   163   5e-47   
ref|XP_006415364.1|  hypothetical protein EUTSA_v10009998mg             163   7e-47   Eutrema salsugineum [saltwater cress]
ref|XP_008674914.1|  PREDICTED: 14 kDa zinc-binding protein-like        162   7e-47   
ref|XP_002891131.1|  hypothetical protein ARALYDRAFT_336541             163   1e-46   
ref|XP_002971357.1|  hypothetical protein SELMODRAFT_95126              160   1e-46   
ref|XP_008225838.1|  PREDICTED: 14 kDa zinc-binding protein             162   2e-46   Prunus mume [ume]
ref|XP_010317037.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    162   2e-46   Solanum lycopersicum
emb|CCI50621.1|  unnamed protein product                                160   3e-46   Albugo candida
ref|XP_002961455.1|  hypothetical protein SELMODRAFT_76264              159   4e-46   
ref|XP_007041082.1|  Histidine triad nucleotide-binding 2, 2 isof...    160   4e-46   
ref|XP_006448694.1|  hypothetical protein CICLE_v10016837mg             161   5e-46   Citrus clementina [clementine]
gb|EWM29206.1|  protein kinase c binding protein                        161   5e-46   Nannochloropsis gaditana
ref|XP_005648829.1|  HIT-domain-containing protein                      161   5e-46   Coccomyxa subellipsoidea C-169
ref|XP_010260601.1|  PREDICTED: 14 kDa zinc-binding protein             161   6e-46   Nelumbo nucifera [Indian lotus]
gb|EAS04975.3|  scavenger mRNA decapping enzyme carboxy-term-bind...    160   6e-46   Tetrahymena thermophila SB210
ref|XP_003081421.1|  ZB14_MAIZE 14 kDa zinc-binding protein (ISS)       159   7e-46   Ostreococcus tauri
ref|XP_011000173.1|  PREDICTED: 14 kDa zinc-binding protein isofo...    159   7e-46   Populus euphratica
ref|XP_010460911.1|  PREDICTED: 14 kDa zinc-binding protein-like        160   9e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007510684.1|  predicted protein                                  159   1e-45   Bathycoccus prasinos
ref|XP_010499667.1|  PREDICTED: 14 kDa zinc-binding protein-like        160   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010478560.1|  PREDICTED: 14 kDa zinc-binding protein             160   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_003060821.1|  predicted protein                                  157   2e-45   Micromonas pusilla CCMP1545
ref|XP_001419867.1|  predicted protein                                  157   3e-45   Ostreococcus lucimarinus CCE9901
ref|XP_001696200.1|  protein kinase C binding protein                   155   2e-44   Chlamydomonas reinhardtii
ref|XP_002961475.1|  hypothetical protein SELMODRAFT_77650              154   3e-44   
emb|CCA14803.1|  14 kDa zincbinding protein putative                    156   3e-44   Albugo laibachii Nc14
tpg|DAA45133.1|  TPA: protein kinase inhibitor1                         154   3e-44   
ref|XP_006468492.1|  PREDICTED: 14 kDa zinc-binding protein-like ...    155   4e-44   
ref|XP_002971332.1|  hypothetical protein SELMODRAFT_94999              153   1e-43   
ref|XP_009347648.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa zinc-...    154   2e-43   Pyrus x bretschneideri [bai li]
gb|AAD21696.1|  Similar to gb|Z29643 protein kinase C inhibitor (...    155   3e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CBN74620.1|  conserved unknown protein                              154   5e-43   Ectocarpus siliculosus
ref|XP_011400956.1|  14 kDa zinc-binding protein                        151   8e-43   Auxenochlorella protothecoides
gb|EMT02405.1|  14 kDa zinc-binding protein                             156   9e-43   
ref|XP_002945873.1|  hypothetical protein VOLCADRAFT_102824             150   9e-42   Volvox carteri f. nagariensis
ref|XP_005767128.1|  hypothetical protein EMIHUDRAFT_61926              149   1e-41   Emiliania huxleyi CCMP1516
gb|AGG56522.1|  protein kinase c inhibitor                              147   2e-41   Antheraea yamamai [Japanese oak silk moth]
ref|WP_015131209.1|  histidine triad (HIT) protein                      147   2e-41   Calothrix sp. PCC 7507
ref|XP_780695.1|  PREDICTED: histidine triad nucleotide-binding p...    147   3e-41   Strongylocentrotus purpuratus [purple urchin]
ref|XP_010875499.1|  PREDICTED: histidine triad nucleotide-bindin...    148   4e-41   
gb|EWM29205.1|  protein kinase c binding protein                        149   5e-41   Nannochloropsis gaditana
dbj|BAM18093.1|  protein kinase C inhibitor                             146   6e-41   Papilio xuthus [Chinese swallowtail]
ref|XP_001031984.2|  HIT domain containing protein                      146   6e-41   Tetrahymena thermophila SB210
ref|WP_035987363.1|  zinc-binding protein                               145   1e-40   Leptolyngbya sp. KIOST-1
ref|WP_035472332.1|  zinc-binding protein                               145   1e-40   Gammaproteobacteria bacterium MFB021
ref|WP_009769297.1|  HIT family hydrolase, diadenosine tetraphosp...    145   1e-40   Oscillatoriales cyanobacterium JSC-12
ref|XP_010790143.1|  PREDICTED: histidine triad nucleotide-bindin...    146   2e-40   Notothenia coriiceps [yellowbelly rockcod]
ref|WP_015190463.1|  histidine triad (HIT) protein                      144   2e-40   Gloeocapsa sp. PCC 7428
ref|WP_015173203.1|  histidine triad (HIT) protein                      144   2e-40   Geitlerinema sp. PCC 7407
gb|EJY74625.1|  Protein kinase C binding protein                        144   3e-40   Oxytricha trifallax
ref|WP_027840641.1|  zinc-binding protein                               144   3e-40   Mastigocoleus testarum
ref|WP_012596355.1|  MULTISPECIES: zinc-binding protein                 144   3e-40   Cyanothece
ref|XP_005801040.1|  PREDICTED: histidine triad nucleotide-bindin...    145   3e-40   
ref|WP_018121984.1|  hypothetical protein                               144   4e-40   Wohlfahrtiimonas chitiniclastica
ref|XP_002184361.1|  predicted protein                                  144   5e-40   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002591273.1|  hypothetical protein BRAFLDRAFT_216507             144   5e-40   Branchiostoma floridae
ref|XP_011416416.1|  PREDICTED: histidine triad nucleotide-bindin...    145   6e-40   Crassostrea gigas
ref|WP_008314875.1|  Histidine triad nucleotide-binding protein 1       143   6e-40   Wohlfahrtiimonas chitiniclastica
ref|XP_010790141.1|  PREDICTED: histidine triad nucleotide-bindin...    146   7e-40   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001425174.1|  hypothetical protein                               143   7e-40   Paramecium tetraurelia strain d4-2
ref|WP_027966196.1|  zinc-binding protein                               143   8e-40   Halomonas halocynthiae
ref|XP_010790142.1|  PREDICTED: histidine triad nucleotide-bindin...    146   8e-40   Notothenia coriiceps [yellowbelly rockcod]
ref|WP_015181491.1|  HIT family hydrolase, diadenosine tetraphosp...    142   1e-39   Microcoleus sp. PCC 7113
ref|XP_001025220.2|  HIT domain containing protein                      142   1e-39   
ref|XP_008292382.1|  PREDICTED: histidine triad nucleotide-bindin...    144   1e-39   Stegastes partitus
ref|NP_001158525.1|  histidine triad nucleotide-binding protein 2...    144   1e-39   Oncorhynchus mykiss
emb|CDQ64596.1|  unnamed protein product                                144   1e-39   Oncorhynchus mykiss
ref|WP_017716059.1|  zinc-binding protein                               142   1e-39   Oscillatoria sp. PCC 10802
ref|WP_015161220.1|  HIT family hydrolase, diadenosine tetraphosp...    142   2e-39   Chamaesiphon minutus
ref|WP_039727741.1|  MULTISPECIES: zinc-binding protein                 142   2e-39   Lyngbya confervoides
emb|CDY32019.1|  BnaC06g15970D                                          143   2e-39   Brassica napus [oilseed rape]
ref|XP_008416234.1|  PREDICTED: histidine triad nucleotide-bindin...    143   2e-39   Poecilia reticulata
ref|XP_005949185.1|  PREDICTED: histidine triad nucleotide-bindin...    143   2e-39   Haplochromis burtoni
ref|WP_017299142.1|  zinc-binding protein                               142   2e-39   Nodosilinea nodulosa
ref|XP_010729193.1|  PREDICTED: histidine triad nucleotide-bindin...    143   2e-39   
dbj|BAB75786.1|  protein kinase C inhibitor                             142   2e-39   Nostoc sp. PCC 7120
ref|WP_044522083.1|  zinc-binding protein                               141   3e-39   Nostocaceae
ref|WP_015207374.1|  HIT family hydrolase, diadenosine tetraphosp...    141   3e-39   Cylindrospermum stagnale
ref|XP_003975269.1|  PREDICTED: histidine triad nucleotide-bindin...    142   3e-39   
ref|XP_007557903.1|  PREDICTED: histidine triad nucleotide-bindin...    143   3e-39   Poecilia formosa
ref|WP_017289073.1|  zinc-binding protein                               141   3e-39   Leptolyngbya boryana
ref|XP_003372141.1|  histidine triad nucleotide-binding protein 1       142   3e-39   Trichinella spiralis
ref|XP_002591274.1|  hypothetical protein BRAFLDRAFT_121424             141   3e-39   Branchiostoma floridae
ref|XP_003455334.1|  PREDICTED: histidine triad nucleotide-bindin...    142   4e-39   Oreochromis niloticus
ref|XP_008292381.1|  PREDICTED: histidine triad nucleotide-bindin...    144   4e-39   Stegastes partitus
ref|XP_008416233.1|  PREDICTED: histidine triad nucleotide-bindin...    144   4e-39   Poecilia reticulata
gb|ELU01133.1|  hypothetical protein CAPTEDRAFT_149440                  141   4e-39   Capitella teleta
ref|XP_004575686.1|  PREDICTED: histidine triad nucleotide-bindin...    142   4e-39   Maylandia zebra
ref|XP_005753798.1|  PREDICTED: histidine triad nucleotide-bindin...    142   5e-39   Pundamilia nyererei
gb|ABA20441.1|  Histidine triad (HIT) protein                           141   5e-39   Trichormus variabilis ATCC 29413
ref|XP_003383423.1|  PREDICTED: histidine triad nucleotide-bindin...    141   6e-39   Amphimedon queenslandica
ref|WP_011432043.1|  zinc-binding protein                               140   6e-39   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_015155974.1|  histidine triad (HIT) protein                      140   6e-39   Cyanobacteria [blue-green bacteria]
ref|WP_041456001.1|  zinc-binding protein                               140   8e-39   Trichormus variabilis
ref|WP_006101479.1|  zinc-binding protein                               140   8e-39   Coleofasciculus chthonoplastes
gb|EKD52510.1|  HIT family protein                                      140   8e-39   uncultured bacterium
ref|WP_017651366.1|  zinc-binding protein                               140   8e-39   Fortiea contorta
ref|XP_004575687.1|  PREDICTED: histidine triad nucleotide-bindin...    142   9e-39   Maylandia zebra
gb|ACQ58023.1|  Histidine triad nucleotide-binding protein 2            142   1e-38   Anoplopoma fimbria
ref|WP_028300883.1|  zinc-binding protein                               140   1e-38   Oceanospirillum beijerinckii
ref|WP_006455256.1|  zinc-binding protein                               140   1e-38   Synechococcus sp. PCC 7335
ref|XP_008626139.1|  hypothetical protein YYE_04276                     140   1e-38   Plasmodium vinckei vinckei
ref|XP_008211498.1|  PREDICTED: histidine triad nucleotide-bindin...    141   1e-38   Nasonia vitripennis
ref|XP_003963878.1|  PREDICTED: histidine triad nucleotide-bindin...    140   1e-38   Takifugu rubripes [tiger puffer]
ref|XP_004609889.1|  PREDICTED: histidine triad nucleotide-bindin...    140   1e-38   Sorex araneus [Eurasian shrew]
ref|WP_014857102.1|  purine nucleoside phosphoramidase                  140   1e-38   Melioribacter roseus
ref|XP_005335859.1|  PREDICTED: histidine triad nucleotide-bindin...    140   1e-38   Ictidomys tridecemlineatus
ref|WP_039953702.1|  zinc-binding protein                               139   1e-38   Rhodanobacter thiooxydans
gb|EIL99974.1|  HIT family hydrolase, diadenosine tetraphosphate ...    139   1e-38   Rhodanobacter thiooxydans LCS2
ref|WP_015078360.1|  histidine triad protein                            139   2e-38   Anabaena sp. 90
ref|XP_006790103.1|  PREDICTED: histidine triad nucleotide-bindin...    142   2e-38   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005753795.1|  PREDICTED: histidine triad nucleotide-bindin...    141   2e-38   Pundamilia nyererei
ref|WP_026731461.1|  zinc-binding protein                               139   2e-38   Fischerella sp. PCC 9605
ref|XP_002735511.1|  PREDICTED: histidine triad nucleotide-bindin...    140   2e-38   Saccoglossus kowalevskii
ref|WP_036007912.1|  zinc-binding protein                               139   2e-38   [Leptolyngbya] sp. JSC-1
ref|WP_011025338.1|  HIT family hydrolase                               139   2e-38   Caldanaerobacter subterraneus
emb|CAG08117.1|  unnamed protein product                                140   2e-38   Tetraodon nigroviridis
ref|WP_026097832.1|  zinc-binding protein                               139   2e-38   Geitlerinema sp. PCC 7105
ref|WP_027492157.1|  zinc-binding protein                               139   2e-38   Rhodanobacter sp. OR444
ref|XP_001623801.1|  predicted protein                                  139   2e-38   Nematostella vectensis
ref|WP_006196270.1|  zinc-binding protein                               139   2e-38   Nodularia spumigena
ref|WP_017318331.1|  zinc-binding protein                               139   3e-38   Mastigocladopsis repens
ref|XP_005753796.1|  PREDICTED: histidine triad nucleotide-bindin...    140   3e-38   Pundamilia nyererei
ref|WP_015201289.1|  histidine triad (HIT) protein                      139   3e-38   Crinalium epipsammum
gb|ACQ58168.1|  Histidine triad nucleotide-binding protein 2            142   3e-38   Anoplopoma fimbria
ref|XP_010891934.1|  PREDICTED: histidine triad nucleotide-bindin...    139   3e-38   Esox lucius
ref|XP_001434194.1|  hypothetical protein                               139   3e-38   Paramecium tetraurelia strain d4-2
ref|WP_019500475.1|  hypothetical protein                               139   3e-38   Pseudanabaena sp. PCC 6802
ref|XP_680071.1|  protein kinase c inhibitor-like protein               139   3e-38   
ref|WP_012597807.1|  zinc-binding protein                               138   4e-38   Cyanothece sp. PCC 7424
emb|CBY22033.1|  unnamed protein product                                139   4e-38   Oikopleura dioica
gb|ETB56556.1|  hypothetical protein, variant                           140   4e-38   
ref|XP_005838838.1|  hypothetical protein GUITHDRAFT_157151             145   4e-38   
gb|EUD70596.1|  hit-like protein                                        139   4e-38   
ref|WP_035150466.1|  zinc-binding protein                               138   4e-38   
ref|WP_015228285.1|  HIT family hydrolase, diadenosine tetraphosp...    138   4e-38   
gb|EFN86168.1|  Histidine triad nucleotide-binding protein 1            139   4e-38   
ref|WP_016877200.1|  zinc-binding protein                               138   5e-38   
dbj|BAN21116.1|  protein kinase C inhibitor, putative                   139   5e-38   
ref|WP_031513253.1|  HIT family hydrolase                               138   5e-38   
ref|WP_016853699.1|  HIT family hydrolase                               138   5e-38   
ref|WP_019495471.1|  zinc-binding protein                               138   5e-38   
ref|XP_004072127.1|  PREDICTED: histidine triad nucleotide-bindin...    139   5e-38   
ref|WP_007309567.1|  zinc-binding protein                               138   6e-38   
ref|WP_013324376.1|  zinc-binding protein                               138   6e-38   
ref|XP_011136968.1|  PREDICTED: histidine triad nucleotide-bindin...    139   6e-38   
ref|NP_001005593.1|  histidine triad nucleotide-binding protein 1       138   6e-38   
ref|XP_002286249.1|  predicted protein                                  139   6e-38   
ref|WP_017710835.1|  zinc-binding protein                               138   6e-38   
ref|NP_001037526.1|  protein kinase c inhibitor                         138   6e-38   
gb|ETB56555.1|  hypothetical protein YYC_05404                          140   7e-38   
ref|XP_011496418.1|  PREDICTED: histidine triad nucleotide-bindin...    139   7e-38   
ref|XP_006617994.1|  PREDICTED: histidine triad nucleotide-bindin...    139   7e-38   
emb|CDU17255.1|  protein kinase c inhibitor-like protein, putative      140   7e-38   
ref|XP_007230088.1|  PREDICTED: histidine triad nucleotide-bindin...    139   7e-38   
ref|WP_008181848.1|  zinc-binding protein                               137   8e-38   
ref|WP_007304177.1|  zinc-binding protein                               137   8e-38   
ref|XP_006558545.1|  PREDICTED: histidine triad nucleotide-bindin...    139   9e-38   
ref|WP_043334727.1|  zinc-binding protein                               137   9e-38   
emb|CDR12184.1|  protein kinase c inhibitor-like protein, putative      140   9e-38   
emb|CDS45763.1|  protein kinase c inhibitor-like protein, putative      139   1e-37   
ref|WP_009459408.1|  MULTISPECIES: zinc-binding protein                 137   1e-37   
gb|KIE13560.1|  zinc-binding protein                                    137   1e-37   
ref|XP_007230087.1|  PREDICTED: histidine triad nucleotide-bindin...    139   1e-37   
ref|WP_011430415.1|  zinc-binding protein                               137   1e-37   
ref|WP_015226978.1|  histidine triad (HIT) protein                      137   1e-37   
ref|WP_035121093.1|  zinc-binding protein                               137   1e-37   
ref|WP_039716482.1|  zinc-binding protein                               137   1e-37   
ref|WP_015115072.1|  histidine triad (HIT) protein                      137   1e-37   
ref|XP_008426939.1|  PREDICTED: histidine triad nucleotide-bindin...    137   2e-37   
ref|WP_022587864.1|  HIT family hydrolase                               137   2e-37   
ref|XP_007551259.1|  PREDICTED: histidine triad nucleotide-bindin...    137   2e-37   
gb|ERL93881.1|  hypothetical protein D910_11167                         138   2e-37   
ref|XP_008334172.1|  PREDICTED: histidine triad nucleotide-bindin...    137   2e-37   
ref|WP_015175610.1|  histidine triad (HIT) protein                      137   2e-37   
ref|WP_012408957.1|  zinc-binding protein                               137   2e-37   
ref|WP_043527962.1|  zinc-binding protein                               137   2e-37   
emb|CAF97091.1|  unnamed protein product                                137   2e-37   
ref|XP_008334171.1|  PREDICTED: histidine triad nucleotide-bindin...    137   2e-37   
ref|WP_041038768.1|  zinc-binding protein                               137   2e-37   
ref|XP_004031327.1|  hypothetical protein IMG5_142840                   137   2e-37   
ref|WP_023070207.1|  zinc-binding protein                               136   2e-37   
emb|CBY31289.1|  unnamed protein product                                137   2e-37   
ref|WP_015168079.1|  HIT family hydrolase, diadenosine tetraphosp...    136   2e-37   
ref|WP_017320951.1|  zinc-binding protein                               136   3e-37   
gb|EJK53025.1|  hypothetical protein THAOC_27610                        140   3e-37   
ref|WP_018398745.1|  zinc-binding protein                               136   3e-37   
gb|KIH51082.1|  histidine triad domain protein                          138   3e-37   
ref|XP_010741018.1|  PREDICTED: histidine triad nucleotide-bindin...    137   3e-37   
ref|WP_019115267.1|  hypothetical protein                               136   3e-37   
ref|WP_006631073.1|  zinc-binding protein                               136   3e-37   
ref|NP_001077041.1|  histidine triad nucleotide-binding protein 2...    137   3e-37   
ref|WP_028771173.1|  hypothetical protein                               136   3e-37   
ref|WP_037217025.1|  zinc-binding protein                               136   4e-37   
ref|NP_001188230.1|  histidine triad nucleotide-binding protein 1       136   4e-37   
ref|XP_008334169.1|  PREDICTED: histidine triad nucleotide-bindin...    137   4e-37   
gb|EFN74579.1|  Histidine triad nucleotide-binding protein 1            136   4e-37   
ref|XP_008334170.1|  PREDICTED: histidine triad nucleotide-bindin...    137   5e-37   
ref|WP_006516677.1|  HIT family hydrolase, diadenosine tetraphosp...    135   5e-37   
ref|WP_016860050.1|  zinc-binding protein                               136   5e-37   
ref|WP_011056841.1|  zinc-binding protein                               135   5e-37   
ref|WP_011378015.1|  MULTISPECIES: zinc-binding protein                 135   5e-37   
ref|XP_007252508.1|  PREDICTED: histidine triad nucleotide-bindin...    136   5e-37   
ref|WP_008277950.1|  zinc-binding protein                               135   5e-37   
gb|EYC04656.1|  hypothetical protein Y032_0086g1909                     136   5e-37   
ref|XP_002126674.1|  PREDICTED: histidine triad nucleotide-bindin...    136   6e-37   
ref|WP_012307820.1|  MULTISPECIES: zinc-binding protein                 135   6e-37   
ref|XP_005930613.1|  PREDICTED: histidine triad nucleotide-bindin...    136   6e-37   
ref|XP_003438351.1|  PREDICTED: histidine triad nucleotide-bindin...    135   6e-37   
gb|KIJ85453.1|  zinc-binding protein                                    135   6e-37   
ref|XP_001378136.2|  PREDICTED: histidine triad nucleotide-bindin...    137   7e-37   
ref|XP_011253656.1|  PREDICTED: histidine triad nucleotide-bindin...    136   8e-37   
ref|NP_001279796.1|  histidine triad nucleotide binding protein 2       137   8e-37   
ref|WP_035138443.1|  zinc-binding protein                               135   8e-37   
dbj|BAD78355.1|  protein kinase C inhibitor                             135   8e-37   
gb|EYC04655.1|  hypothetical protein Y032_0086g1909                     137   8e-37   
gb|AFM85651.1|  histidine triad nucleotide-binding protein 2            137   9e-37   
ref|XP_725590.1|  protein kinase C interacting protein 1                136   9e-37   
ref|XP_004570155.1|  PREDICTED: histidine triad nucleotide-bindin...    135   9e-37   
ref|XP_005973745.1|  PREDICTED: histidine triad nucleotide-bindin...    135   9e-37   
ref|WP_023069740.1|  histidine triad nucleotide-binding protein 1       135   9e-37   
ref|WP_015137043.1|  HIT family hydrolase, diadenosine tetraphosp...    135   1e-36   
ref|XP_010567026.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|XP_010184957.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|WP_018974577.1|  HIT family hydrolase                               135   1e-36   
ref|WP_011614033.1|  zinc-binding protein                               135   1e-36   
ref|WP_024952131.1|  zinc-binding protein                               135   1e-36   
gb|ETN84589.1|  histidine triad domain protein                          136   1e-36   
ref|XP_001614997.1|  protein kinase C inhibitor                         137   1e-36   
ref|XP_005661680.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|WP_027351453.1|  zinc-binding protein                               135   1e-36   
ref|XP_005154959.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|WP_041315483.1|  HIT family hydrolase                               135   1e-36   
ref|XP_003230695.2|  PREDICTED: histidine triad nucleotide-bindin...    136   1e-36   
ref|NP_001084557.1|  histidine triad nucleotide binding protein 2       137   1e-36   
ref|XP_667552.1|  hypothetical protein                                  135   1e-36   
ref|WP_024123856.1|  histidine triad nucleotide-binding protein         134   1e-36   
ref|XP_671399.1|  hypothetical protein                                  134   1e-36   
gb|KFM62946.1|  Histidine triad nucleotide-binding protein 2, mit...    136   1e-36   
ref|XP_005239897.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|XP_004012272.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|WP_011140931.1|  zinc-binding protein                               134   1e-36   
ref|WP_009782192.1|  zinc-binding protein                               134   1e-36   
gb|AAL40394.1|AF085236_1  protein kinase C inhibitor-2                  135   1e-36   
ref|WP_026879056.1|  zinc-binding protein                               134   1e-36   
ref|XP_005903351.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|WP_003867925.1|  MULTISPECIES: HIT family hydrolase                 134   1e-36   
ref|WP_015196353.1|  histidine triad (HIT) protein                      134   1e-36   
ref|XP_004008699.1|  PREDICTED: histidine triad nucleotide-bindin...    135   1e-36   
ref|XP_003505052.1|  PREDICTED: histidine triad nucleotide-bindin...    136   2e-36   
ref|XP_004267371.1|  PREDICTED: histidine triad nucleotide-bindin...    135   2e-36   
ref|XP_007622386.1|  PREDICTED: histidine triad nucleotide-bindin...    136   2e-36   
dbj|BAA94871.1|  protein kinase C inhibitor                             134   2e-36   
ref|WP_035114837.1|  zinc-binding protein                               134   2e-36   
gb|ABZ84992.1|  hit family protein                                      134   2e-36   
ref|NP_787006.1|  histidine triad nucleotide-binding protein 1          134   2e-36   
ref|WP_017325299.1|  zinc-binding protein                               134   2e-36   
ref|XP_005804221.1|  PREDICTED: histidine triad nucleotide-bindin...    134   2e-36   
gb|ACH45531.1|  putative protein kinase C inhibitor/ASWZ variant 5      134   2e-36   
pdb|4INC|A  Chain A, Human Histidine Triad Nucleotide Binding Pro...    135   2e-36   
gb|AFY80069.1|  HIT family hydrolase, diadenosine tetraphosphate ...    134   2e-36   
ref|WP_013192151.1|  zinc-binding protein                               134   2e-36   
ref|XP_006986076.1|  PREDICTED: histidine triad nucleotide-bindin...    135   2e-36   
ref|WP_020150173.1|  hypothetical protein                               134   2e-36   
ref|WP_011589392.1|  MULTISPECIES: zinc-binding protein                 134   2e-36   
ref|XP_006986075.1|  PREDICTED: histidine triad nucleotide-bindin...    135   2e-36   
ref|WP_008317515.1|  HIT family hydrolase, diadenosine tetraphosp...    134   2e-36   
ref|NP_990020.1|  histidine triad nucleotide-binding protein 1          134   2e-36   
ref|WP_044448232.1|  zinc-binding protein                               134   2e-36   
pdb|3O1Z|A  Chain A, High Resolution Crystal Structure Of Histidi...    134   2e-36   
ref|XP_002166515.2|  PREDICTED: histidine triad nucleotide-bindin...    136   2e-36   
gb|ACB49716.1|  histidine triad family protein                          134   2e-36   
gb|ACQ58669.1|  Histidine triad nucleotide-binding protein 1            134   2e-36   
ref|XP_006627277.1|  PREDICTED: histidine triad nucleotide-bindin...    135   2e-36   
ref|WP_044196269.1|  zinc-binding protein                               134   2e-36   
ref|NP_001139032.1|  histidine triad nucleotide binding protein 1       134   2e-36   
ref|WP_015217095.1|  histidine triad (HIT) protein                      134   2e-36   
ref|NP_492056.1|  Protein HINT-1                                        134   2e-36   
gb|EHB09950.1|  Histidine triad nucleotide-binding protein 2            135   2e-36   
ref|WP_039738652.1|  zinc-binding protein                               134   2e-36   
gb|AIS52175.1|  HIT family hydrolase                                    134   2e-36   
gb|ACH45527.1|  putative protein kinase C inhibitor/ASWZ variant 5      134   3e-36   
ref|WP_029688846.1|  MULTISPECIES: HIT family hydrolase                 134   3e-36   
ref|WP_017305871.1|  zinc-binding protein                               134   3e-36   
pdb|3O1X|A  Chain A, High Resolution Crystal Structure Of Histidi...    134   3e-36   
pdb|3O1C|A  Chain A, High Resolution Crystal Structure Of Histidi...    134   3e-36   
ref|XP_008840582.1|  PREDICTED: histidine triad nucleotide-bindin...    135   3e-36   
gb|AAW24587.1|  SJCHGC07198 protein                                     134   3e-36   
ref|XP_005897800.1|  PREDICTED: histidine triad nucleotide-bindin...    134   3e-36   
ref|NP_001076092.1|  histidine triad nucleotide-binding protein 1       134   3e-36   
ref|WP_012162659.1|  zinc-binding protein                               134   3e-36   
ref|XP_008319861.1|  PREDICTED: histidine triad nucleotide-bindin...    135   3e-36   
ref|XP_002743114.1|  PREDICTED: histidine triad nucleotide-bindin...    135   3e-36   
ref|XP_005530101.1|  PREDICTED: histidine triad nucleotide-bindin...    134   3e-36   
ref|WP_012626960.1|  zinc-binding protein                               134   3e-36   
gb|AAN16460.1|  PKCI-Z-related protein                                  134   3e-36   
ref|NP_001134628.1|  histidine triad nucleotide-binding protein 1       134   3e-36   
ref|XP_002430066.1|  histidine triad nucleotide-binding protein, ...    134   3e-36   
ref|WP_021820140.1|  HIT family hydrolase                               133   3e-36   
ref|WP_009626380.1|  histidine triad (HIT) protein                      133   4e-36   
ref|WP_009546453.1|  MULTISPECIES: zinc-binding protein                 133   4e-36   
tpg|DAA12625.1|  TPA: histidine triad nucleotide binding protein ...    134   4e-36   
ref|XP_005989912.1|  PREDICTED: histidine triad nucleotide-bindin...    134   4e-36   
gb|ADO27980.1|  histidine triad nucleotide-binding protein 1            134   4e-36   
ref|WP_015280905.1|  HIT family hydrolase, diadenosine tetraphosp...    133   4e-36   
ref|XP_005078841.1|  PREDICTED: histidine triad nucleotide-bindin...    135   4e-36   
ref|WP_028304844.1|  zinc-binding protein                               133   4e-36   
ref|XP_006716943.1|  PREDICTED: histidine triad nucleotide-bindin...    135   4e-36   
ref|XP_004077101.1|  PREDICTED: histidine triad nucleotide-bindin...    134   4e-36   
ref|WP_007151572.1|  zinc-binding protein                               133   4e-36   
ref|NP_001231254.1|  histidine triad nucleotide-binding protein 2...    135   4e-36   
emb|CDQ81013.1|  unnamed protein product                                134   4e-36   
ref|NP_001058314.1|  Os06g0667500                                       132   4e-36   
ref|WP_014560867.1|  purine nucleoside phosphoramidase                  133   4e-36   
emb|CAX70614.1|  histidine triad nucleotide binding protein 1           134   4e-36   
ref|XP_010374436.1|  PREDICTED: histidine triad nucleotide-bindin...    135   4e-36   
ref|WP_027403240.1|  zinc-binding protein                               133   4e-36   
gb|KFQ27672.1|  Histidine triad nucleotide-binding protein 1            133   5e-36   
ref|WP_015121446.1|  HIT family hydrolase, diadenosine tetraphosp...    133   5e-36   
ref|WP_008845193.1|  Hit-like protein involved in cell-cycle regu...    133   5e-36   
emb|CCD81807.1|  putative histidine triad (hit) protein                 134   5e-36   
emb|CAX70615.1|  histidine triad nucleotide binding protein 1           134   5e-36   
gb|EFB15376.1|  hypothetical protein PANDA_007482                       134   5e-36   
pdb|3RHN|A  Chain A, Histidine Triad Nucleotide-Binding Protein (...    133   5e-36   
ref|XP_008266493.1|  PREDICTED: histidine triad nucleotide-bindin...    134   6e-36   
ref|XP_002125177.1|  PREDICTED: histidine triad nucleotide-bindin...    135   6e-36   
ref|XP_005660263.1|  PREDICTED: histidine triad nucleotide-bindin...    134   6e-36   
ref|NP_115982.1|  histidine triad nucleotide-binding protein 2, m...    134   6e-36   
ref|XP_005362151.1|  PREDICTED: histidine triad nucleotide-bindin...    134   6e-36   
emb|CDJ93567.1|  Histidine triad (HIT) protein domain containing ...    134   6e-36   
ref|XP_004895583.1|  PREDICTED: histidine triad nucleotide-bindin...    135   6e-36   
ref|XP_003470911.1|  PREDICTED: histidine triad nucleotide-bindin...    134   6e-36   
ref|XP_001743736.1|  hypothetical protein                               133   6e-36   
ref|XP_006072721.1|  PREDICTED: histidine triad nucleotide-bindin...    133   7e-36   
ref|WP_017292921.1|  zinc-binding protein                               132   7e-36   
ref|WP_026104430.1|  zinc-binding protein                               132   7e-36   
ref|WP_028084856.1|  zinc-binding protein                               132   7e-36   
ref|XP_004747623.1|  PREDICTED: histidine triad nucleotide-bindin...    133   7e-36   
ref|XP_004658524.1|  PREDICTED: histidine triad nucleotide-bindin...    134   7e-36   
ref|XP_003911567.1|  PREDICTED: histidine triad nucleotide-bindin...    134   7e-36   
ref|XP_004093198.1|  PREDICTED: LOW QUALITY PROTEIN: histidine tr...    133   7e-36   
ref|XP_006783685.1|  PREDICTED: histidine triad nucleotide-bindin...    133   7e-36   
ref|WP_003869513.1|  HIT family hydrolase                               132   7e-36   
pdb|4NJX|A  Chain A, Human Histidine Triad Nucleotide-binding Pro...    134   8e-36   
ref|XP_002819681.1|  PREDICTED: histidine triad nucleotide-bindin...    134   8e-36   
ref|XP_005401052.1|  PREDICTED: histidine triad nucleotide-bindin...    134   8e-36   
ref|NP_001253607.1|  histidine triad nucleotide-binding protein 2...    134   8e-36   
ref|XP_008850097.1|  PREDICTED: histidine triad nucleotide-bindin...    133   8e-36   
ref|XP_007522872.1|  PREDICTED: histidine triad nucleotide-bindin...    134   8e-36   
ref|XP_009056011.1|  hypothetical protein LOTGIDRAFT_232738             134   8e-36   
ref|XP_006743792.1|  PREDICTED: histidine triad nucleotide-bindin...    133   9e-36   
gb|EDN65268.1|  Histidine triad (HIT) protein                           132   9e-36   



>ref|XP_006430419.1| hypothetical protein CICLE_v10013010mg [Citrus clementina]
 gb|ESR43659.1| hypothetical protein CICLE_v10013010mg [Citrus clementina]
 gb|KDO57338.1| hypothetical protein CISIN_1g031773mg [Citrus sinensis]
Length=153

 Score =   221 bits (563),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 115/118 (97%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +VYEDD+VLAFRDIDP+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  37   PSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEER  96

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILGRLLYTAKLVAKQEGL E+GFR+VINDG +GGQ+VFHIH+HL+GGRQ+NWPPG
Sbjct  97   HCEILGRLLYTAKLVAKQEGL-EDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG  153



>ref|XP_006481968.1| PREDICTED: 14 kDa zinc-binding protein-like [Citrus sinensis]
Length=153

 Score =   219 bits (557),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 115/118 (97%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +VYEDD+VLAFRDI+P+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  37   PSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIEPQAPTHILIIPKVKDGLTGLSKAEER  96

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILGRLLYTAKLVAKQEGL E+GFR+VINDG +GGQ+VFHIH+HL+GGRQ+NWPPG
Sbjct  97   HCEILGRLLYTAKLVAKQEGL-EDGFRIVINDGPNGGQSVFHIHVHLLGGRQMNWPPG  153



>ref|XP_009619340.1| PREDICTED: 14 kDa zinc-binding protein [Nicotiana tomentosiformis]
Length=158

 Score =   218 bits (554),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPT+FDKIINKEIPANIVYEDD+VLAFRDI+P+AP HILLIPKV+DGLTGLSKAEE+
Sbjct  41   PSDSPTLFDKIINKEIPANIVYEDDKVLAFRDINPQAPVHILLIPKVRDGLTGLSKAEEK  100

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILG+LLYTAKLVAKQEGL ENGFRLVINDG  G Q+V+H+HLHL+GGRQ+NWPPG
Sbjct  101  HCEILGQLLYTAKLVAKQEGLLENGFRLVINDGPSGCQSVYHLHLHLLGGRQMNWPPG  158



>ref|XP_009777729.1| PREDICTED: 14 kDa zinc-binding protein [Nicotiana sylvestris]
Length=158

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIPANIVYEDD+VLAFRD +P+AP HILLIPKV+DGLTGLSKAEE+
Sbjct  41   PSDSPTIFDKIINKEIPANIVYEDDKVLAFRDTNPQAPVHILLIPKVRDGLTGLSKAEEK  100

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILG+LLYTAKLVAKQEGL ENGFRLVINDG  G Q+V+H+HLHL+GGRQ+NWPPG
Sbjct  101  HCEILGQLLYTAKLVAKQEGLLENGFRLVINDGPSGCQSVYHLHLHLLGGRQMNWPPG  158



>ref|XP_006339217.1| PREDICTED: 14 kDa zinc-binding protein-like [Solanum tuberosum]
Length=155

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIPA+IV+EDD+VLAFRDI+P+AP HILLIPKV+DGLTGLSKAEE+
Sbjct  38   PSDSPTIFDKIINKEIPADIVFEDDKVLAFRDINPQAPVHILLIPKVRDGLTGLSKAEEK  97

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +C++LGRLLYTAKLVAKQEGL ENGFRLVINDG DG Q+V+H+HLHL+GGRQ+NWPPG
Sbjct  98   NCDVLGRLLYTAKLVAKQEGLLENGFRLVINDGPDGCQSVYHLHLHLLGGRQMNWPPG  155



>ref|XP_004249357.1| PREDICTED: 14 kDa zinc-binding protein [Solanum lycopersicum]
Length=155

 Score =   214 bits (544),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIPA+IV+EDD+VLAFRDI+P+AP HILLIPKV+DGLTGLSKAEE+
Sbjct  38   PSDSPTIFDKIINKEIPADIVFEDDKVLAFRDINPQAPVHILLIPKVRDGLTGLSKAEEK  97

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +C++LGRLLYTAKLVAKQEGL ENGFRLVINDG DG Q+V+H+HLHL+GGRQ+NWPPG
Sbjct  98   NCDVLGRLLYTAKLVAKQEGLLENGFRLVINDGPDGCQSVYHLHLHLLGGRQMNWPPG  155



>ref|XP_011069986.1| PREDICTED: 14 kDa zinc-binding protein-like [Sesamum indicum]
Length=154

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+N+VYEDD+VLAFRDI P+APTHIL+IPKVKDGLTG+SKAEER
Sbjct  38   PSDSPTIFDKIINKEIPSNVVYEDDKVLAFRDIAPQAPTHILIIPKVKDGLTGISKAEER  97

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILGRLLY AKLVAKQEGLD+ GFRLVINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  98   HCEILGRLLYAAKLVAKQEGLDD-GFRLVINDGPKGCQSVYHLHVHLLGGRQMNWPPG  154



>gb|KHN34585.1| 14 kDa zinc-binding protein [Glycine soja]
Length=129

 Score =   211 bits (536),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 112/117 (96%), Gaps = 1/117 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD PT+FDKIINKEIP+ +VYEDD+VLAFRDIDP+APTHIL+IPKV+DGLTGLSKAEER
Sbjct  13   PSDGPTVFDKIINKEIPSTVVYEDDKVLAFRDIDPQAPTHILIIPKVRDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPP  171
            HCEILGRLL TAKLVAKQEGLD +GFR+VINDG+DGGQ+V+HIH+HLIGGRQ+ WPP
Sbjct  73   HCEILGRLLCTAKLVAKQEGLD-DGFRIVINDGRDGGQSVYHIHVHLIGGRQMGWPP  128



>ref|NP_001242625.1| uncharacterized protein LOC100785079 [Glycine max]
 gb|ACU20487.1| unknown [Glycine max]
Length=129

 Score =   210 bits (535),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 1/117 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD PT+FDKIINKEIP+ +VYEDD+VLAFRDIDP+APTHIL+IPKV+DGLTGLSKAEER
Sbjct  13   PSDGPTVFDKIINKEIPSTVVYEDDKVLAFRDIDPQAPTHILIIPKVRDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPP  171
            HCEILGRLL TAKLVAKQEGLD +GFR+VINDG+DGGQ+V+HIH HLIGGRQ+ WPP
Sbjct  73   HCEILGRLLCTAKLVAKQEGLD-DGFRIVINDGRDGGQSVYHIHAHLIGGRQMGWPP  128



>gb|KDP24045.1| hypothetical protein JCGZ_26729 [Jatropha curcas]
Length=129

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +VYEDD+VLAFRDI P+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  13   PSDSPTIFDKIINKEIPSTVVYEDDKVLAFRDISPQAPTHILIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HC+ILGRLLYTAKL+AKQEGL E+GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  73   HCDILGRLLYTAKLIAKQEGL-EDGFRIVINDGPSGCQSVYHLHIHLLGGRQMNWPPG  129



>gb|KJB78446.1| hypothetical protein B456_013G000500 [Gossypium raimondii]
Length=155

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIPA +VYEDD+VLAFRDI P+APTHIL+IPK KDGLTGLSKAEER
Sbjct  39   PSDSPTIFDKIINKEIPATVVYEDDKVLAFRDIAPQAPTHILIIPKSKDGLTGLSKAEER  98

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILG LLYTAKLVAKQEGLD +GFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  99   HCEILGCLLYTAKLVAKQEGLD-DGFRIVINDGPKGCQSVYHIHVHLLGGRQMNWPPG  155



>ref|XP_004294701.1| PREDICTED: 14 kDa zinc-binding protein [Fragaria vesca subsp. 
vesca]
Length=159

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDS TIFDKIINKEIPA +V+EDD+VLAFRDI P+APTHIL+IPKV+DGLTGLSKAEER
Sbjct  43   PSDSATIFDKIINKEIPATVVFEDDKVLAFRDISPQAPTHILIIPKVRDGLTGLSKAEER  102

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILG+LLYTAKLVAKQEGL E+GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  103  HCEILGQLLYTAKLVAKQEGL-EDGFRIVINDGPKGCQSVYHIHVHLIGGRQMNWPPG  159



>ref|XP_010036427.1| PREDICTED: 14 kDa zinc-binding protein [Eucalyptus grandis]
 gb|KCW47976.1| hypothetical protein EUGRSUZ_K01707 [Eucalyptus grandis]
Length=151

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII KEIP+ +V+EDD+VLAFRDI P+APTHIL+IPKVKDGL+GLSKAEER
Sbjct  35   PSDSPTIFDKIIKKEIPSAVVFEDDKVLAFRDISPQAPTHILIIPKVKDGLSGLSKAEER  94

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILGRLLYTAKLVAKQEGL E+GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  95   HCEILGRLLYTAKLVAKQEGL-EDGFRIVINDGPSGCQSVYHLHIHLLGGRQMNWPPG  151



>ref|XP_010251655.1| PREDICTED: 14 kDa zinc-binding protein [Nelumbo nucifera]
Length=158

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +VYEDD+VLAFRDI P+APTHIL+IPKVKDGLTGLS AEER
Sbjct  42   PSDSPTIFDKIINKEIPSTVVYEDDKVLAFRDISPQAPTHILIIPKVKDGLTGLSTAEER  101

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILG+LLY AKLVAKQEGL E+GFR+VINDG  G Q+V+H+H+HLIGGRQ+NWPPG
Sbjct  102  HCEILGKLLYAAKLVAKQEGL-EDGFRVVINDGPKGCQSVYHLHIHLIGGRQMNWPPG  158



>ref|XP_010673250.1| PREDICTED: 14 kDa zinc-binding protein-like [Beta vulgaris subsp. 
vulgaris]
Length=161

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 1/124 (1%)
 Frame = -1

Query  539  LLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L     P DSPTIFDKIINKEIPAN+V+EDDQVLAFRDI+P+APTHI++IPKVKDGL+GL
Sbjct  39   LAAASTPVDSPTIFDKIINKEIPANVVFEDDQVLAFRDINPQAPTHIVIIPKVKDGLSGL  98

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEE+HC+ILGRLLYTAKLVAKQE LD+ GFR+VINDG  G Q+V+HIH+HL+GGRQ+N
Sbjct  99   SKAEEKHCDILGRLLYTAKLVAKQENLDD-GFRIVINDGPTGCQSVYHIHVHLLGGRQMN  157

Query  179  WPPG  168
            WPPG
Sbjct  158  WPPG  161



>ref|XP_007028210.1| HIS triad family protein 3 [Theobroma cacao]
 gb|EOY08712.1| HIS triad family protein 3 [Theobroma cacao]
Length=155

 Score =   206 bits (525),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +VYEDD+VLAFRDI P+APTHIL+IPK KDGLTGLSKAEER
Sbjct  39   PSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIAPQAPTHILIIPKSKDGLTGLSKAEER  98

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            HCEILG LLY AKLVAKQEGL E+GFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  99   HCEILGHLLYIAKLVAKQEGL-EDGFRIVINDGPQGCQSVYHIHVHLLGGRQMNWPPG  155



>ref|XP_007202700.1| hypothetical protein PRUPE_ppa012689mg [Prunus persica]
 gb|EMJ03899.1| hypothetical protein PRUPE_ppa012689mg [Prunus persica]
Length=158

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +V+EDD+VLAFRDI+P+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  42   PSDSPTIFDKIINKEIPSKVVFEDDKVLAFRDINPQAPTHILIIPKVKDGLTGLSKAEER  101

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG+LLYTAKL+AKQEGLD+ GFR+VINDG +G Q+V+H+H+HL+GGRQLNWPPG
Sbjct  102  HTEILGQLLYTAKLIAKQEGLDD-GFRIVINDGPNGCQSVYHLHVHLLGGRQLNWPPG  158



>ref|XP_004489633.1| PREDICTED: 14 kDa zinc-binding protein-like [Cicer arietinum]
Length=153

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = -1

Query  539  LLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L  TP  SDSPTIFDKIINKEIP+ +VYEDD+VLAFRDI P+AP HIL+IPKV+DGLTG+
Sbjct  31   LAATPSDSDSPTIFDKIINKEIPSTVVYEDDKVLAFRDISPQAPVHILIIPKVRDGLTGI  90

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEERH EILGRLLYTAKLVAKQEGLD+ G+R+VINDG  G Q+V+HIH+HL+GGRQ+N
Sbjct  91   SKAEERHFEILGRLLYTAKLVAKQEGLDD-GYRVVINDGPKGCQSVYHIHVHLLGGRQMN  149

Query  179  WPPG  168
            WPPG
Sbjct  150  WPPG  153



>ref|XP_008240602.1| PREDICTED: 14 kDa zinc-binding protein [Prunus mume]
Length=158

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +V+EDD+VLAFRDI+P+APTHIL+IPKV+DGLTGLSKAEER
Sbjct  42   PSDSPTIFDKIINKEIPSKVVFEDDKVLAFRDINPQAPTHILIIPKVRDGLTGLSKAEER  101

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG+LLYTAKL+AKQEGLD +GFR+VINDG +G Q+V+H+H+HL+GGRQLNWPPG
Sbjct  102  HTEILGQLLYTAKLIAKQEGLD-DGFRIVINDGPNGCQSVYHLHVHLLGGRQLNWPPG  158



>ref|XP_002270641.1| PREDICTED: 14 kDa zinc-binding protein [Vitis vinifera]
Length=160

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIPA IVYEDD+VLAFRDI P+APTHILLIPKVKDGLTGLSKAEER
Sbjct  44   PSDSPTIFDKIINKEIPATIVYEDDKVLAFRDIAPQAPTHILLIPKVKDGLTGLSKAEER  103

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H  ILG LLYTAKLVAKQEGL E+GFR+VINDG    Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  104  HSVILGHLLYTAKLVAKQEGL-EDGFRIVINDGPSACQSVYHIHVHLLGGRQMNWPPG  160



>gb|KHN16268.1| 14 kDa zinc-binding protein [Glycine soja]
Length=159

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -1

Query  572  GPVISLLTLPWLLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILL  393
             P+++      L  TP  +D+PTIFDKIINKEIP+ +VYEDD+VLAFRDI P+APTHIL+
Sbjct  26   SPIMASEKQAALAVTPSDADAPTIFDKIINKEIPSTVVYEDDKVLAFRDITPQAPTHILI  85

Query  392  IPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHI  213
            IPK KDGL+GLSKAEERH EILGRLLYTAKLVAKQEGLD +GFR+VINDG  G Q+V+HI
Sbjct  86   IPKFKDGLSGLSKAEERHFEILGRLLYTAKLVAKQEGLD-DGFRIVINDGPKGCQSVYHI  144

Query  212  HLHLIGGRQLNWPPG  168
            H+HL+GGRQ+NWPPG
Sbjct  145  HVHLLGGRQMNWPPG  159



>emb|CBI31175.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIPA IVYEDD+VLAFRDI P+APTHILLIPKVKDGLTGLSKAEER
Sbjct  13   PSDSPTIFDKIINKEIPATIVYEDDKVLAFRDIAPQAPTHILLIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H  ILG LLYTAKLVAKQEGL E+GFR+VINDG    Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HSVILGHLLYTAKLVAKQEGL-EDGFRIVINDGPSACQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_006402981.1| hypothetical protein EUTSA_v10006296mg [Eutrema salsugineum]
 gb|ESQ44434.1| hypothetical protein EUTSA_v10006296mg [Eutrema salsugineum]
Length=147

 Score =   204 bits (519),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKVKDGLTGLSKAEER
Sbjct  31   PSDSPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPIHILLIPKVKDGLTGLSKAEER  90

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGLD +GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  91   HIDILGRLLYTAKLVAKQEGLD-DGFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  147



>ref|XP_009116350.1| PREDICTED: 14 kDa zinc-binding protein [Brassica rapa]
Length=147

 Score =   203 bits (517),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  31   PSDAPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  90

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  91   HIDILGRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  147



>emb|CDP19662.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 110/116 (95%), Gaps = 1/116 (1%)
 Frame = -1

Query  515  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC  336
            DSPTIFDKIINKEIPAN+VYEDD+VLAFRDI+P+AP HILLIPKVKDGL+G+SKAEERH 
Sbjct  17   DSPTIFDKIINKEIPANVVYEDDKVLAFRDINPQAPIHILLIPKVKDGLSGVSKAEERHI  76

Query  335  EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            EILGRLLYTAKLVAKQEGL E+GFRLVINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  77   EILGRLLYTAKLVAKQEGL-EDGFRLVINDGPSGCQSVYHLHIHLLGGRQMNWPPG  131



>ref|XP_006292006.1| hypothetical protein CARUB_v10018194mg [Capsella rubella]
 gb|EOA24904.1| hypothetical protein CARUB_v10018194mg [Capsella rubella]
Length=147

 Score =   203 bits (517),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  31   PSDSPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  90

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGL+E GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  91   HIDILGRLLYTAKLVAKQEGLEE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  147



>gb|KFK34892.1| hypothetical protein AALP_AA5G207000 [Arabis alpina]
Length=145

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 3/135 (2%)
 Frame = -1

Query  572  GPVISLLTLPWLLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILL  393
             PV++      L  TPF  DSPTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILL
Sbjct  14   SPVMASEKEAALAATPF--DSPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPIHILL  71

Query  392  IPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHI  213
            IPKV+DGLTGLSKAEERH +ILGRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HI
Sbjct  72   IPKVRDGLTGLSKAEERHIDILGRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHI  130

Query  212  HLHLIGGRQLNWPPG  168
            H+HLIGGRQ+NWPPG
Sbjct  131  HVHLIGGRQMNWPPG  145



>ref|NP_001238556.1| uncharacterized protein LOC100527347 [Glycine max]
 gb|ACU16421.1| unknown [Glycine max]
Length=159

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -1

Query  572  GPVISLLTLPWLLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILL  393
             P+++      L  TP  +D+PTIFDKIINKEIP+ +VYEDD+VLAFRDI P+APTHIL+
Sbjct  26   SPIMASEKQAALAVTPSDADAPTIFDKIINKEIPSTVVYEDDKVLAFRDITPQAPTHILI  85

Query  392  IPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHI  213
            IPK KDGL+GLSKAEERH EILGRLLYTAKLVA+QEGLD +GFR+VINDG  G Q+V+HI
Sbjct  86   IPKFKDGLSGLSKAEERHFEILGRLLYTAKLVAEQEGLD-DGFRIVINDGPKGCQSVYHI  144

Query  212  HLHLIGGRQLNWPPG  168
            H+HL+GGRQ+NWPPG
Sbjct  145  HVHLLGGRQMNWPPG  159



>ref|XP_002876369.1| hypothetical protein ARALYDRAFT_486090 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52628.1| hypothetical protein ARALYDRAFT_486090 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score =   202 bits (515),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  31   PSDSPTIFDKIISKEIPSTMVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  90

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGL+E GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  91   HIDILGRLLYTAKLVAKQEGLEE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  147



>ref|XP_009139095.1| PREDICTED: 14 kDa zinc-binding protein-like [Brassica rapa]
Length=144

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  28   PSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  87

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  88   HIDILGRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  144



>emb|CDY27209.1| BnaA09g35930D [Brassica napus]
 emb|CDX72132.1| BnaC08g27420D [Brassica napus]
Length=129

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  13   PSDAPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  73   HIDILGRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  129



>ref|XP_011041305.1| PREDICTED: 14 kDa zinc-binding protein-like [Populus euphratica]
Length=167

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 108/113 (96%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIINKEIPA +VYEDD+VLAFRDI P+APTHILLIPK+KDGLTGLSKAEERHCEIL
Sbjct  56   TIFDKIINKEIPAKVVYEDDKVLAFRDIAPQAPTHILLIPKIKDGLTGLSKAEERHCEIL  115

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            GRLLYTAKLVAKQEGL E+G+R+VINDG +G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  116  GRLLYTAKLVAKQEGL-EDGYRVVINDGPNGCQSVYHVHVHLLGGRQMNWPPG  167



>gb|EPS66467.1| hypothetical protein M569_08307 [Genlisea aurea]
Length=129

 Score =   201 bits (512),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD PTIFDKII+K+IP+++VYEDDQVLAFRDI P+AP HI++IPKVKDGLT LSKAEER
Sbjct  13   PSDGPTIFDKIIDKKIPSSVVYEDDQVLAFRDIAPQAPVHIVIIPKVKDGLTRLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILGRLLYTAK+VAKQEGL ENGFR+VINDG DG Q+V+H+HLH+IGGRQ+NWPPG
Sbjct  73   HVEILGRLLYTAKIVAKQEGL-ENGFRVVINDGPDGCQSVYHLHLHVIGGRQMNWPPG  129



>emb|CDY67461.1| BnaCnng55070D [Brassica napus]
 emb|CDX75993.1| BnaA04g02570D [Brassica napus]
Length=129

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  13   PSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  73   HIDILGRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  129



>ref|XP_002520586.1| histidine triad (hit) protein, putative [Ricinus communis]
 gb|EEF41819.1| histidine triad (hit) protein, putative [Ricinus communis]
Length=129

 Score =   201 bits (511),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
             PSDSPTIFDKII+KEIP+ IVYEDD+VLAFRDI P+AP HI++IPKVKDGLTGLSKAEE
Sbjct  12   IPSDSPTIFDKIIDKEIPSTIVYEDDKVLAFRDISPQAPIHIIIIPKVKDGLTGLSKAEE  71

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            RH +ILGRLLYTAKLVAK EGL ENGFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  72   RHVDILGRLLYTAKLVAKLEGL-ENGFRIVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_011010091.1| PREDICTED: 14 kDa zinc-binding protein-like [Populus euphratica]
Length=167

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 108/113 (96%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIINKEIPA +VYEDD+VLAFRDI P+APTHILLIPK+KDGLTGLSKAEERHCEIL
Sbjct  56   TIFDKIINKEIPAKVVYEDDKVLAFRDIAPQAPTHILLIPKIKDGLTGLSKAEERHCEIL  115

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            GRLLYTAKLVAKQEGL E+G+R+VINDG +G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  116  GRLLYTAKLVAKQEGL-EDGYRVVINDGPNGCQSVYHVHVHLLGGRQMNWPPG  167



>ref|XP_004136603.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus]
 ref|XP_004168239.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus]
 gb|KGN59368.1| hypothetical protein Csa_3G814350 [Cucumis sativus]
Length=156

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +V+EDD+VLAFRDI P+APTHIL+IPKVKDGL+GLSKAEER
Sbjct  40   PSDSPTIFDKIINKEIPSTVVFEDDKVLAFRDIAPQAPTHILIIPKVKDGLSGLSKAEER  99

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLYTAKL+AKQEGLD +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  100  HTEILGHLLYTAKLIAKQEGLD-DGFRVVINDGPSGCQSVYHLHVHLLGGRQMNWPPG  156



>ref|XP_002323194.2| hypothetical protein POPTR_0016s02430g [Populus trichocarpa]
 gb|EEF04955.2| hypothetical protein POPTR_0016s02430g [Populus trichocarpa]
Length=167

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 108/113 (96%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIINKEIPA +VYEDD+VLAFRDI P+APTHILLIPKVKDGLTGLSKAEERHCEIL
Sbjct  56   TIFDKIINKEIPAKVVYEDDKVLAFRDIAPQAPTHILLIPKVKDGLTGLSKAEERHCEIL  115

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G+LLYTAKLVAKQEGL E+G+R+VINDG +G Q+V+H+HLHL+GGRQ+NWPPG
Sbjct  116  GQLLYTAKLVAKQEGL-EDGYRVVINDGPNGCQSVYHLHLHLLGGRQMNWPPG  167



>ref|XP_007151511.1| hypothetical protein PHAVU_004G053100g [Phaseolus vulgaris]
 gb|ESW23505.1| hypothetical protein PHAVU_004G053100g [Phaseolus vulgaris]
Length=155

 Score =   201 bits (512),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -1

Query  539  LLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L   P  +D+PTIFDKIINKEIP+ +VYEDD+VLAFRDI P+APTHIL+IPKVKDGL+GL
Sbjct  33   LAAIPSDADAPTIFDKIINKEIPSTVVYEDDKVLAFRDITPQAPTHILIIPKVKDGLSGL  92

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEERH +ILGRLLYTAKLVAKQEGLD+ GFR+VINDG  G Q+V+HIH+HL+GGRQ+N
Sbjct  93   SKAEERHFDILGRLLYTAKLVAKQEGLDD-GFRIVINDGPKGCQSVYHIHVHLLGGRQMN  151

Query  179  WPPG  168
            WP G
Sbjct  152  WPAG  155



>ref|XP_009350626.1| PREDICTED: 14 kDa zinc-binding protein [Pyrus x bretschneideri]
Length=160

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKIINKEIPA +V+EDD+VLAFRDI+P+APTHIL+IPKV+DGLTGL+KAEER
Sbjct  44   PSDAPTIFDKIINKEIPAKVVFEDDKVLAFRDINPQAPTHILIIPKVRDGLTGLAKAEER  103

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG+LLY AKL+AKQEGLD+ GFR+VINDG +G Q+V+H+HLHL+GGRQ+NWPPG
Sbjct  104  HTEILGQLLYAAKLIAKQEGLDD-GFRIVINDGPNGCQSVYHLHLHLLGGRQMNWPPG  160



>ref|XP_003618911.1| 14 kDa zinc-binding protein [Medicago truncatula]
 gb|AES75129.1| scavenger mRNA decapping enzyme carboxy-term-binding protein 
[Medicago truncatula]
Length=153

 Score =   201 bits (511),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -1

Query  539  LLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L  TP  +DSPTIFDKIINKEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTG+
Sbjct  31   LAATPPDADSPTIFDKIINKEIPSTVVYEDDKVLAFRDIQPQGPVHILLIPKVRDGLTGI  90

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEERH +ILGRLLYTAKLVAKQEGLD+ G+R+VINDG  G Q+V+HIH+H+IGGRQ+N
Sbjct  91   SKAEERHIDILGRLLYTAKLVAKQEGLDD-GYRVVINDGPKGCQSVYHIHVHVIGGRQMN  149

Query  179  WPPG  168
            WPPG
Sbjct  150  WPPG  153



>ref|NP_567038.1| HIS triad family protein 3 [Arabidopsis thaliana]
 gb|AAN86189.1| putative protein kinase C inhibitor [Arabidopsis thaliana]
 gb|AEE79527.1| HIS triad family protein 3 [Arabidopsis thaliana]
Length=147

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  31   PSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  90

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGL E GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  91   HIDILGRLLYTAKLVAKQEGLAE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  147



>ref|XP_008443161.1| PREDICTED: 14 kDa zinc-binding protein [Cucumis melo]
Length=156

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +V+EDD+VLAFRDI P+APTHIL+IP+VKDGL+GLSKAEER
Sbjct  40   PSDSPTIFDKIINKEIPSTVVFEDDKVLAFRDIAPQAPTHILIIPRVKDGLSGLSKAEER  99

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLYTAKL+AKQEGLD +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  100  HTEILGHLLYTAKLIAKQEGLD-DGFRVVINDGPSGCQSVYHLHVHLLGGRQMNWPPG  156



>ref|XP_006603708.1| PREDICTED: uncharacterized protein LOC100785079 isoform X1 [Glycine 
max]
Length=157

 Score =   201 bits (510),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 4/125 (3%)
 Frame = -1

Query  536  LETPFPSDSPTI---FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLT  366
            L   F  DS  I   FDKIINKEIP+ +VYEDD+VLAFRDIDP+APTHIL+IPKV+DGLT
Sbjct  33   LWVSFAGDSVKIYARFDKIINKEIPSTVVYEDDKVLAFRDIDPQAPTHILIIPKVRDGLT  92

Query  365  GLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQ  186
            GLSKAEERHCEILGRLL TAKLVAKQEGLD+ GFR+VINDG+DGGQ+V+HIH+HLIGGRQ
Sbjct  93   GLSKAEERHCEILGRLLCTAKLVAKQEGLDD-GFRIVINDGRDGGQSVYHIHVHLIGGRQ  151

Query  185  LNWPP  171
            + WPP
Sbjct  152  MGWPP  156



>ref|XP_011079133.1| PREDICTED: 14 kDa zinc-binding protein-like isoform X1 [Sesamum 
indicum]
Length=129

 Score =   199 bits (507),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PS SPTIFDKIINKEIPANIVYEDD+VLAFRDI P+AP H+++IPKV DGLTG+SKAEE+
Sbjct  13   PSGSPTIFDKIINKEIPANIVYEDDKVLAFRDIAPQAPVHVVIIPKVTDGLTGISKAEEK  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILGRLLYT+KLVAKQEGL E+GFRLVINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  73   HTEILGRLLYTSKLVAKQEGL-EDGFRLVINDGPKGCQSVYHLHIHLLGGRQMNWPPG  129



>emb|CAB88052.1| protein kinase C inhibitor-like protein [Arabidopsis thaliana]
 gb|AAK76535.1| putative protein kinase C inhibitor [Arabidopsis thaliana]
 gb|AAM63920.1| protein kinase C inhibitor-like protein [Arabidopsis thaliana]
Length=129

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII+KEIP+ +V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAEER
Sbjct  13   PSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKLVAKQEGL E GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  73   HIDILGRLLYTAKLVAKQEGLAE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  129



>gb|EYU35642.1| hypothetical protein MIMGU_mgv1a015436mg [Erythranthe guttata]
Length=157

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 109/116 (94%), Gaps = 1/116 (1%)
 Frame = -1

Query  515  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC  336
            DSPTIFDKIINK+IPANIVYED+ VLAFRDI P+APTHIL+IPK+++GLTG+SKAEE+H 
Sbjct  43   DSPTIFDKIINKQIPANIVYEDEHVLAFRDISPQAPTHILVIPKLRNGLTGISKAEEKHF  102

Query  335  EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            EILGRLLYTAK+VAKQEGLD+ GFRLVINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  103  EILGRLLYTAKIVAKQEGLDD-GFRLVINDGPSGCQSVYHLHIHLLGGRQMNWPPG  157



>ref|XP_008392503.1| PREDICTED: 14 kDa zinc-binding protein [Malus domestica]
Length=160

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKIIN+EIPA +V+EDD+VLAFRDI+P+APTHIL+IPKV+DGLTGLSKAEER
Sbjct  44   PSDAPTIFDKIINQEIPAKVVFEDDKVLAFRDINPQAPTHILIIPKVRDGLTGLSKAEER  103

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG+LLY AKL+AKQE LD+ GFR+VINDG +G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  104  HTEILGQLLYAAKLIAKQESLDD-GFRIVINDGPNGCQSVYHLHVHLLGGRQMNWPPG  160



>gb|AGT16929.1| hypothetical protein SHCRBa_011_I19_R_310 [Saccharum hybrid cultivar 
R570]
Length=129

 Score =   197 bits (502),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
             P+DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGLSKAEE
Sbjct  12   LPNDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLSKAEE  71

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            RH EILG LLY AK+VAKQEGL+E G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  72   RHVEILGYLLYVAKVVAKQEGLEE-GYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_010504557.1| PREDICTED: 14 kDa zinc-binding protein [Camelina sativa]
Length=149

 Score =   198 bits (504),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 109/124 (88%), Gaps = 2/124 (2%)
 Frame = -1

Query  536  LETPFPSD-SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L    PSD SPTIFDKII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGL
Sbjct  27   LAAATPSDDSPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGL  86

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEERH +ILGRLLYTAKLVAKQEGL E GFR+VINDG  G Q+V+HIH+HLIGGRQ+N
Sbjct  87   SKAEERHIDILGRLLYTAKLVAKQEGLAE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMN  145

Query  179  WPPG  168
            WPPG
Sbjct  146  WPPG  149



>ref|XP_009386029.1| PREDICTED: 14 kDa zinc-binding protein [Musa acuminata subsp. 
malaccensis]
Length=161

 Score =   198 bits (503),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKII KEIP+ +VYED++VLAFRDI P+APTHI++IPKVKDGLTGLSKAEER
Sbjct  45   PSDAPTIFDKIIRKEIPSTVVYEDEKVLAFRDISPQAPTHIIIIPKVKDGLTGLSKAEER  104

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AKLVAKQEGLD +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  105  HIEILGYLLYVAKLVAKQEGLD-DGFRIVINDGPKGCQSVYHLHIHLLGGRQMNWPPG  161



>ref|XP_002467940.1| hypothetical protein SORBIDRAFT_01g036830 [Sorghum bicolor]
 gb|EER94938.1| hypothetical protein SORBIDRAFT_01g036830 [Sorghum bicolor]
Length=129

 Score =   197 bits (500),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  13   PNDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HIEILGYLLYVAKVVAKQEGL-EDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_010516257.1| PREDICTED: 14 kDa zinc-binding protein-like [Camelina sativa]
Length=149

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = -1

Query  536  LETPFPSD-SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L    PSD SPTIFDKII+KEIP+N+V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGL
Sbjct  27   LAAATPSDDSPTIFDKIISKEIPSNVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGL  86

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEE+H +ILGRLLYTAKLVAKQEGL E GFR+VINDG  G Q+V+HIH+HLIGGRQ+N
Sbjct  87   SKAEEKHIDILGRLLYTAKLVAKQEGLAE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMN  145

Query  179  WPPG  168
            WPPG
Sbjct  146  WPPG  149



>gb|AGT16429.1| zinc-binding protein [Saccharum hybrid cultivar R570]
Length=129

 Score =   196 bits (499),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+DSPTIFDKII KEIP+ +VYED++VLAFRD++P+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  13   PNDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDVNPQAPTHILIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGYLLYVAKVVAKQEGL-EDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_004984542.1| PREDICTED: 14 kDa zinc-binding protein-like [Setaria italica]
Length=129

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  13   PNDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK++AKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWP G
Sbjct  73   HVEILGYLLYVAKVIAKQEGL-EDGYRVVINDGPKGCQSVYHIHVHLLGGRQMNWPAG  129



>gb|EMS55067.1| 14 kDa zinc-binding protein [Triticum urartu]
Length=129

 Score =   193 bits (491),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+D+PTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHI++IPKVKDGLTGLSKAEER
Sbjct  13   PNDNPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHIVIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK++AKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGCLLYAAKVIAKQEGL-EDGYRIVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|NP_001241703.1| histidine triad nucleotide binding protein [Zea mays]
 gb|ACG24990.1| zinc-binding protein [Zea mays]
 gb|ACG32807.1| zinc-binding protein [Zea mays]
 gb|ADZ57277.1| histidine triad nucleotide binding protein [Zea mays]
 tpg|DAA45134.1| TPA: protein kinase inhibitor1 [Zea mays]
Length=129

 Score =   193 bits (490),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -1

Query  515  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC  336
            DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGL+KAEERH 
Sbjct  15   DSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLAKAEERHI  74

Query  335  EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  75   EILGYLLYVAKVVAKQEGL-EDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_008792458.1| PREDICTED: 14 kDa zinc-binding protein [Phoenix dactylifera]
Length=164

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKII KEIP+ +V+EDD+VLAFRDI P+APTHI++IPKVKDGL+ LSKAEER
Sbjct  48   PSDAPTIFDKIIKKEIPSTVVFEDDKVLAFRDISPQAPTHIIIIPKVKDGLSQLSKAEER  107

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AKLVAKQEGLD+ GFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  108  HIEILGYLLYVAKLVAKQEGLDD-GFRIVINDGPKGCQSVYHIHVHLLGGRQMNWPPG  164



>dbj|BAJ99840.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93123.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=129

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+D+PTIFDKII KEIP+ +VYED++VLAFRDI+P+APTH+++IPKVKDGLTGLSKAEER
Sbjct  13   PNDNPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHVVIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK++AKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGCLLYAAKVIAKQEGL-EDGYRIVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>gb|EEC75152.1| hypothetical protein OsI_11358 [Oryza sativa Indica Group]
Length=129

 Score =   192 bits (489),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+D+PTIFDKII KEIP+ +V+ED++VLAFRDI+P+APTHI++IPKVKDGLTGLSKAEER
Sbjct  13   PNDNPTIFDKIIKKEIPSTVVFEDEKVLAFRDINPQAPTHIVIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGYLLYVAKVVAKQEGL-EDGYRIVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_010427477.1| PREDICTED: 14 kDa zinc-binding protein-like [Camelina sativa]
Length=149

 Score =   193 bits (491),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 2/124 (2%)
 Frame = -1

Query  536  LETPFPSD-SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L    PSD S TIFDKII+KEIP+ +V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGL
Sbjct  27   LAAATPSDDSLTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGL  86

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            SKAEERH +ILGRLLYTAKLVAKQEGL E GFR+VINDG  G Q+V+HIH+HLIGGRQ+N
Sbjct  87   SKAEERHIDILGRLLYTAKLVAKQEGLAE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMN  145

Query  179  WPPG  168
            WPPG
Sbjct  146  WPPG  149



>ref|XP_010525428.1| PREDICTED: 14 kDa zinc-binding protein [Tarenaya hassleriana]
Length=128

 Score =   192 bits (489),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDS TIFDKIINKEIP+ +VYEDD+VLAF+DI+P+AP HILLIPKVKDGL+GLSKAEER
Sbjct  13   PSDS-TIFDKIINKEIPSTVVYEDDKVLAFKDIEPQAPVHILLIPKVKDGLSGLSKAEER  71

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLY A LVAKQEGLD+ GFR+VINDG +G Q+V+HIH+H++GGRQ+NWPPG
Sbjct  72   HIDILGRLLYAANLVAKQEGLDD-GFRIVINDGPNGCQSVYHIHVHVLGGRQMNWPPG  128



>gb|AFK47543.1| unknown [Lotus japonicus]
Length=145

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -1

Query  539  LLETPFPSD-SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTG  363
            L  TP  S+ +PTIFD+IINKEIP+ +VYEDD+VLAFRDI P+AP HIL+IPKV+DGLTG
Sbjct  22   LAATPPSSEYTPTIFDRIINKEIPSTVVYEDDKVLAFRDIAPQAPVHILIIPKVRDGLTG  81

Query  362  LSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL  183
            LSKAEERH EILGRLL+TAKLVAKQEGLD +GFR+VINDG  G Q+V+HIH+HL+GGRQ+
Sbjct  82   LSKAEERHFEILGRLLHTAKLVAKQEGLD-DGFRIVINDGPKGCQSVYHIHVHLLGGRQM  140

Query  182  NWPPG  168
            +WPPG
Sbjct  141  DWPPG  145



>ref|NP_001105498.1| 14 kDa zinc-binding protein [Zea mays]
 sp|P42856.1|ZB14_MAIZE RecName: Full=14 kDa zinc-binding protein; AltName: Full=Protein 
kinase C inhibitor; Short=PKCI [Zea mays]
 emb|CAA82751.1| protein kinase C inhibitor [Zea mays]
Length=128

 Score =   192 bits (488),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -1

Query  515  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC  336
            DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGL+KAEERH 
Sbjct  14   DSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLAKAEERHI  73

Query  335  EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  74   EILGYLLYVAKVVAKQEGL-EDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  128



>ref|XP_010922940.1| PREDICTED: 14 kDa zinc-binding protein [Elaeis guineensis]
Length=164

 Score =   193 bits (490),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD+PTIFDKII KEIP+ +V+EDD+VLAFRDI P+APTHI++IPKVKDGL+ LSKAEER
Sbjct  48   PSDAPTIFDKIIRKEIPSTVVFEDDKVLAFRDISPQAPTHIIIIPKVKDGLSQLSKAEER  107

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK+VAKQEGLD+ GFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  108  HIEILGYLLYVAKVVAKQEGLDD-GFRIVINDGPKGCQSVYHIHVHLLGGRQMNWPPG  164



>ref|XP_006650010.1| PREDICTED: 14 kDa zinc-binding protein-like [Oryza brachyantha]
Length=129

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+D+PTIFDKII KEIP+ +V+ED++VLAFRDI+P+APTHI++IPKVKDGL+GLSKAEER
Sbjct  13   PNDNPTIFDKIIKKEIPSTVVFEDEKVLAFRDINPQAPTHIVIIPKVKDGLSGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK++AKQEGL E+GFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGYLLYVAKVIAKQEGL-EDGFRIVINDGPKGCQSVYHIHVHLLGGRQMNWPPG  129



>emb|CDX67650.1| BnaA07g16900D [Brassica napus]
Length=129

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            SDSPTIFDKII++EIP ++VYEDD+VLAFRDI P+ P HIL+IPKVKDGLTGLSKAEERH
Sbjct  14   SDSPTIFDKIISREIPHHVVYEDDKVLAFRDIRPQGPIHILVIPKVKDGLTGLSKAEERH  73

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILGRLLY AK+VAKQEGLD +GFR+VINDG  G Q V+HIH+H+IGGRQ+NWPPG
Sbjct  74   IDILGRLLYVAKIVAKQEGLD-DGFRIVINDGPQGCQAVYHIHVHVIGGRQMNWPPG  129



>ref|NP_001049967.1| Os03g0322500 [Oryza sativa Japonica Group]
 gb|ABF95679.1| 14 kDa zinc-binding protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11881.1| Os03g0322500 [Oryza sativa Japonica Group]
 dbj|BAG96117.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00283.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58971.1| hypothetical protein OsJ_10663 [Oryza sativa Japonica Group]
Length=129

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+D+PTIFDKII KEIP+ +V++D++VLAFRDI+P+APTHI++IPKVKDGLTGLSKAEER
Sbjct  13   PNDNPTIFDKIIKKEIPSTVVFDDEKVLAFRDINPQAPTHIVIIPKVKDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGYLLYVAKVVAKQEGL-EDGYRIVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_003558021.1| PREDICTED: 14 kDa zinc-binding protein [Brachypodium distachyon]
Length=129

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P+D+PTIFDKII KEIP+ +VYED++VLAFRDI+P+AP HI++IPKV+DGLTGLSKAEER
Sbjct  13   PNDNPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPIHIIIIPKVRDGLTGLSKAEER  72

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK++AKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  73   HVEILGSLLYVAKVIAKQEGL-EDGYRIVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  129



>ref|XP_009104008.1| PREDICTED: LOW QUALITY PROTEIN: 14 kDa zinc-binding protein-like 
[Brassica rapa]
Length=175

 Score =   191 bits (486),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            SDSPTIFDKII++EIP ++VYEDD+VLAFRDI P+ P HIL+IPKVKDGLTGLSKAEERH
Sbjct  60   SDSPTIFDKIISREIPHHVVYEDDKVLAFRDIRPQGPIHILVIPKVKDGLTGLSKAEERH  119

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILGRLLY AK+VAKQEGLD+ GFR+VINDG  G Q V+HIH+H+IGGRQ+NWPPG
Sbjct  120  IDILGRLLYVAKIVAKQEGLDD-GFRIVINDGPQGCQAVYHIHVHVIGGRQMNWPPG  175



>ref|XP_010673252.1| PREDICTED: 14 kDa zinc-binding protein-like [Beta vulgaris subsp. 
vulgaris]
Length=184

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -1

Query  539  LLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L     PSDSPTIFDKI++KEIPAN+VYED++VLAFRDI+P+AP HIL+IPKVKDGL+ L
Sbjct  62   LAAASTPSDSPTIFDKILSKEIPANVVYEDEKVLAFRDINPQAPVHILIIPKVKDGLSRL  121

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN  180
            +KAEERH +ILGRLLYTAK++AKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+ 
Sbjct  122  AKAEERHFDILGRLLYTAKVIAKQEGL-EDGYRIVINDGPKGCQSVYHIHVHLLGGRQME  180

Query  179  WPPG  168
            WP G
Sbjct  181  WPAG  184



>ref|XP_009406827.1| PREDICTED: 14 kDa zinc-binding protein-like [Musa acuminata subsp. 
malaccensis]
Length=125

 Score =   189 bits (480),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKII KEIP+ +VYEDD+VLAFRDI P+APTHIL+IPKVKDGL+GLSKAEERH EIL
Sbjct  14   TIFDKIIKKEIPSTVVYEDDKVLAFRDIAPQAPTHILIIPKVKDGLSGLSKAEERHVEIL  73

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLY AKLVAKQEGL  +GFR+VINDG D GQ+V+H+H+HL+GGRQ+NWPPG
Sbjct  74   GYLLYIAKLVAKQEGLG-DGFRIVINDGNDAGQSVYHLHVHLLGGRQMNWPPG  125



>ref|XP_010554736.1| PREDICTED: 14 kDa zinc-binding protein-like [Tarenaya hassleriana]
Length=146

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSD  TIFDKIINKEIP+ +VYEDD+V AFRDI P+AP HI++IP VKDGL+GLSKAEER
Sbjct  31   PSDF-TIFDKIINKEIPSTVVYEDDKVFAFRDIQPQAPVHIVIIPIVKDGLSGLSKAEER  89

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILGRLLYTAKL+AKQEGLD +GFR+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  90   HIDILGRLLYTAKLIAKQEGLD-DGFRIVINDGPKGCQSVYHIHVHLLGGRQMNWPPG  146



>ref|XP_006836159.1| hypothetical protein AMTR_s00101p00042720 [Amborella trichopoda]
 gb|ERM99012.1| hypothetical protein AMTR_s00101p00042720 [Amborella trichopoda]
Length=154

 Score =   188 bits (477),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P D+PTIFDKI+ KEIP+  VYEDD+V AFRD+ P+APTHIL+IPKVKDGL GLSKAE R
Sbjct  38   PDDAPTIFDKILKKEIPSTAVYEDDKVYAFRDVSPQAPTHILIIPKVKDGLLGLSKAEVR  97

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLYTAK++AKQEGLD +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  98   HIEILGHLLYTAKVIAKQEGLD-DGFRIVINDGPAGCQSVYHLHIHLLGGRQMNWPPG  154



>ref|XP_011079134.1| PREDICTED: 14 kDa zinc-binding protein-like isoform X2 [Sesamum 
indicum]
Length=125

 Score =   187 bits (474),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKIINKEIPANIVYEDD+VLAFRDI P+AP H+++IPKV DGLTG+SKAEE+H EILGR
Sbjct  16   FDKIINKEIPANIVYEDDKVLAFRDIAPQAPVHVVIIPKVTDGLTGISKAEEKHTEILGR  75

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLYT+KLVAKQEGL E+GFRLVINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  76   LLYTSKLVAKQEGL-EDGFRLVINDGPKGCQSVYHLHIHLLGGRQMNWPPG  125



>sp|P42855.1|ZB14_BRAJU RecName: Full=14 kDa zinc-binding protein; AltName: Full=Protein 
kinase C inhibitor; Short=PKCI, partial [Brassica juncea]
 gb|AAA18397.1| putative protein kinase C inhibitor, partial [Brassica juncea]
Length=113

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGL KAEERH +IL
Sbjct  2    TIFGKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLFKAEERHIDIL  61

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            GRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct  62   GRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG  113



>ref|XP_004970323.1| PREDICTED: 14 kDa zinc-binding protein-like [Setaria italica]
Length=165

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 1/118 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            P D PTIFDKII KEIP+ +VYED +VLAFRDI P+AP HI++IPKVKDGL+ LSKAEER
Sbjct  49   PVDGPTIFDKIIRKEIPSQVVYEDQKVLAFRDISPQAPIHIIIIPKVKDGLSRLSKAEER  108

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H EILG LLY AK+VAKQEGL  +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  109  HIEILGSLLYAAKVVAKQEGLG-DGFRIVINDGLKGCQSVYHLHVHLLGGRQMNWPPG  165



>gb|ABK23114.1| unknown [Picea sitchensis]
Length=130

 Score =   182 bits (462),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKI+ KEIP+ +VYED++VLAFRDI P+APTHI++IPKV+DGLTGLS+AEERH +I
Sbjct  18   PTIFDKILQKEIPSTVVYEDEKVLAFRDIAPQAPTHIIIIPKVRDGLTGLSQAEERHEDI  77

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLYTAK++AKQEGL  +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  78   LGHLLYTAKVIAKQEGL-SDGFRIVINDGPSGCQSVYHLHIHLLGGRQMNWPPG  130



>gb|ABK26444.1| unknown [Picea sitchensis]
 gb|ABR18192.1| unknown [Picea sitchensis]
 gb|ACN40035.1| unknown [Picea sitchensis]
Length=159

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKI+ KEIP+ +VYED++VLAFRDI P+APTHI++IPKV+DGLTGLS+AEERH +I
Sbjct  47   PTIFDKILQKEIPSTVVYEDEKVLAFRDIAPQAPTHIIIIPKVRDGLTGLSQAEERHEDI  106

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLYTAK++AKQEGL  +GFR+VINDG  G Q+V+H+H+HL+GGRQ+NWPPG
Sbjct  107  LGHLLYTAKVIAKQEGL-SDGFRIVINDGPSGCQSVYHLHIHLLGGRQMNWPPG  159



>ref|XP_006858221.1| hypothetical protein AMTR_s00062p00187560 [Amborella trichopoda]
 gb|ERN19688.1| hypothetical protein AMTR_s00062p00187560 [Amborella trichopoda]
Length=186

 Score =   181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP+ IVYED++VLAFRD++P+AP HILLIPK +DGLT LSKAE RH EI
Sbjct  74   PTIFDKIIAKEIPSTIVYEDEKVLAFRDVNPQAPVHILLIPKARDGLTQLSKAEFRHSEI  133

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLYTAKLVA++EGL ++GFR+VINDG DG Q+V+H+HLHL+GGRQL WPPG
Sbjct  134  LGDLLYTAKLVAEKEGL-KDGFRVVINDGLDGCQSVYHLHLHLLGGRQLKWPPG  186



>gb|KHN05234.1| 14 kDa zinc-binding protein [Glycine soja]
Length=178

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            F S++PTIFDKIINKEIP++IVYED++VLAFRDI+P+AP H+L+IPK++DGLT L KA+ 
Sbjct  61   FDSEAPTIFDKIINKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKLRDGLTQLGKADS  120

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            RH EILG+LLY AK+VA++EG+D+ GFR+VIN+G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  121  RHGEILGQLLYAAKIVAEKEGIDD-GFRVVINNGPSACQSVYHLHLHVLGGRQMNWPPG  178



>ref|NP_001238173.1| uncharacterized protein LOC100500187 [Glycine max]
 gb|ACU15152.1| unknown [Glycine max]
Length=178

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            F S++PTIFDKIINKEIP++IVYED++VLAFRDI+P+AP H+L+IPK++DGLT L KA+ 
Sbjct  61   FDSEAPTIFDKIINKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKLRDGLTQLGKADS  120

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            RH EILG+LLY AK+VA++EG+D+ GFR+VIN+G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  121  RHGEILGQLLYAAKIVAEKEGIDD-GFRVVINNGPSACQSVYHLHLHVLGGRQMNWPPG  178



>gb|KDO57337.1| hypothetical protein CISIN_1g031773mg [Citrus sinensis]
Length=153

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 1/98 (1%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKIINKEIP+ +VYEDD+VLAFRDIDP+APTHIL+IPKVKDGLTGLSKAEER
Sbjct  37   PSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEER  96

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQ  228
            HCEILGRLLYTAKLVAKQEGL E+GFR+VINDG +GG 
Sbjct  97   HCEILGRLLYTAKLVAKQEGL-EDGFRIVINDGPNGGH  133



>ref|XP_002986197.1| hypothetical protein SELMODRAFT_446557 [Selaginella moellendorffii]
 gb|EFJ12728.1| hypothetical protein SELMODRAFT_446557 [Selaginella moellendorffii]
Length=141

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S SPTIFDKII KEIP+ IVYEDD+VLAFRDI+P+APTHIL+IPK +DGLT LSKAEERH
Sbjct  26   SGSPTIFDKIIAKEIPSKIVYEDDKVLAFRDINPQAPTHILIIPKHRDGLTQLSKAEERH  85

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG LLY + +VAK+E LD +G+R+VINDG  G Q+V+H+H+HL+GGRQ+ WPPG
Sbjct  86   KEILGELLYASTVVAKKEKLD-DGYRIVINDGPQGCQSVYHLHIHLVGGRQMKWPPG  141



>gb|EEE55566.1| hypothetical protein OsJ_03841 [Oryza sativa Japonica Group]
Length=195

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 15/132 (11%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDD--------------QVLAFRDIDPKAPTHILLIPK  384
            PSD PTIFDKI+ KEIP+ +VYED+              Q LAFRDI P+AP HI++IPK
Sbjct  65   PSDGPTIFDKILRKEIPSQVVYEDEKFAFQNRGLKGGAVQTLAFRDISPQAPVHIIIIPK  124

Query  383  VKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLH  204
            VKDGL+ LSKAEERH E++G LLY AK +AKQE LD +GFR+VINDG +G Q+V+H+H+H
Sbjct  125  VKDGLSRLSKAEERHVEVMGHLLYAAKTIAKQENLD-DGFRIVINDGPNGCQSVYHLHIH  183

Query  203  LIGGRQLNWPPG  168
            L+GGRQ+NWPPG
Sbjct  184  LLGGRQMNWPPG  195



>ref|XP_002458664.1| hypothetical protein SORBIDRAFT_03g037730 [Sorghum bicolor]
 gb|EES03784.1| hypothetical protein SORBIDRAFT_03g037730 [Sorghum bicolor]
Length=164

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = -1

Query  539  LLETPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL  360
            L   P  + +PTIFDKII KEIP+ +VYED++VL+FRD+ P+APTHI++I KV DGL+ L
Sbjct  41   LAAEPIATGTPTIFDKIIRKEIPSQVVYEDEKVLSFRDVSPQAPTHIIIIAKVNDGLSRL  100

Query  359  SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFH-IHLHLIGGRQL  183
            SKAEERH E+LG LLY AK+VAKQEGLD +GFR+VINDG  G Q V+H +H+HL+GGRQ+
Sbjct  101  SKAEERHVEVLGSLLYAAKIVAKQEGLD-DGFRIVINDGPKGTQWVYHHLHVHLLGGRQM  159

Query  182  NWPPG  168
            NWPPG
Sbjct  160  NWPPG  164



>ref|XP_008459016.1| PREDICTED: 14 kDa zinc-binding protein isoform X1 [Cucumis melo]
Length=184

 Score =   177 bits (448),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII+KEIP+NIVYEDD+VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH EI
Sbjct  72   PTIFDKIISKEIPSNIVYEDDKVLAFRDINPQAPVHVLIIPKLRDGLTELGKAEARHGEI  131

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LGRLLY AK+VA++EG+ E GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  132  LGRLLYAAKIVAEKEGIVE-GFRVVINSGASACQSVYHLHLHVLGGRQMKWPPG  184



>ref|XP_008459017.1| PREDICTED: 14 kDa zinc-binding protein isoform X2 [Cucumis melo]
Length=183

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII+KEIP+NIVYEDD+VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH EI
Sbjct  71   PTIFDKIISKEIPSNIVYEDDKVLAFRDINPQAPVHVLIIPKLRDGLTELGKAEARHGEI  130

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LGRLLY AK+VA++EG+ E GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  131  LGRLLYAAKIVAEKEGIVE-GFRVVINSGASACQSVYHLHLHVLGGRQMKWPPG  183



>ref|XP_007138824.1| hypothetical protein PHAVU_009G240300g [Phaseolus vulgaris]
 gb|ESW10818.1| hypothetical protein PHAVU_009G240300g [Phaseolus vulgaris]
Length=178

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            F S++PTIFDKIINKEIP++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L KA+ 
Sbjct  61   FDSEAPTIFDKIINKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKFRDGLTQLGKADS  120

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            RH EILG+LLY AK+VA++EG+ + GFR+VIN+G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  121  RHGEILGQLLYAAKIVAEKEGIVD-GFRVVINNGPSACQSVYHLHLHVLGGRQMNWPPG  178



>ref|XP_002985009.1| hypothetical protein SELMODRAFT_121527 [Selaginella moellendorffii]
 gb|EFJ13884.1| hypothetical protein SELMODRAFT_121527 [Selaginella moellendorffii]
Length=141

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S SPTIFDKII K IP+ IVYEDD+VLAFRD++P+APTHIL+IPK +DGLT LSKAEERH
Sbjct  26   SGSPTIFDKIIAKVIPSKIVYEDDKVLAFRDLNPQAPTHILIIPKHRDGLTQLSKAEERH  85

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG LLY + +VAK+E LD +G+R+VINDG  G Q+V+H+H+HL+GGRQ+ WPPG
Sbjct  86   KEILGELLYASTVVAKKEKLD-DGYRIVINDGPQGCQSVYHLHIHLVGGRQMKWPPG  141



>gb|EYU18944.1| hypothetical protein MIMGU_mgv1a020861mg, partial [Erythranthe 
guttata]
Length=139

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            +PTIFDKII+KEIPANIVYED+ VLAFRDI PKAP H+L+IPK +DGLT L KAE+RH E
Sbjct  26   APTIFDKIISKEIPANIVYEDEAVLAFRDISPKAPVHVLVIPKSRDGLTELGKAEKRHEE  85

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ILGRLLY A +VA++EG+ E GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  86   ILGRLLYAANIVAEKEGITE-GFRVVINSGPSACQSVYHLHLHVLGGRQMKWPPG  139



>ref|XP_002437422.1| hypothetical protein SORBIDRAFT_10g026700 [Sorghum bicolor]
 gb|EER88789.1| hypothetical protein SORBIDRAFT_10g026700 [Sorghum bicolor]
Length=178

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +  PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPKV+DGLTGL KAE RH
Sbjct  63   TGGPTIFDKIIAKEIPSSIVYEDENVLAFRDINPQAPVHVLVIPKVRDGLTGLDKAEPRH  122

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++EG+  NG+R+VIN+G +G Q+V+H+HLH++GGRQ+ WPPG
Sbjct  123  TEILGQLLYAAKVVAEKEGV-ANGYRVVINNGAEGCQSVYHLHLHVLGGRQMKWPPG  178



>ref|XP_004145437.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus]
 ref|XP_004167574.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus]
 gb|KGN66862.1| hypothetical protein Csa_1G701380 [Cucumis sativus]
Length=183

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII+KEIP+NIVYEDD+VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH EI
Sbjct  71   PTIFDKIISKEIPSNIVYEDDKVLAFRDINPQAPVHVLIIPKLRDGLTELGKAEARHGEI  130

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG+LLY AK+VA++EG+ E GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  131  LGQLLYAAKIVAEKEGIVE-GFRVVINSGASACQSVYHLHLHVLGGRQMKWPPG  183



>ref|NP_001152228.1| LOC100285866 [Zea mays]
 gb|ACG46495.1| zinc-binding protein [Zea mays]
 gb|AFW76075.1| zinc-binding protein [Zea mays]
Length=179

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK +DGLTGL KAE RH EI
Sbjct  67   PTIFDKIIAKEIPSSIVYEDENVLAFRDINPQAPVHVLVIPKARDGLTGLDKAEPRHTEI  126

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LGRLLY AK+VA++EG+  +G+R+VIN+G +G Q+V+H+HLH++GGRQ+ WPPG
Sbjct  127  LGRLLYAAKVVAEKEGV-ASGYRVVINNGAEGCQSVYHLHLHVLGGRQMKWPPG  179



>ref|XP_003607898.1| 14 kDa zinc-binding protein [Medicago truncatula]
 gb|ABC75370.1| Histidine triad (HIT) protein [Medicago truncatula]
 gb|AES90095.1| scavenger mRNA decapping enzyme carboxy-term-binding protein 
[Medicago truncatula]
 gb|AFK47061.1| unknown [Medicago truncatula]
Length=182

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKIINKEIP++IVYED++VLAFRDI P+AP H+L+IPK +DGLT L KA+ RH
Sbjct  67   SGAPTIFDKIINKEIPSSIVYEDEKVLAFRDISPQAPVHVLVIPKFRDGLTELGKADARH  126

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  127  GEILGQLLYAAKIVAEKEGI-ADGFRVVINSGASACQSVYHLHLHVLGGRQMNWPPG  182



>ref|XP_004293768.1| PREDICTED: 14 kDa zinc-binding protein [Fragaria vesca subsp. 
vesca]
Length=181

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKII KEIP++IVYEDD+VLAFRDI+P+AP H+++IPK +DGLT L+KAE RH
Sbjct  66   SGAPTIFDKIIAKEIPSSIVYEDDKVLAFRDINPQAPVHVVIIPKNRDGLTELAKAESRH  125

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK VA++EG+  +GFR+VIN+G +G Q+V+H+HLHL+GGRQ+ WPPG
Sbjct  126  VEILGQLLYAAKKVAEKEGI-LDGFRVVINNGPEGCQSVYHLHLHLLGGRQMKWPPG  181



>ref|XP_003560429.1| PREDICTED: 14 kDa zinc-binding protein isoform X2 [Brachypodium 
distachyon]
Length=178

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +  PTIFDKII K+IP+NIVYED++VLAFRDI+P+AP H+L+IPK++DGLTGL KAE RH
Sbjct  63   TGGPTIFDKIIAKQIPSNIVYEDEKVLAFRDINPQAPVHVLVIPKLRDGLTGLDKAEPRH  122

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++EG+  +GFR+VIN+G++G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  123  AEILGQLLYAAKVVAEKEGV-ADGFRVVINNGEEGCQSVYHLHVHVLGGRQMKWPPG  178



>ref|XP_008603825.1| hit-like protein [Saprolegnia diclina VS20]
 gb|EQC42402.1| hit-like protein [Saprolegnia diclina VS20]
Length=156

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIINKEIPANI++E+D+VLAFRDI P+APTH+L+IPKV+ GLT L +AEE H EIL
Sbjct  45   TIFDKIINKEIPANIIFENDKVLAFRDISPQAPTHVLVIPKVRAGLTRLIRAEESHKEIL  104

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLYTA +VA+ E L E+G+R+VINDGK+G Q+V+H+HLH+IGGR L WPPG
Sbjct  105  GELLYTASVVARNENL-EDGYRIVINDGKNGCQSVYHLHLHIIGGRPLGWPPG  156



>gb|KDO29861.1| hypothetical protein SPRG_04934 [Saprolegnia parasitica CBS 223.65]
Length=156

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIINKEIPANI++E+D+VLAFRDI P+APTH+L+IPKV+ GLT L +AEE H EIL
Sbjct  45   TIFDKIINKEIPANIIFENDKVLAFRDISPQAPTHVLVIPKVRAGLTRLIRAEESHKEIL  104

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLYTA +VA+ E L E+G+R+VINDGK+G Q+V+H+HLH+IGGR L WPPG
Sbjct  105  GELLYTASVVARNENL-EDGYRIVINDGKNGCQSVYHLHLHIIGGRPLGWPPG  156



>ref|XP_004966317.1| PREDICTED: 14 kDa zinc-binding protein-like [Setaria italica]
Length=178

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            ++ PTIFDKII KEIP++IVYEDD+VLAFRDI+P+AP H+L+IPKV+DGLTGLSKAE RH
Sbjct  63   TEGPTIFDKIIAKEIPSSIVYEDDKVLAFRDINPQAPVHVLVIPKVRDGLTGLSKAEPRH  122

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LL   K+VA++EGL  NG+R+VIN+G +G Q+V+H+HLH++GGRQ+ WP G
Sbjct  123  VEILGQLLCAVKVVAEKEGL-ANGYRVVINNGPEGCQSVYHLHLHVLGGRQMKWPAG  178



>ref|XP_010240546.1| PREDICTED: 14 kDa zinc-binding protein isoform X1 [Brachypodium 
distachyon]
Length=198

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +  PTIFDKII K+IP+NIVYED++VLAFRDI+P+AP H+L+IPK++DGLTGL KAE RH
Sbjct  83   TGGPTIFDKIIAKQIPSNIVYEDEKVLAFRDINPQAPVHVLVIPKLRDGLTGLDKAEPRH  142

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++EG+  +GFR+VIN+G++G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  143  AEILGQLLYAAKVVAEKEGV-ADGFRVVINNGEEGCQSVYHLHVHVLGGRQMKWPPG  198



>ref|XP_008890341.1| hypothetical protein PPTG_00663 [Phytophthora parasitica INRA-310]
 gb|ETN24260.1| hypothetical protein PPTG_00663 [Phytophthora parasitica INRA-310]
Length=163

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIIN +IPA I YED+Q LAF D++P+AP HILLIPK +DGLT LS AEERH  IL
Sbjct  52   TIFDKIINGQIPAKIAYEDEQCLAFHDVNPQAPVHILLIPKKRDGLTQLSHAEERHEAIL  111

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLY AKLVAKQ+ LD+ GFR+VINDG+DG Q+VFH+HLHL+GGR+L WPPG
Sbjct  112  GHLLYAAKLVAKQQNLDK-GFRMVINDGEDGCQSVFHLHLHLLGGRKLGWPPG  163



>gb|ABK21571.1| unknown [Picea sitchensis]
Length=188

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIPA IVYED +VLAFRDI+P+AP HILLIPK++DGLT LSKAE RH
Sbjct  73   TGAPTIFDKIIKKEIPATIVYEDAKVLAFRDINPQAPVHILLIPKIRDGLTQLSKAEPRH  132

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG +LYTAK+VA+ EG+ E G+R+VIN+G    Q+V+H+HLH+IGGRQ+ WP G
Sbjct  133  AEILGHMLYTAKVVAEGEGISE-GYRIVINNGPSACQSVYHLHLHIIGGRQMKWPAG  188



>gb|ETI56792.1| hypothetical protein F443_00793 [Phytophthora parasitica P1569]
 gb|ETK96577.1| hypothetical protein L915_00732 [Phytophthora parasitica]
 gb|ETL49935.1| hypothetical protein L916_00728 [Phytophthora parasitica]
 gb|ETM03011.1| hypothetical protein L917_00690 [Phytophthora parasitica]
 gb|ETM56261.1| hypothetical protein L914_00718 [Phytophthora parasitica]
 gb|ETO85521.1| hypothetical protein F444_00794 [Phytophthora parasitica P1976]
 gb|ETP26574.1| hypothetical protein F441_00776 [Phytophthora parasitica CJ01A1]
 gb|ETP54575.1| hypothetical protein F442_00742 [Phytophthora parasitica P10297]
Length=163

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIIN +IPA I YED+Q LAF D++P+AP HILLIPK +DGLT LS AEERH  IL
Sbjct  52   TIFDKIINGQIPAKIAYEDEQCLAFHDVNPQAPVHILLIPKKRDGLTQLSHAEERHEAIL  111

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLY AKLVAKQ+ LD+ GFR+VINDG+DG Q+VFH+HLHL+GGR+L WPPG
Sbjct  112  GHLLYAAKLVAKQQNLDK-GFRIVINDGEDGCQSVFHLHLHLLGGRKLGWPPG  163



>gb|EMT11377.1| 14 kDa zinc-binding protein [Aegilops tauschii]
Length=178

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK++DGLTGL KAE RH EI
Sbjct  66   PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKLRDGLTGLDKAEPRHAEI  125

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG+LLY AK+VA++EG+  +GFR+VIN+G +G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  126  LGQLLYAAKVVAEKEGV-ADGFRVVINNGAEGCQSVYHLHVHVLGGRQMKWPPG  178



>ref|XP_009523292.1| hypothetical protein PHYSODRAFT_492857 [Phytophthora sojae]
 gb|EGZ20575.1| hypothetical protein PHYSODRAFT_492857 [Phytophthora sojae]
Length=135

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIIN++IPA I YED+Q LAF D++P+AP HIL+IPK +DGLT L+ AEERH  +L
Sbjct  24   TIFDKIINRQIPAKIAYEDEQCLAFHDVNPQAPVHILVIPKKRDGLTQLAHAEERHVAVL  83

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLY AKLVAKQ+ LD+ GFR+VINDG+DG Q+VFH+HLH++GGR+L+WPPG
Sbjct  84   GHLLYAAKLVAKQQNLDK-GFRIVINDGEDGCQSVFHLHLHVLGGRKLDWPPG  135



>ref|XP_004505299.1| PREDICTED: 14 kDa zinc-binding protein-like isoform X2 [Cicer 
arietinum]
Length=181

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKIINKEIP++IVYED++VLAFRDI P+AP H+L+IPK +DGLT L KA+ RH
Sbjct  66   SGAPTIFDKIINKEIPSSIVYEDEKVLAFRDISPQAPVHVLVIPKFRDGLTELGKADARH  125

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++EG+  +GFR+V+N G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  126  EEILGQLLYAAKIVAEKEGI-LDGFRVVVNSGASACQSVYHLHLHVLGGRQMNWPPG  181



>ref|XP_006657234.1| PREDICTED: 14 kDa zinc-binding protein-like [Oryza brachyantha]
Length=179

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP+N+VYED++VLAFRDI+P+AP H+L+IPKV+DGLTGL KAE RH EI
Sbjct  67   PTIFDKIIAKEIPSNVVYEDEKVLAFRDINPQAPVHVLVIPKVRDGLTGLDKAEPRHVEI  126

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLY AK+VA++EG+ E G+R+VIN+G  G Q+V+H+HLH++GGRQ+ WP G
Sbjct  127  LGYLLYAAKIVAEKEGIAE-GYRVVINNGPKGCQSVYHLHLHVLGGRQMTWPAG  179



>dbj|BAJ99076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK++DGLTGL KAE RH +I
Sbjct  66   PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKLRDGLTGLDKAEPRHADI  125

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG+LLY AK+VA++EG+  +GFR+VIN+G +G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  126  LGQLLYAAKVVAEKEGV-ADGFRVVINNGAEGCQSVYHLHVHVLGGRQMKWPPG  178



>ref|XP_010058024.1| PREDICTED: 14 kDa zinc-binding protein isoform X2 [Eucalyptus 
grandis]
 gb|KCW75492.1| hypothetical protein EUGRSUZ_E04251 [Eucalyptus grandis]
Length=185

 Score =   171 bits (432),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP+ IVYED++VLAFRDI P+AP H+L+IPK +DGLT L KAEE+H
Sbjct  70   TGAPTIFDKIIAKEIPSTIVYEDEKVLAFRDISPEAPVHVLVIPKFRDGLTQLGKAEEKH  129

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILGRLLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  130  SEILGRLLYAAKVVAEKEGI-LDGFRVVINSGPSACQSVYHLHLHVLGGRQMKWPPG  185



>gb|KDP43155.1| hypothetical protein JCGZ_00088 [Jatropha curcas]
Length=185

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYEDD+VLAFRDI+P+AP H+L+IPK++DGLT LSKAE RH EI
Sbjct  73   PTIFDKIITKEIPSSIVYEDDKVLAFRDINPQAPVHVLVIPKIRDGLTQLSKAEARHGEI  132

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLY AK+VA++EG+  +GFR+VIN+G    Q+V+H+HLH++GGRQ+ WP G
Sbjct  133  LGYLLYAAKIVAEKEGI-LDGFRVVINNGPSACQSVYHLHLHVLGGRQMTWPAG  185



>ref|XP_010538299.1| PREDICTED: 14 kDa zinc-binding protein isoform X1 [Tarenaya hassleriana]
Length=185

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPKV+DGLT L KAE RH
Sbjct  70   TGAPTIFDKIIAKEIPSSIVYEDENVLAFRDINPQAPVHVLVIPKVRDGLTTLGKAEPRH  129

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LL+ AK+VA++EG+  +GFR+VIN+G +  Q+VFH+HLH++GGRQ+ WPPG
Sbjct  130  AEILGQLLHAAKIVAEKEGI-LDGFRVVINNGTEACQSVFHLHLHVLGGRQMKWPPG  185



>ref|XP_004505298.1| PREDICTED: 14 kDa zinc-binding protein-like isoform X1 [Cicer 
arietinum]
Length=185

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKIINKEIP++IVYED++VLAFRDI P+AP H+L+IPK +DGLT L KA+ RH
Sbjct  70   SGAPTIFDKIINKEIPSSIVYEDEKVLAFRDISPQAPVHVLVIPKFRDGLTELGKADARH  129

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++EG+  +GFR+V+N G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  130  EEILGQLLYAAKIVAEKEGI-LDGFRVVVNSGASACQSVYHLHLHVLGGRQMNWPPG  185



>gb|EEC81142.1| hypothetical protein OsI_24044 [Oryza sativa Indica Group]
 gb|EEE66184.1| hypothetical protein OsJ_22295 [Oryza sativa Japonica Group]
Length=176

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +  PTIFDKII KEIP+N+VYED++VLAFRDI+P+AP H+L+IPK++DGLTGL KAE RH
Sbjct  61   TGGPTIFDKIIAKEIPSNVVYEDEKVLAFRDINPQAPVHVLVIPKIRDGLTGLDKAEPRH  120

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG LLY AK+VA++EG+ E G+R+VIN+G  G Q+V+H+HLH++GGRQ+ WP G
Sbjct  121  VEILGYLLYAAKIVAEKEGIAE-GYRVVINNGPKGCQSVYHLHLHVLGGRQMKWPAG  176



>ref|XP_009408259.1| PREDICTED: 14 kDa zinc-binding protein [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP+ IVYEDD+VLAFRD++P+AP HIL+IPK++DGLT L KAE RH
Sbjct  72   TGAPTIFDKIIAKEIPSTIVYEDDKVLAFRDVNPQAPVHILVIPKIRDGLTQLGKAEPRH  131

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG LL+ AKLVA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQL WPPG
Sbjct  132  AEVLGHLLFAAKLVAEKEGI-VDGFRVVINNGPEACQSVYHLHLHVLGGRQLKWPPG  187



>ref|XP_002276515.1| PREDICTED: 14 kDa zinc-binding protein isoform X1 [Vitis vinifera]
Length=200

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKII KEIP+ IVYED++VLAFRD++P+AP H+L+IPK++DGLT L KAE RH
Sbjct  85   SGAPTIFDKIIAKEIPSTIVYEDEKVLAFRDVNPQAPVHVLVIPKLRDGLTQLGKAEVRH  144

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG+LLY A+LVA++EG+  +GFR+VIN G D  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  145  EQILGQLLYAARLVAEKEGV-LDGFRVVINSGPDACQSVYHLHLHVLGGRQMKWPPG  200



>emb|CBI27186.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKII KEIP+ IVYED++VLAFRD++P+AP H+L+IPK++DGLT L KAE RH
Sbjct  77   SGAPTIFDKIIAKEIPSTIVYEDEKVLAFRDVNPQAPVHVLVIPKLRDGLTQLGKAEVRH  136

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG+LLY A+LVA++EG+  +GFR+VIN G D  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  137  EQILGQLLYAARLVAEKEGV-LDGFRVVINSGPDACQSVYHLHLHVLGGRQMKWPPG  192



>ref|XP_001770419.1| predicted protein [Physcomitrella patens]
 gb|EDQ64756.1| predicted protein [Physcomitrella patens]
Length=137

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKII+KEIP+ IVYEDD VLAFRD+ P+ P HI+LIPK +DGLT LSKAE+RH +IL
Sbjct  26   TIFDKIISKEIPSKIVYEDDDVLAFRDVSPQGPVHIILIPKDRDGLTQLSKAEDRHEKIL  85

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+ TA  VA+QE LD+ GFRLV+NDG DG Q+V+HIHLHLIGGRQ+ WPPG
Sbjct  86   GHLMVTAAKVARQEKLDK-GFRLVVNDGPDGCQSVYHIHLHLIGGRQMKWPPG  137



>ref|XP_008798226.1| PREDICTED: 14 kDa zinc-binding protein [Phoenix dactylifera]
Length=185

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII +EIP+ I+YEDD+VLAFRDI+P+AP H+LLIPK +DGLT L KAE RH EI
Sbjct  73   PTIFDKIIAREIPSTIIYEDDKVLAFRDINPQAPVHVLLIPKFRDGLTQLGKAESRHAEI  132

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLY AK+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  133  LGHLLYAAKVVAEKEGI-VDGFRVVINNGPEACQSVYHLHLHILGGRQMKWPPG  185



>ref|XP_009102671.1| PREDICTED: 14 kDa zinc-binding protein-like [Brassica rapa]
Length=183

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH
Sbjct  68   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTTLGKAEPRH  127

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +G Q+V+H+HLH++GGRQ+ WPPG
Sbjct  128  IEVLGQLLHASKIVAEKEGI-VDGFRVVINNGAEGCQSVYHLHLHVLGGRQMKWPPG  183



>emb|CDX77556.1| BnaA07g06940D [Brassica napus]
Length=183

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKI+ KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH
Sbjct  68   TGAPTIFDKIVAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTTLGKAEPRH  127

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +G Q+V+H+HLH++GGRQ+ WPPG
Sbjct  128  TEVLGQLLHASKIVAEKEGI-VDGFRVVINNGAEGCQSVYHLHLHVLGGRQMKWPPG  183



>ref|XP_011085155.1| PREDICTED: 14 kDa zinc-binding protein [Sesamum indicum]
Length=186

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKII+KEIP+ IVYED+ VLAFRDI P+AP H+L+IPK++DGLT L KAE+RH
Sbjct  71   SGAPTIFDKIISKEIPSTIVYEDEAVLAFRDISPQAPVHVLVIPKLRDGLTELGKAEKRH  130

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILGRLLY AK+VA++EG+  +GFR+V+N G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  131  EEILGRLLYAAKIVAEKEGII-DGFRVVVNSGPSACQSVYHLHLHVLGGRQMKWPPG  186



>emb|CDX98244.1| BnaC07g08540D [Brassica napus]
Length=183

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH
Sbjct  68   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTTLGKAEPRH  127

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +G Q+V+H+HLH++GGRQ+ WPPG
Sbjct  128  IEVLGQLLHASKIVAEKEGI-VDGFRVVINNGAEGCQSVYHLHLHVLGGRQMKWPPG  183



>ref|XP_009782765.1| PREDICTED: 14 kDa zinc-binding protein, partial [Nicotiana sylvestris]
Length=146

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            +PTIFDKII KEIPA++VYED++VLAFRDI+P+AP H+L+IPK +DGLT L KAE+RH +
Sbjct  33   APTIFDKIIAKEIPASVVYEDEKVLAFRDINPQAPVHVLVIPKSRDGLTELGKAEQRHED  92

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ILG LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQL WPPG
Sbjct  93   ILGHLLYAAKIVAEKEGI-VDGFRVVINSGASACQSVYHLHLHVLGGRQLKWPPG  146



>gb|EYU29000.1| hypothetical protein MIMGU_mgv1a014698mg [Erythranthe guttata]
Length=181

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII+KEIPANIVYED+ VLAFRD  PKAP H+L+IPK +DGLT L KAE+RH
Sbjct  66   TGAPTIFDKIISKEIPANIVYEDEAVLAFRDKSPKAPVHVLVIPKSRDGLTELGKAEKRH  125

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG LLY A +VA++EG+ E GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  126  EEILGHLLYAANIVAEKEGITE-GFRVVINSGPSACQSVYHLHLHVLGGRQMKWPPG  181



>ref|XP_001773357.1| predicted protein [Physcomitrella patens]
 gb|EDQ61895.1| predicted protein, partial [Physcomitrella patens]
Length=124

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKI+ +EIPA +VYE+ +VLAFRDI+P+AP H++LIPK +DGLT LSKA ER+
Sbjct  9    AGAPTIFDKIVKREIPATVVYENVKVLAFRDINPQAPVHVVLIPKERDGLTQLSKASERN  68

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             ++LG LL+ AK+VA+QEGL E GFR+VINDG  G Q+V+H+HLHL+GGRQL WPPG
Sbjct  69   KDVLGELLFAAKVVAEQEGLVE-GFRVVINDGPQGCQSVYHLHLHLLGGRQLKWPPG  124



>ref|XP_009826163.1| hypothetical protein H257_03668 [Aphanomyces astaci]
 gb|ETV84471.1| hypothetical protein H257_03668 [Aphanomyces astaci]
Length=153

 Score =   167 bits (423),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PT+FDKII++EIP+ +V+E+D+VLAFRDI P+AP H++L+PKV+DGLT ++ AEERH EI
Sbjct  41   PTLFDKIISREIPSTVVFENDKVLAFRDISPQAPVHVILVPKVRDGLTRIANAEERHKEI  100

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLYTA +VAK E LDE G+R+VINDG  G Q+V+H+HLH++GGR L+WPPG
Sbjct  101  LGELLYTASVVAKNEQLDE-GYRIVINDGPRGLQSVYHLHLHILGGRTLSWPPG  153



>ref|XP_008870916.1| hypothetical protein H310_07318 [Aphanomyces invadans]
 gb|ETW00781.1| hypothetical protein H310_07318 [Aphanomyces invadans]
Length=152

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
             PTIFDKII +EIPA++V+E+D+VLAFRDI P+AP H+++IPKV+DGLT ++ AEERH E
Sbjct  39   EPTIFDKIIRREIPASVVFENDKVLAFRDIAPQAPVHVIVIPKVRDGLTRIANAEERHKE  98

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ILG LLY+A +VAK E LDE G+R+VINDG  G Q+V+H+HLH++GGR L+WPPG
Sbjct  99   ILGELLYSASVVAKNEQLDE-GYRIVINDGPRGLQSVYHLHLHILGGRTLSWPPG  152



>ref|XP_009606620.1| PREDICTED: 14 kDa zinc-binding protein [Nicotiana tomentosiformis]
Length=182

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIPA++VYED++VLAFRDI+P+AP H+L+IPK +DGLT L KAE+RH
Sbjct  67   TGAPTIFDKIIAKEIPASVVYEDEKVLAFRDINPQAPIHVLVIPKSRDGLTELGKAEQRH  126

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQL WPPG
Sbjct  127  EDILGHLLYAAKIVAEKEGI-VDGFRVVINSGASACQSVYHLHLHVLGGRQLKWPPG  182



>gb|KJB47944.1| hypothetical protein B456_008G048400 [Gossypium raimondii]
 gb|KJB47945.1| hypothetical protein B456_008G048400 [Gossypium raimondii]
Length=192

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            +PTIFDKII KEIP+ IVYEDD+VLAF+DI P+AP H+L+IPK +DGLT L KAE+RH E
Sbjct  79   APTIFDKIIAKEIPSTIVYEDDKVLAFKDISPQAPVHVLVIPKFRDGLTQLGKAEQRHGE  138

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ILG+LLY A++VA++EG+  +GFR+VIN+G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  139  ILGQLLYAARIVAEKEGI-LDGFRVVINNGPSACQSVYHLHLHVLGGRQMKWPPG  192



>ref|XP_004233245.1| PREDICTED: 14 kDa zinc-binding protein isoform X2 [Solanum lycopersicum]
Length=180

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIPA++VYED +VLAFRDI+P+AP H+L+IPK +DGLT L KAE+RH
Sbjct  65   TGAPTIFDKIIAKEIPASVVYEDQKVLAFRDINPQAPVHVLIIPKSRDGLTELGKAEQRH  124

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQL WPPG
Sbjct  125  EDILGNLLYAAKIVAEKEGI-VDGFRVVINSGPSACQSVYHLHLHVLGGRQLKWPPG  180



>emb|CDP11254.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTI+DKII KEIP+ IVYEDD+VLAFRDI+P+AP H+L+IPK +DGLT L KAE+RH EI
Sbjct  73   PTIYDKIIAKEIPSTIVYEDDKVLAFRDINPQAPVHVLVIPKSRDGLTQLGKAEKRHGEI  132

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  133  LGELLYAAKIVAEKEGI-VDGFRVVINSGPTACQSVYHLHLHVLGGRQMAWPPG  185



>ref|XP_007041080.1| Histidine triad nucleotide-binding 2, 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007041081.1| Histidine triad nucleotide-binding 2, 2 isoform 1 [Theobroma 
cacao]
 gb|EOX96911.1| Histidine triad nucleotide-binding 2, 2 isoform 1 [Theobroma 
cacao]
 gb|EOX96912.1| Histidine triad nucleotide-binding 2, 2 isoform 1 [Theobroma 
cacao]
Length=192

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S  PTIFDKII KEIP+ IVYEDD+VLAF+DI+P+AP H+L+IPK +DGLT L KAE RH
Sbjct  77   SGVPTIFDKIIAKEIPSTIVYEDDKVLAFKDINPQAPVHVLVIPKFRDGLTQLGKAEPRH  136

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LLY AK+VA++ G+  +GFR+VIN+G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  137  GEILGQLLYAAKIVAEKGGI-VDGFRVVINNGPSACQSVYHLHLHVLGGRQMNWPPG  192



>gb|KEH30829.1| scavenger mRNA decapping enzyme carboxy-term-binding protein 
[Medicago truncatula]
Length=190

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 9/125 (7%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSK-----  354
            S +PTIFDKIINKEIP++IVYED++VLAFRDI P+AP H+L+IPK +DGLT L K     
Sbjct  67   SGAPTIFDKIINKEIPSSIVYEDEKVLAFRDISPQAPVHVLVIPKFRDGLTELGKVANHL  126

Query  353  ---AEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL  183
               A+ RH EILG+LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQ+
Sbjct  127  VLYADARHGEILGQLLYAAKIVAEKEGI-ADGFRVVINSGASACQSVYHLHLHVLGGRQM  185

Query  182  NWPPG  168
            NWPPG
Sbjct  186  NWPPG  190



>ref|XP_002504781.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66039.1| predicted protein [Micromonas sp. RCC299]
Length=120

 Score =   164 bits (415),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S  PTIFDKII KEIP++++YED+  LAFRDI P+A TH L+IPK++ GLT LSKAEE H
Sbjct  4    SGEPTIFDKIIAKEIPSDVIYEDNLCLAFRDIAPQAKTHFLVIPKIRSGLTQLSKAEEGH  63

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG LLYTA+ VAKQE LD+ GFR+VINDG +G Q+V+H+H+H++GG+QL+WPPG
Sbjct  64   KELLGHLLYTAQKVAKQEKLDK-GFRVVINDGVEGCQSVYHLHIHVVGGQQLSWPPG  119



>ref|XP_002895257.1| 14 kDa zinc-binding protein [Phytophthora infestans T30-4]
 gb|EEY59043.1| 14 kDa zinc-binding protein [Phytophthora infestans T30-4]
Length=135

 Score =   164 bits (416),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKIIN +IP  I YED+Q LAF D++P+AP HILLIPK +DGLT L+ AEERH  IL
Sbjct  24   TIFDKIINGQIPTKIAYEDEQCLAFHDVNPQAPVHILLIPKKRDGLTQLAHAEERHESIL  83

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LLYTAK VA Q+ LD+ GFR+VINDG DG Q+VFH+HLHL+GGR+L WPPG
Sbjct  84   GHLLYTAKQVANQQNLDK-GFRIVINDGADGCQSVFHLHLHLLGGRKLGWPPG  135



>ref|XP_006365044.1| PREDICTED: 14 kDa zinc-binding protein-like [Solanum tuberosum]
Length=230

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIPA++VYED +VLAFRDI+P+AP H+L+IPK +DGLT L KAE+RH
Sbjct  115  TGAPTIFDKIIAKEIPASVVYEDQKVLAFRDINPQAPVHVLIIPKSRDGLTELGKAEQRH  174

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG LLY AK+VA++EG+ + GFR+VIN G    Q+V+H+HLH++GGRQL WPPG
Sbjct  175  EDILGNLLYAAKIVAEKEGIVD-GFRVVINSGPSACQSVYHLHLHVLGGRQLKWPPG  230



>gb|KFK44923.1| hypothetical protein AALP_AA1G320200 [Arabis alpina]
Length=186

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH
Sbjct  71   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTTLGKAEPRH  130

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQL WPPG
Sbjct  131  VEVLGQLLHASKIVAEKEGI-LDGFRVVINNGAEACQSVYHLHLHVLGGRQLKWPPG  186



>ref|NP_174401.1| histidine triad nucleotide-binding 2 protein [Arabidopsis thaliana]
 dbj|BAC42230.1| putative protein kinase C inhibitor [Arabidopsis thaliana]
 gb|AAO50640.1| putative protein kinase C inhibitor (Zinc-binding protein) [Arabidopsis 
thaliana]
 gb|AEE31319.1| histidine triad nucleotide-binding 2 protein [Arabidopsis thaliana]
Length=187

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH
Sbjct  72   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTSLGKAEPRH  131

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  132  VEVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHLHVLGGRQMKWPPG  187



>ref|XP_005851832.1| hypothetical protein CHLNCDRAFT_133322 [Chlorella variabilis]
 gb|EFN59730.1| hypothetical protein CHLNCDRAFT_133322 [Chlorella variabilis]
Length=132

 Score =   164 bits (415),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII K+IPA I+YED+Q LAFRDI P+ P H L+IPKV++GLT LSKA+E H
Sbjct  17   TGAPTIFDKIIAKQIPAQIIYEDEQALAFRDISPQGPVHFLVIPKVRNGLTQLSKAKEEH  76

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG LLY A  VAKQEGL + G+R+ INDG +G Q+V+H+HLH+IGGRQ++WPPG
Sbjct  77   KPLLGHLLYVAAQVAKQEGLSQ-GYRVAINDGPNGCQSVYHLHLHIIGGRQMSWPPG  132



>ref|XP_011000172.1| PREDICTED: 14 kDa zinc-binding protein isoform X1 [Populus euphratica]
Length=185

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L KAE RH E+
Sbjct  73   PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKARDGLTTLGKAEARHGEV  132

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG+LLY A++VA++EG+  +GFR+VIN+G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  133  LGQLLYAARIVAEKEGI-LDGFRVVINNGPGACQSVYHLHLHVLGGRQMKWPPG  185



>ref|XP_002321820.2| zinc-binding family protein [Populus trichocarpa]
 gb|EEF05947.2| zinc-binding family protein [Populus trichocarpa]
Length=185

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L KAE RH E+
Sbjct  73   PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKARDGLTTLGKAEARHGEV  132

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG+LLY A++VA++EG+  +GFR+VIN+G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  133  LGQLLYAARIVAEKEGI-LDGFRVVINNGPGACQSVYHLHLHVLGGRQMKWPPG  185



>ref|XP_010941662.1| PREDICTED: 14 kDa zinc-binding protein [Elaeis guineensis]
Length=205

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP+ IVYEDD+VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH EI
Sbjct  93   PTIFDKIIAKEIPSTIVYEDDKVLAFRDINPQAPVHVLVIPKLRDGLTHLGKAELRHAEI  152

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LL  AK+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  153  LGHLLCAAKIVAEKEGI-VDGFRVVINNGPEACQSVYHLHLHILGGRQMKWPPG  205



>ref|XP_006305672.1| hypothetical protein CARUB_v10010389mg [Capsella rubella]
 gb|EOA38570.1| hypothetical protein CARUB_v10010389mg [Capsella rubella]
Length=186

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT LS AE RH
Sbjct  71   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTMLSNAEPRH  130

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             ++LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  131  VDVLGKLLHASKIVAEKEGI-LDGFRVVINNGAEACQSVYHLHLHVLGGRQMKWPPG  186



>ref|XP_006468491.1| PREDICTED: 14 kDa zinc-binding protein-like isoform X1 [Citrus 
sinensis]
 gb|KDO77356.1| hypothetical protein CISIN_1g029617mg [Citrus sinensis]
Length=190

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S++PTIFDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L+KAE RH
Sbjct  75   SEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARH  134

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG LL  +K+VA++EG+ + GFR+VIN+G    Q+V+H+HLH++GGRQL WPPG
Sbjct  135  GDILGHLLCASKIVAEKEGILD-GFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG  190



>ref|XP_007212586.1| hypothetical protein PRUPE_ppa015962mg, partial [Prunus persica]
 gb|EMJ13785.1| hypothetical protein PRUPE_ppa015962mg, partial [Prunus persica]
Length=170

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S +PTIFDKII KEIP++IVYEDD+VLAFRDI+P+AP H+L+IPK +DGLT L KAE RH
Sbjct  55   SGAPTIFDKIIAKEIPSSIVYEDDKVLAFRDINPQAPVHVLVIPKFRDGLTELRKAELRH  114

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LL+ AK+VA+ EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WP G
Sbjct  115  VEILGQLLHAAKIVAEIEGI-LDGFRVVINNGPEACQSVYHLHLHVLGGRQMKWPAG  170



>emb|CDW80129.1| histidine triad nucleotide-binding protein 1 [Stylonychia lemnae]
Length=130

 Score =   162 bits (410),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKII KEIPANI+YEDDQ LAFRD++P APTH L+IPK + GLTGL +A + H  IL
Sbjct  18   TIFDKIIRKEIPANIIYEDDQALAFRDVNPVAPTHFLVIPKERKGLTGLRRAVKSHTNIL  77

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL  A  VA QE LDE G+R++INDGK GGQ+V+H+HLH+IGG+QL+WPPG
Sbjct  78   GHLLLIASQVAIQEKLDE-GYRVIINDGKHGGQSVYHLHLHVIGGKQLSWPPG  129



>gb|EPS72246.1| hypothetical protein M569_02515 [Genlisea aurea]
Length=170

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +++ TIFDKII KEIP+ +VYEDD VLAFRDI P+AP H+L+IPK +DGLT L KA +RH
Sbjct  55   TETRTIFDKIIAKEIPSTVVYEDDAVLAFRDISPQAPVHVLVIPKSRDGLTELGKAGKRH  114

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILGRLL+ AK+VA++EG+ E GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  115  EEILGRLLHAAKMVAEKEGILE-GFRVVINSGPSACQSVYHLHLHVLGGRQMKWPPG  170



>ref|XP_010109839.1| hypothetical protein L484_018496 [Morus notabilis]
 gb|EXC24782.1| hypothetical protein L484_018496 [Morus notabilis]
Length=176

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIPA+IVYED++VLAFRDI P+AP H+L+IPK++DGLT L KAE  H
Sbjct  61   TGAPTIFDKIIAKEIPASIVYEDEKVLAFRDITPQAPVHVLVIPKLRDGLTQLGKAEPGH  120

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             EILG+LL+ AKLVA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  121  VEILGQLLHAAKLVAEKEGI-LDGFRVVINSGPSACQSVYHLHLHVLGGRQMKWPPG  176



>ref|XP_006415364.1| hypothetical protein EUTSA_v10009998mg [Eutrema salsugineum]
 gb|ESQ33717.1| hypothetical protein EUTSA_v10009998mg [Eutrema salsugineum]
Length=187

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE +H
Sbjct  72   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTMLGKAEPKH  131

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  132  VEVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHLHVLGGRQMKWPPG  187



>ref|XP_008674914.1| PREDICTED: 14 kDa zinc-binding protein-like [Zea mays]
 gb|ACN31037.1| unknown [Zea mays]
Length=162

 Score =   162 bits (411),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 100/119 (84%), Gaps = 3/119 (3%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP+ +VYED++VLA RDI P+APTHI++I KVK GL+ LSKAEE H
Sbjct  45   NSTPTIFDKIIRKEIPSEVVYEDEKVLACRDISPQAPTHIIIIAKVKYGLSRLSKAEEGH  104

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVF--HIHLHLIGGRQLNWPPG  168
             E+LG LLY AK+VA+QEGL  +GFR+V++DG  G Q+V+  H+H+HL+GGRQ+NWPPG
Sbjct  105  VELLGNLLYAAKVVAEQEGL-ADGFRIVMDDGPRGSQSVYHRHLHVHLLGGRQMNWPPG  162



>ref|XP_002891131.1| hypothetical protein ARALYDRAFT_336541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67390.1| hypothetical protein ARALYDRAFT_336541 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L  AE RH
Sbjct  70   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTTLGNAEPRH  129

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  130  VEVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHLHVLGGRQMKWPPG  185



>ref|XP_002971357.1| hypothetical protein SELMODRAFT_95126, partial [Selaginella moellendorffii]
 gb|EFJ27955.1| hypothetical protein SELMODRAFT_95126, partial [Selaginella moellendorffii]
Length=110

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKI++KEIP+ IVYEDD+ LAFRDI+P+AP H++LIPK++DGLT LSKAEE+H ++LG 
Sbjct  1    FDKILSKEIPSTIVYEDDKALAFRDINPQAPVHVVLIPKIRDGLTQLSKAEEKHKDVLGH  60

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLY AKL+ ++EGL  +G+R+VINDG  G Q+V+H+HLH++GGRQL WPPG
Sbjct  61   LLYVAKLIGEKEGLG-DGYRVVINDGPLGCQSVYHLHLHILGGRQLKWPPG  110



>ref|XP_008225838.1| PREDICTED: 14 kDa zinc-binding protein [Prunus mume]
Length=181

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYEDD+VLAFRDI+P+AP H+L+IPK +DGLT L KAE RH EI
Sbjct  69   PTIFDKIIAKEIPSSIVYEDDKVLAFRDINPQAPVHVLVIPKFRDGLTELRKAELRHVEI  128

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG+LL+ AK+VA  EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WP G
Sbjct  129  LGQLLHAAKIVADIEGI-LDGFRVVINNGPEACQSVYHLHLHVLGGRQMKWPAG  181



>ref|XP_010317037.1| PREDICTED: 14 kDa zinc-binding protein isoform X1 [Solanum lycopersicum]
Length=181

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 2/118 (2%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL-SKAEER  342
            + +PTIFDKII KEIPA++VYED +VLAFRDI+P+AP H+L+IPK +DGLT L  KAE+R
Sbjct  65   TGAPTIFDKIIAKEIPASVVYEDQKVLAFRDINPQAPVHVLIIPKSRDGLTELGKKAEQR  124

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H +ILG LLY AK+VA++EG+  +GFR+VIN G    Q+V+H+HLH++GGRQL WPPG
Sbjct  125  HEDILGNLLYAAKIVAEKEGI-VDGFRVVINSGPSACQSVYHLHLHVLGGRQLKWPPG  181



>emb|CCI50621.1| unnamed protein product [Albugo candida]
Length=137

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            S TIFDKII KEIPA IV+EDDQ LAF D+ P+AP HIL+IPK  DGL+ LS AEERH  
Sbjct  24   SVTIFDKIIRKEIPAKIVFEDDQCLAFHDVHPQAPVHILIIPKDSDGLSQLSAAEERHKP  83

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ILG L+Y A+ VA+ +GL  NGFR+VINDG DG Q+V+H+H+HL+GGR+L WPPG
Sbjct  84   ILGHLMYIARKVAQDQGL-ANGFRIVINDGPDGCQSVYHLHIHLLGGRKLGWPPG  137



>ref|XP_002961455.1| hypothetical protein SELMODRAFT_76264, partial [Selaginella moellendorffii]
 gb|EFJ36715.1| hypothetical protein SELMODRAFT_76264, partial [Selaginella moellendorffii]
Length=110

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKI++KEIP+ IVYED++ LAFRDI+P+AP H++LIPK++DGLT LSKAEE+H ++LG 
Sbjct  1    FDKILSKEIPSTIVYEDEKALAFRDINPQAPVHVVLIPKIRDGLTQLSKAEEKHKDVLGH  60

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLY AKL+ ++EGL  +G+R+VINDG  G Q+V+H+HLH++GGRQL WPPG
Sbjct  61   LLYVAKLIGEKEGLG-DGYRVVINDGPLGCQSVYHLHLHILGGRQLKWPPG  110



>ref|XP_007041082.1| Histidine triad nucleotide-binding 2, 2 isoform 3 [Theobroma 
cacao]
 gb|EOX96913.1| Histidine triad nucleotide-binding 2, 2 isoform 3 [Theobroma 
cacao]
Length=163

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKII KEIP+ IVYEDD+VLAF+DI+P+AP H+L+IPK +DGLT L KAE RH EILG+
Sbjct  54   FDKIIAKEIPSTIVYEDDKVLAFKDINPQAPVHVLVIPKFRDGLTQLGKAEPRHGEILGQ  113

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLY AK+VA++ G+  +GFR+VIN+G    Q+V+H+HLH++GGRQ+NWPPG
Sbjct  114  LLYAAKIVAEKGGI-VDGFRVVINNGPSACQSVYHLHLHVLGGRQMNWPPG  163



>ref|XP_006448694.1| hypothetical protein CICLE_v10016837mg [Citrus clementina]
 gb|ESR61934.1| hypothetical protein CICLE_v10016837mg [Citrus clementina]
Length=190

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S++PTIFDKII KEI ++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L+KAE RH
Sbjct  75   SEAPTIFDKIIAKEILSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARH  134

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             +ILG LL  +K+VA++EG+ + GFR+VIN+G    Q+V+H+HLH++GGRQL WPPG
Sbjct  135  GDILGHLLCASKIVAEKEGILD-GFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG  190



>gb|EWM29206.1| protein kinase c binding protein [Nannochloropsis gaditana]
Length=182

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PT+FDKI+ KEIP+N +YEDD  +AF D+ P+ P H L+IPK + GL+ LSKAEE H  +
Sbjct  69   PTVFDKIVKKEIPSNFIYEDDDCVAFHDLSPQGPVHFLVIPKDRAGLSRLSKAEESHKAL  128

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLY A+ VAKQEGL   GFR+VINDG DG Q+V+H+H+H+IGGRQ+ WPPG
Sbjct  129  LGHLLYVAQQVAKQEGLVPGGFRVVINDGPDGSQSVYHLHIHVIGGRQMGWPPG  182



>ref|XP_005648829.1| HIT-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24285.1| HIT-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=181

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII+K+IPANI+YED+  LAFRDI+P+AP H L+IPK +DGLT LSK  + H ++
Sbjct  69   PTIFDKIISKQIPANIIYEDESALAFRDINPQAPVHFLVIPKHRDGLTQLSKCNDSHEKV  128

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LL  A  VA QEGL++ GFR+VINDG +G Q+V+H+HLH++GGRQL WPPG
Sbjct  129  LGHLLVVASKVALQEGLND-GFRVVINDGVNGCQSVYHLHLHIVGGRQLTWPPG  181



>ref|XP_010260601.1| PREDICTED: 14 kDa zinc-binding protein [Nelumbo nucifera]
Length=196

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIFDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK ++GLT LSKAE +H EI
Sbjct  84   PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKFRNGLTQLSKAEPKHTEI  143

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LL+ AK+VA++EG+ +  FR+VIN+G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  144  LGHLLHAAKVVAEKEGIMDR-FRVVINNGPGACQSVYHLHLHVLGGRQMKWPPG  196



>gb|EAS04975.3| scavenger mRNA decapping enzyme carboxy-term-binding protein 
[Tetrahymena thermophila SB210]
Length=167

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKII KEIPA IVYEDD+ LAF+D+ P+AP HILLIPKVKDGLT L KAEERH +IL
Sbjct  43   TIFDKIIKKEIPAQIVYEDDKCLAFKDVSPQAPVHILLIPKVKDGLTQLQKAEERHKDIL  102

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG*LDLSNC  147
            G L+     +A+Q  L E G+R+VINDGK G Q+V+H+HLH++GG Q+ WPPG L  S  
Sbjct  103  GHLMLKVAEIAQQNNLQE-GYRVVINDGKLGCQSVYHLHLHILGGTQMGWPPGVLGKSET  161

Query  146  RDP  138
              P
Sbjct  162  IKP  164



>ref|XP_003081421.1| ZB14_MAIZE 14 kDa zinc-binding protein (ISS) [Ostreococcus tauri]
 emb|CAL55590.1| Histidine triad (HIT) protein [Ostreococcus tauri]
Length=139

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S+  TIFDKI++KEIPA ++YED   LAFRDI+P+A TH L+IPK++ GLT LSK+ E H
Sbjct  23   SEERTIFDKIVSKEIPATVIYEDSLALAFRDINPQAKTHFLVIPKIRAGLTRLSKSTEDH  82

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG L+YTA LVAKQE LD  G+R+V+NDG +G Q+V+H+HLH++GG+QL+WPPG
Sbjct  83   KALLGHLMYTAALVAKQEKLDA-GYRVVVNDGVEGCQSVYHLHLHVLGGQQLSWPPG  138



>ref|XP_011000173.1| PREDICTED: 14 kDa zinc-binding protein isoform X2 [Populus euphratica]
Length=156

 Score =   159 bits (403),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L KAE RH E+LG+
Sbjct  47   FDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKARDGLTTLGKAEARHGEVLGQ  106

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLY A++VA++EG+ + GFR+VIN+G    Q+V+H+HLH++GGRQ+ WPPG
Sbjct  107  LLYAARIVAEKEGILD-GFRVVINNGPGACQSVYHLHLHVLGGRQMKWPPG  156



>ref|XP_010460911.1| PREDICTED: 14 kDa zinc-binding protein-like [Camelina sativa]
Length=187

 Score =   160 bits (405),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFR+I+P+AP H+L+IPK++DGLT L  AE RH
Sbjct  72   TGAPTIFDKIIAKEIPSDIVYEDENVLAFREINPQAPVHVLVIPKLRDGLTMLGNAEPRH  131

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             ++LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQL WPPG
Sbjct  132  VDVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHLHVLGGRQLKWPPG  187



>ref|XP_007510684.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18217.1| predicted protein [Bathycoccus prasinos]
Length=140

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S  PTIFDKI++KEIPA ++YED+  +AF+D++P A TH L+IPK+K GL+ LSKA E H
Sbjct  24   STEPTIFDKIVSKEIPATVLYEDNLAMAFKDVNPVAKTHFLVIPKIKAGLSQLSKANEDH  83

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG  +Y A++VAKQE L E GFR+VINDG DG Q+V+H+HLH+IGG+QL+WPPG
Sbjct  84   KMLLGHCMYVAQMVAKQEKL-EKGFRVVINDGVDGCQSVYHLHLHVIGGQQLSWPPG  139



>ref|XP_010499667.1| PREDICTED: 14 kDa zinc-binding protein-like [Camelina sativa]
Length=206

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRD +P+AP H+L+IPK +DGLT L  AE RH
Sbjct  91   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDTNPQAPVHVLVIPKFRDGLTMLGNAEPRH  150

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             ++LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQL WPPG
Sbjct  151  VDVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHLHVVGGRQLKWPPG  206



>ref|XP_010478560.1| PREDICTED: 14 kDa zinc-binding protein [Camelina sativa]
Length=187

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFD II KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L  AE RH
Sbjct  72   TRAPTIFDMIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTMLGNAEPRH  131

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
             ++LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HLH++GGRQ+ WPPG
Sbjct  132  VDVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHLHVLGGRQMKWPPG  187



>ref|XP_003060821.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55590.1| predicted protein [Micromonas pusilla CCMP1545]
Length=121

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            S  PTIFDKI+ KEIPA ++YED+  LAFRD+ P+A TH L+IPK++ GLT LS AEE H
Sbjct  4    SGEPTIFDKIVAKEIPATVIYEDNLCLAFRDVAPQAKTHFLVIPKIRAGLTRLSNAEEEH  63

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG LL+TA+ VAK EGL E GFR+VINDG  G Q+V+H+HLH++GG+QL WPPG
Sbjct  64   KALLGHLLFTAQRVAKDEGLGE-GFRVVINDGVQGCQSVYHLHLHVLGGQQLTWPPG  119



>ref|XP_001419867.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98160.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=138

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +D  TIFDKI+ KEIPA I+YED   +AFRD++P+A TH L+IPK++ GLT LSKA E H
Sbjct  22   ADERTIFDKIVAKEIPATILYEDALAMAFRDVNPQAKTHFLVIPKIRAGLTRLSKATEEH  81

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG L+YTA +VAKQE LD  G+R VINDG +G Q+V+H+H+H+IGG+QL+WPPG
Sbjct  82   KTLLGHLMYTASVVAKQENLDA-GYRCVINDGVEGCQSVYHLHVHVIGGQQLSWPPG  137



>ref|XP_001696200.1| protein kinase C binding protein [Chlamydomonas reinhardtii]
 gb|EDP08177.1| protein kinase C binding protein [Chlamydomonas reinhardtii]
Length=132

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            ++ PTIFDKI++KEIPANI+YEDD+ LAFRDI P+AP H L+IPK ++GLT LSKA   H
Sbjct  17   TEPPTIFDKIVSKEIPANIIYEDDEALAFRDIQPQAPVHFLVIPKKRNGLTRLSKASPEH  76

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG L++ A+ VA +E L + GFR+V+NDG +G Q+V+H+HLH++GGRQL WPPG
Sbjct  77   KALLGHLMWVAQHVAMKENLGD-GFRVVVNDGPNGCQSVYHLHLHIMGGRQLTWPPG  132



>ref|XP_002961475.1| hypothetical protein SELMODRAFT_77650 [Selaginella moellendorffii]
 gb|EFJ36735.1| hypothetical protein SELMODRAFT_77650 [Selaginella moellendorffii]
Length=119

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKI++KEI A IVYEDD+ LAFRDI+P+AP H++LIPK +DGLT L+ AE+RH EILG 
Sbjct  10   FDKILSKEINATIVYEDDKALAFRDIEPQAPVHVILIPKQRDGLTRLANAEKRHREILGH  69

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLY AK + +QE L E G+R+VINDG  G Q+ +H+HLH++GGRQ+ WPPG
Sbjct  70   LLYVAKKIGEQEKLQE-GYRVVINDGPKGCQSTYHLHLHIMGGRQMKWPPG  119



>emb|CCA14803.1| 14 kDa zincbinding protein putative [Albugo laibachii Nc14]
Length=179

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKII KEIPA I +ED+  LAF D+ P+AP HIL+IPK  DGL+ LS AEERH  IL
Sbjct  68   TIFDKIIRKEIPAKIAFEDEMCLAFHDVQPQAPVHILIIPKNSDGLSQLSAAEERHKPIL  127

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+Y A+ VA+ +GL  NGFR+VINDG DG Q+V+H+H+HL+GGR+L WPPG
Sbjct  128  GHLMYVARKVAQDQGL-ANGFRIVINDGPDGCQSVYHLHIHLLGGRKLGWPPG  179



>tpg|DAA45133.1| TPA: protein kinase inhibitor1 [Zea mays]
Length=102

 Score =   154 bits (388),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -1

Query  446  QVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENG  267
            QVLAFRDI+P+APTHIL+IPKVKDGLTGL+KAEERH EILG LLY AK+VAKQEGL E+G
Sbjct  11   QVLAFRDINPQAPTHILIIPKVKDGLTGLAKAEERHIEILGYLLYVAKVVAKQEGL-EDG  69

Query  266  FRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct  70   YRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG  102



>ref|XP_006468492.1| PREDICTED: 14 kDa zinc-binding protein-like isoform X2 [Citrus 
sinensis]
Length=161

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKII KEIP++IVYED++VLAFRDI+P+AP H+L+IPK +DGLT L+KAE RH +ILG 
Sbjct  52   FDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGH  111

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LL  +K+VA++EG+ + GFR+VIN+G    Q+V+H+HLH++GGRQL WPPG
Sbjct  112  LLCASKIVAEKEGILD-GFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG  161



>ref|XP_002971332.1| hypothetical protein SELMODRAFT_94999 [Selaginella moellendorffii]
 gb|EFJ27930.1| hypothetical protein SELMODRAFT_94999 [Selaginella moellendorffii]
Length=119

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -1

Query  500  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR  321
            FDKI++KEI A IVYEDD+ LAFRDI+P+AP H++LIPK +DGLT L+ AE+RH +ILG 
Sbjct  10   FDKILSKEINATIVYEDDKALAFRDIEPQAPVHVILIPKQRDGLTRLANAEKRHRDILGH  69

Query  320  LLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LLY AK + +QE L E G+R+VINDG  G Q+ +H+HLH++GGRQ+ WPPG
Sbjct  70   LLYVAKKIGEQEKLQE-GYRVVINDGPKGCQSTYHLHLHIMGGRQMKWPPG  119



>ref|XP_009347648.1| PREDICTED: LOW QUALITY PROTEIN: 14 kDa zinc-binding protein-like 
[Pyrus x bretschneideri]
 ref|XP_009347651.1| PREDICTED: LOW QUALITY PROTEIN: 14 kDa zinc-binding protein-like 
[Pyrus x bretschneideri]
Length=161

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 4/120 (3%)
 Frame = -1

Query  521  PSDSPTIFDKIIN--KEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAE  348
            PSD+P     I    K +   I+Y    VLAFRDI P+APTHIL+ PKV+DGLTGLSKAE
Sbjct  44   PSDAPLCLVIIFXDXKMLNXRILYLV-LVLAFRDISPQAPTHILIFPKVRDGLTGLSKAE  102

Query  347  ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ERH EILG+LLY AKL+A QEGLD +GFR+VINDG +G Q V+H+H+HL+GGRQ+NWPPG
Sbjct  103  ERHTEILGQLLYAAKLIATQEGLD-DGFRIVINDGPNGCQLVYHLHIHLLGGRQMNWPPG  161



>gb|AAD21696.1| Similar to gb|Z29643 protein kinase C inhibitor (PKCI) from Zea 
mays and a member of HIT family PF|01230 [Arabidopsis thaliana]
Length=214

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 28/144 (19%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IPK++DGLT L KAE RH
Sbjct  72   TGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTSLGKAEPRH  131

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDG-------------------------  234
             E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +                          
Sbjct  132  VEVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACKSFLFFSIQLSIIVLIHMTELTSS  190

Query  233  --GQTVFHIHLHLIGGRQLNWPPG  168
              GQ+V+H+HLH++GGRQ+ WPPG
Sbjct  191  HSGQSVYHLHLHVLGGRQMKWPPG  214



>emb|CBN74620.1| conserved unknown protein [Ectocarpus siliculosus]
Length=205

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKII+KEIPA+I++ED+  LAF DI P+AP H L+IPK +DGLT LSKA + +  +L
Sbjct  94   TIFDKIISKEIPADIIHEDELCLAFNDISPQAPVHFLVIPKSRDGLTQLSKAVDSNKALL  153

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L++ A+ VAK++GLDE GFR+V+NDG  G QTV+H+H+H+IGGRQL WPPG
Sbjct  154  GHLMFVAQKVAKEQGLDE-GFRVVVNDGVQGCQTVYHLHIHVIGGRQLKWPPG  205



>ref|XP_011400956.1| 14 kDa zinc-binding protein [Auxenochlorella protothecoides]
 gb|KFM27949.1| 14 kDa zinc-binding protein [Auxenochlorella protothecoides]
Length=133

 Score =   151 bits (381),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
             PTIFDKI+ KEIPA I+YEDDQ LAFRD+ P+AP H L+IPKV DGL+ LSKA E    
Sbjct  21   QPTIFDKIVAKEIPAKIIYEDDQALAFRDVSPQAPIHFLVIPKVVDGLSQLSKAREDQKA  80

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG L + A  V  +E     GFR+V+NDGKDG Q+V+H+HLH+IGGRQL WPPG
Sbjct  81   LLGHLFWVAGQVGTKEC--PGGFRVVVNDGKDGCQSVYHLHLHVIGGRQLAWPPG  133



>gb|EMT02405.1| 14 kDa zinc-binding protein [Aegilops tauschii]
Length=319

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -1

Query  530  TPFPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKA  351
             P P+D+PTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHI++IPKVKDGLTGLSKA
Sbjct  10   APVPNDNPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHIVIIPKVKDGLTGLSKA  69

Query  350  EERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDG  234
            EERH EILG LLY AK++AKQEGL E+G+R+VINDG  G
Sbjct  70   EERHVEILGCLLYAAKVIAKQEGL-EDGYRIVINDGPSG  107



>ref|XP_002945873.1| hypothetical protein VOLCADRAFT_102824 [Volvox carteri f. nagariensis]
 gb|EFJ52868.1| hypothetical protein VOLCADRAFT_102824 [Volvox carteri f. nagariensis]
Length=173

 Score =   150 bits (378),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKI++KEIPAN++YEDD+ LAFRDI P+AP H L+IPK + GLT LSKA E H  +L
Sbjct  53   TIFDKIVSKEIPANVIYEDDEALAFRDISPQAPVHFLVIPKKRSGLTRLSKATEGHKALL  112

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL  183
            G LLY A+LVA +E L E GFR+VINDG +G Q+V+H+HLH++GGRQ+
Sbjct  113  GHLLYVAQLVAMKENLGE-GFRVVINDGPNGCQSVYHLHLHVMGGRQV  159



>ref|XP_005767128.1| hypothetical protein EMIHUDRAFT_61926 [Emiliania huxleyi CCMP1516]
 gb|EOD14699.1| hypothetical protein EMIHUDRAFT_61926 [Emiliania huxleyi CCMP1516]
Length=183

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            T+FDKI++KEIP+ +V+ED   LAFRDI+P AP HIL+IPK +DGLTGL  A   H  IL
Sbjct  73   TLFDKILSKEIPSEVVFEDALCLAFRDINPVAPAHILIIPKHRDGLTGLGAATAEHSAIL  132

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+  A  +AKQEGL E  FRLV N+G+  GQ+VFH+HLHLIGGR L WPPG
Sbjct  133  GHLMVAAAAIAKQEGLSE--FRLVTNNGEGAGQSVFHLHLHLIGGRPLEWPPG  183



>gb|AGG56522.1| protein kinase c inhibitor [Antheraea yamamai]
Length=128

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KI+ KEIPA  VYEDDQ +AF D++P+APTHIL+IP+    +  LSKA +   ++L
Sbjct  18   TIFGKILRKEIPAKFVYEDDQCVAFHDVNPQAPTHILVIPRKP--IPQLSKAGDEDEQLL  75

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL  A+ VA QEGLD++GFRLVINDGKDG Q+V+H+H+H++GGRQL WPPG
Sbjct  76   GHLLTAARKVAAQEGLDKSGFRLVINDGKDGAQSVYHLHVHVLGGRQLEWPPG  128



>ref|WP_015131209.1| histidine triad (HIT) protein [Calothrix sp. PCC 7507]
 gb|AFY35418.1| histidine triad (HIT) protein [Calothrix sp. PCC 7507]
Length=116

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPA+IVYEDD  LAF+D++P+AP HIL+IPK    +T L++ E +   
Sbjct  5    TETIFSKIIRREIPADIVYEDDLALAFKDVNPQAPVHILVIPK--KPITQLAEVESQDAA  62

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL TAKLVAK+ GL +NG+RLVIN G DGGQTV+H+HLH++GGR L WPPG
Sbjct  63   LLGHLLLTAKLVAKKAGL-QNGYRLVINTGADGGQTVYHLHLHILGGRHLAWPPG  116



>ref|XP_780695.1| PREDICTED: histidine triad nucleotide-binding protein 1-like 
isoform 1 [Strongylocentrotus purpuratus]
Length=134

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIPA+I+YEDD  +AF+D++P AP H L+IPK    ++G+S  E+   +IL
Sbjct  17   TIFGKIIRKEIPADILYEDDTTIAFKDVNPTAPVHFLVIPK--KPISGISAVEKDDVQIL  74

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+YTAK VA+++GL  NG+RLV+NDGKDG Q+V+HIH+H+IGG+QL+WPPG
Sbjct  75   GELMYTAKKVAQEQGL-TNGYRLVVNDGKDGCQSVYHIHIHVIGGKQLSWPPG  126



>ref|XP_010875499.1| PREDICTED: histidine triad nucleotide-binding protein 1-like 
[Esox lucius]
 gb|ACO14175.1| Histidine triad nucleotide-binding protein 2 [Esox lucius]
Length=166

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP+V   +  +S+A++
Sbjct  51   YGSSAPTIFSKVIDKSIPADIIYEDDKCLAFRDISPQAPVHFLVIPRV--AIPRISEAKD  108

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAK+E L  NG+R+VINDGK G Q+V+H+H+H++GGRQLNWPPG
Sbjct  109  DDAELLGHLLVVAKNVAKKERL-HNGYRVVINDGKHGAQSVYHLHIHVLGGRQLNWPPG  166



>gb|EWM29205.1| protein kinase c binding protein [Nannochloropsis gaditana]
Length=217

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PT+FDKI+ KEIP+N +YEDD  +AF D+ P+ P H L+IPK + GL+ LSKAEE H  +
Sbjct  69   PTVFDKIVKKEIPSNFIYEDDDCVAFHDLSPQGPVHFLVIPKDRAGLSRLSKAEESHKAL  128

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LLY A+ VAKQEGL   GFR+VINDG DG Q+V+H+H+H+IGGRQ    P 
Sbjct  129  LGHLLYVAQQVAKQEGLVPGGFRVVINDGPDGSQSVYHLHIHVIGGRQNMCTPA  182



>dbj|BAM18093.1| protein kinase C inhibitor [Papilio xuthus]
Length=127

 Score =   146 bits (368),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KI+ KEIPA  VYEDDQ +AF D++P+APTHIL+IP+    +  LSKA +   ++L
Sbjct  17   TIFGKILRKEIPAKFVYEDDQCVAFHDVNPQAPTHILVIPR--KPIAQLSKASDEDEQLL  74

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+  A+ +A QEGL E+GFR+VINDGK+G Q+V+H+HLH++GGRQ+ WPPG
Sbjct  75   GHLMIAARKIAAQEGLGESGFRIVINDGKNGAQSVYHLHLHILGGRQMRWPPG  127



>ref|XP_001031984.2| HIT domain containing protein [Tetrahymena thermophila]
 gb|EAR84321.2| scavenger mRNA decapping enzyme carboxy-term-binding protein 
[Tetrahymena thermophila SB210]
Length=134

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKI++K+IPA IVYEDD  LAF+DI+P+AP H +LIPK +DGLT LSKAE+RH  +L
Sbjct  7    TIFDKIVSKQIPAKIVYEDDLCLAFKDINPQAPVHFVLIPKNRDGLTQLSKAEDRHKNLL  66

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNW  177
            G L+     +A QE L ++GFR+V+NDG  GGQ+V+HIH+H+ GG QL W
Sbjct  67   GHLMVAVSKIAAQEPLLKDGFRIVVNDGLHGGQSVYHIHIHIFGGAQLTW  116



>ref|WP_035987363.1| zinc-binding protein [Leptolyngbya sp. KIOST-1]
Length=115

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIPANIVYEDD  LAF DI P+APTHIL+IPK    +  L+ A     E+L
Sbjct  5    TIFGKIIRKEIPANIVYEDDLCLAFTDITPQAPTHILVIPK--QPIPKLADATSEDKELL  62

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL+T K +A Q GL ENG+R+VIN G DGGQTV+H+HLHL+GGR L WPPG
Sbjct  63   GHLLFTVKQIADQVGLTENGYRVVINTGDDGGQTVYHLHLHLLGGRSLGWPPG  115



>ref|WP_035472332.1| zinc-binding protein [Gammaproteobacteria bacterium MFB021]
 gb|KFF49542.1| zinc-binding protein [Gammaproteobacteria bacterium MFB021]
Length=114

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
             PT+F KII++EIPA+IVYED+ VLAFRDI+P+APTH+L+IPK    +  L+  EE    
Sbjct  2    EPTLFSKIIDREIPADIVYEDEHVLAFRDINPQAPTHVLIIPK--KPIATLNDIEEADLA  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ++GRL YTA  +AKQ G  E+G+R+V+N  +DGGQ+V+HIH+HL+GGR+L WPPG
Sbjct  60   LIGRLQYTAAKLAKQFGFAEDGYRVVMNCNEDGGQSVYHIHMHLLGGRKLTWPPG  114



>ref|WP_009769297.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ67042.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Oscillatoriales 
cyanobacterium JSC-12]
Length=116

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
              + + TIF KII KEIPA+IVYED+  +AF+D++P+AP HIL+IPK  + +  L+ AE 
Sbjct  1    MSAAAETIFSKIIRKEIPADIVYEDNLAIAFKDVNPQAPVHILVIPK--EPIAKLADAEA  58

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +   ++G LL TAK VA+Q GLD NG+R+VIN G DGGQTV+H+HLH++GGRQ+ WPPG
Sbjct  59   KDHALMGHLLLTAKRVAEQAGLD-NGYRVVINSGADGGQTVYHLHLHILGGRQMQWPPG  116



>ref|XP_010790143.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X3 [Notothenia coriiceps]
Length=173

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI PKAP H L+IP+V   +  +S+A++
Sbjct  58   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPKAPVHFLVIPRVP--IPRISEAKD  115

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+HLH++GGRQL WPPG
Sbjct  116  DDAELLGHLLIVAKTVAKQESLTE-GYRVVINDGKHGAQSVYHLHLHVLGGRQLAWPPG  173



>ref|WP_015190463.1| histidine triad (HIT) protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ32595.1| histidine triad (HIT) protein [Gloeocapsa sp. PCC 7428]
Length=116

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPA+IVYED+  LAF+D++P+AP HIL+IPK  + +  L+ AE +   
Sbjct  5    TETIFSKIIRREIPADIVYEDELALAFKDVNPQAPVHILVIPK--EPIAKLADAESKDHA  62

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ++G LL TAK VA+Q GL ENG+R+VIN G DGGQTV+H+HLH++GGRQ+ WPPG
Sbjct  63   LMGHLLLTAKRVAQQAGL-ENGYRVVINTGSDGGQTVYHLHLHILGGRQMKWPPG  116



>ref|WP_015173203.1| histidine triad (HIT) protein [Geitlerinema sp. PCC 7407]
 gb|AFY67639.1| histidine triad (HIT) protein [Geitlerinema sp. PCC 7407]
Length=113

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            S T+F KI+ +EIPA+I+YED+  LAFRDI+P+AP HIL+IPK  D +  L+  E  +  
Sbjct  2    SDTLFSKIVRREIPADIIYEDNLALAFRDINPQAPVHILVIPK--DPIPTLADTESHNHA  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL T K VA+QEGL ENG+R+VIN G+DGGQTV+H+HLH++GGRQ+ WPPG
Sbjct  60   LLGHLLLTVKRVAEQEGL-ENGYRVVINTGQDGGQTVYHLHLHILGGRQMQWPPG  113



>gb|EJY74625.1| Protein kinase C binding protein [Oxytricha trifallax]
Length=134

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKI  KEIPANI+YEDD  +AFRD+ P  PTH L+IPK ++GL+ L KA + H  +L
Sbjct  22   TIFDKIARKEIPANIIYEDDIAMAFRDVAPITPTHFLVIPKNRNGLSQLRKATKAHIGLL  81

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L++    VA QE L+E G+R+VINDGK G Q+V+H+H+H+IGG+QL+WPPG
Sbjct  82   GHLMWVVGHVAMQENLEE-GYRVVINDGKQGCQSVYHLHIHVIGGKQLSWPPG  133



>ref|WP_027840641.1| zinc-binding protein [Mastigocoleus testarum]
Length=115

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII +EIPANIVYED+  LAF+D++P+AP HIL+IPK    +  L++AE +  EIL
Sbjct  6    TIFGKIIRREIPANIVYEDEFALAFKDVNPQAPVHILVIPK--KPIPKLAEAESQDGEIL  63

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL TAK VA++ GL  NG+RLVIN+G DGGQTV+H+HLH++GGRQ+ WPPG
Sbjct  64   GHLLLTAKKVAQEAGL-ANGYRLVINNGDDGGQTVYHLHLHILGGRQMKWPPG  115



>ref|WP_012596355.1| MULTISPECIES: zinc-binding protein [Cyanothece]
 gb|ACK67094.1| histidine triad (HIT) protein [Cyanothece sp. PCC 8801]
 gb|ACV01853.1| histidine triad (HIT) protein [Cyanothece sp. PCC 8802]
Length=113

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            S TIF KIIN+EIPANIVYEDD  LAF+DI+P+AP HIL+IP  K  +  L    E    
Sbjct  2    SDTIFTKIINREIPANIVYEDDLALAFKDINPQAPVHILVIP--KKPIINLDYGTEEDQT  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL T K VA+QEGLD NG+R+VIN+G +GGQTV+H+HLH++ GRQ+ WPPG
Sbjct  60   LLGHLLLTVKKVAQQEGLD-NGYRVVINNGNEGGQTVYHLHLHILAGRQMTWPPG  113



>ref|XP_005801040.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
[Xiphophorus maculatus]
Length=164

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S  PTIF K+I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP++   + G+S A++
Sbjct  49   YGSPGPTIFSKVIDKSIPADIIYEDDKCLAFRDISPQAPVHFLVIPRIP--IPGISYAKD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLSE-GYRVVINDGKHGSQSVYHLHIHVLGGRQMEWPPG  164



>ref|WP_018121984.1| hypothetical protein [Wohlfahrtiimonas chitiniclastica]
Length=113

 Score =   144 bits (362),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KIINKEIPA IVYEDDQVLAFRDIDPKAP HIL+IPK +  +  ++  +E    ++
Sbjct  3    TIFTKIINKEIPATIVYEDDQVLAFRDIDPKAPEHILVIPKKE--IPTVNDIDEADAALV  60

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G+L   AK +AK+ G  +NG+RLV+N  +DGGQTV HIH+H++ GR+LNWPPG
Sbjct  61   GQLFLAAKKIAKELGFADNGYRLVMNCNEDGGQTVHHIHMHILAGRRLNWPPG  113



>ref|XP_002184361.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44110.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=137

 Score =   144 bits (363),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIFDK+++   P+++VYEDD    FRD++P+AP HIL IPKV+DGLT L  A E   +
Sbjct  25   TETIFDKLLSGAWPSDVVYEDDWAFCFRDVNPQAPVHILCIPKVRDGLTQLVHAREDQKD  84

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LLY AK VA++E  +  G+R+VINDGKDG Q+V+H+HLH++GGRQL WPPG
Sbjct  85   LLGHLLYVAKEVARKECPE--GYRIVINDGKDGAQSVYHLHLHILGGRQLQWPPG  137



>ref|XP_002591273.1| hypothetical protein BRAFLDRAFT_216507 [Branchiostoma floridae]
 gb|EEN47284.1| hypothetical protein BRAFLDRAFT_216507 [Branchiostoma floridae]
Length=127

 Score =   144 bits (362),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIPA+I+YEDDQ LAFRDI+P+AP H L+IPK    +  LSKAE+   ++L
Sbjct  17   TIFGKIIRKEIPADIIYEDDQCLAFRDINPQAPVHFLVIPKKP--IPQLSKAEDGDEQLL  74

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+  A+  AKQ+G+ ++GFR+V+NDG+ G Q+V+H+HLH+ GGR+++WPPG
Sbjct  75   GHLMVVARKCAKQQGIADSGFRMVVNDGRHGAQSVYHVHLHIFGGRKMSWPPG  127



>ref|XP_011416416.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
[Crassostrea gigas]
Length=190

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = -1

Query  509  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI  330
            PTIF KI++K IPA+I+YED+Q LAFRD+ P+AP H L+IP  K  + GLS A+E   ++
Sbjct  80   PTIFSKIVDKSIPADIIYEDEQCLAFRDVSPQAPVHFLVIP--KSPIPGLSDAQEFSKQL  137

Query  329  LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            LG LL TAK VA++E L  NG+RLVIN+G DG Q+V+H+H+H++GGRQ++WPPG
Sbjct  138  LGHLLLTAKRVAEKEDLS-NGYRLVINNGPDGAQSVYHLHIHVLGGRQMSWPPG  190



>ref|WP_008314875.1| Histidine triad nucleotide-binding protein 1 [Wohlfahrtiimonas 
chitiniclastica]
 gb|ELV08914.1| Histidine triad nucleotide-binding protein 1 [Wohlfahrtiimonas 
chitiniclastica SH04]
Length=113

 Score =   143 bits (360),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KIINKEIPA IVYEDDQVLAFRDIDPKAP HIL+IPK +  +  ++  +E    ++
Sbjct  3    TIFTKIINKEIPAAIVYEDDQVLAFRDIDPKAPEHILVIPKKE--IPTVNDIDEADAALV  60

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G+L   AK +AK+ G  +NG+RLV+N  +DGGQTV HIH+H++ GR+LNWPPG
Sbjct  61   GQLFLAAKKIAKELGFADNGYRLVMNCNEDGGQTVHHIHMHILAGRRLNWPPG  113



>ref|XP_010790141.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X1 [Notothenia coriiceps]
Length=219

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI PKAP H L+IP+V   +  +S+A++
Sbjct  104  YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPKAPVHFLVIPRVP--IPRISEAKD  161

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+HLH++GGRQL WPPG
Sbjct  162  DDAELLGHLLIVAKTVAKQESLTE-GYRVVINDGKHGAQSVYHLHLHVLGGRQLAWPPG  219



>ref|XP_001425174.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK57776.1| unnamed protein product [Paramecium tetraurelia]
Length=125

 Score =   143 bits (361),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIFDKI++ +I ANIVY+DD  LAF D++P+AP HILLIPK ++GLT LSKA+E + E+L
Sbjct  6    TIFDKIVSGQIKANIVYQDDLCLAFHDVNPQAPVHILLIPKQRNGLTQLSKAQEHNKEVL  65

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL T   + +     + GFR+VINDG++GGQ+V+H+HLH+IGG QL WPPG
Sbjct  66   GHLLLTVTKIVELVDELKKGFRVVINDGENGGQSVWHLHLHIIGGEQLTWPPG  118



>ref|WP_027966196.1| zinc-binding protein [Halomonas halocynthiae]
Length=113

 Score =   143 bits (360),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
             +F KIIN+EIPA+IV+ED+ VLAF DIDPKAPTHIL+IPK    ++ L+  EER  E++
Sbjct  3    CLFCKIINREIPADIVFEDEHVLAFHDIDPKAPTHILIIPK--KHISTLNDIEERDLEVV  60

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            GRL YTA  +A+Q+G  ++G+R+V+N  + GGQTV+HIH+HL+GGRQ  WP G
Sbjct  61   GRLQYTAAQLARQQGFADDGYRVVMNCNEMGGQTVYHIHMHLMGGRQFTWPAG  113



>ref|XP_010790142.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X2 [Notothenia coriiceps]
Length=213

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI PKAP H L+IP+V   +  +S+A++
Sbjct  98   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPKAPVHFLVIPRVP--IPRISEAKD  155

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+HLH++GGRQL WPPG
Sbjct  156  DDAELLGHLLIVAKTVAKQESLTE-GYRVVINDGKHGAQSVYHLHLHVLGGRQLAWPPG  213



>ref|WP_015181491.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Microcoleus 
sp. PCC 7113]
 gb|AFZ17335.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Microcoleus 
sp. PCC 7113]
Length=113

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            S TIF KII KEIPA+IVYEDD  +AFRDI P+AP HIL+IP  K  L  L+ AE     
Sbjct  2    SETIFSKIIRKEIPADIVYEDDLTIAFRDIAPQAPVHILVIP--KKPLPQLAAAESEDHA  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ++G LL TAK VA+Q GLD NG+RLVIN+G DGGQTV H+H+H++GGRQ+ WPPG
Sbjct  60   LMGHLLLTAKRVAQQLGLD-NGYRLVINNGADGGQTVDHLHVHILGGRQMKWPPG  113



>ref|XP_001025220.2| HIT domain containing protein [Tetrahymena thermophila]
Length=118

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -1

Query  479  EIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKL  300
            +IPA IVYEDD+ LAF+D+ P+AP HILLIPKVKDGLT L KAEERH +ILG L+     
Sbjct  3    KIPAQIVYEDDKCLAFKDVSPQAPVHILLIPKVKDGLTQLQKAEERHKDILGHLMLKVAE  62

Query  299  VAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG*LDLSNCRDP  138
            +A+Q  L E G+R+VINDGK G Q+V+H+HLH++GG Q+ WPPG L  S    P
Sbjct  63   IAQQNNLQE-GYRVVINDGKLGCQSVYHLHLHILGGTQMGWPPGVLGKSETIKP  115



>ref|XP_008292382.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial 
isoform X2 [Stegastes partitus]
Length=164

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I++ IPA+I+YED++ LAFRDI P+AP H L+IP+V   +  +S A +
Sbjct  49   YGSPAPTIFSKVIDRSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRVP--IPRISAARD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+NWPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLHE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMNWPPG  164



>ref|NP_001158525.1| histidine triad nucleotide-binding protein 2, mitochondrial [Oncorhynchus 
mykiss]
 gb|ACO08000.1| Histidine triad nucleotide-binding protein 2 [Oncorhynchus mykiss]
Length=167

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF ++I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP  +D +  +S+ ++
Sbjct  52   YGSPAPTIFSRVIDKTIPADIIYEDDKCLAFRDISPQAPVHFLVIP--RDPIPKISEVKD  109

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAK+E L E G+R+VINDGK G Q+V+H+H+H++GGRQLNWPPG
Sbjct  110  DDAELLGHLLVVAKNVAKKEALHE-GYRMVINDGKHGAQSVYHLHIHVLGGRQLNWPPG  167



>emb|CDQ64596.1| unnamed protein product [Oncorhynchus mykiss]
Length=167

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF ++I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP  +D +  +S+ ++
Sbjct  52   YGSPAPTIFSRVIDKTIPADIIYEDDKCLAFRDISPQAPVHFLVIP--RDPIPKISEVKD  109

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAK+E L E G+R+VINDGK G Q+V+H+H+H++GGRQLNWPPG
Sbjct  110  DDAELLGHLLVVAKNVAKKEALHE-GYRMVINDGKHGAQSVYHLHIHVLGGRQLNWPPG  167



>ref|WP_017716059.1| zinc-binding protein [Oscillatoria sp. PCC 10802]
Length=116

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 3/113 (3%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII +E+PA IVYEDD  LAF+DI P+AP HIL+IPK    ++ LS AE +   ++
Sbjct  7    TIFSKIIRREVPAEIVYEDDLALAFKDIRPQAPVHILVIPK--QPISQLSDAESKDHALM  64

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL TAK VAKQ GL  NG+R+VIN+G+DGGQTV+H+HLH++GGR + WPPG
Sbjct  65   GHLLLTAKRVAKQVGLT-NGYRIVINNGEDGGQTVYHLHLHILGGRHMKWPPG  116



>ref|WP_015161220.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Chamaesiphon 
minutus]
 gb|AFY95109.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Chamaesiphon 
minutus PCC 6605]
Length=113

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII KEIPA+IVYEDD V+AFRD++P+AP HIL+IP  K  +  ++ A     E
Sbjct  2    TETIFSKIIRKEIPADIVYEDDLVMAFRDVNPQAPVHILIIP--KRPIVSMADATPEDTE  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL T   VA QEGL E G+R+VIN GKDGGQTVFH+HLHL+G R + WPPG
Sbjct  60   LLGYLLLTVARVAAQEGLKE-GYRIVINTGKDGGQTVFHLHLHLLGQRMMTWPPG  113



>ref|WP_039727741.1| MULTISPECIES: zinc-binding protein [Oscillatoriophycideae]
 gb|KIF15596.1| zinc-binding protein [Aphanocapsa montana BDHKU210001]
 gb|KIF40514.1| zinc-binding protein [Lyngbya confervoides BDU141951]
Length=115

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII +EIPA+IVYEDD  LAFRDI P+APTH+LLIPK    +  LS A     E+L
Sbjct  5    TIFGKIIRREIPADIVYEDDLCLAFRDISPQAPTHVLLIPKKP--IPKLSDATSDDKELL  62

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G ++ T K +A+Q G+ E+G+R+VIN G DGGQTVFH+H+HL+GGR L WPPG
Sbjct  63   GHMMVTLKALAEQLGIAEDGYRVVINTGTDGGQTVFHLHMHLLGGRSLQWPPG  115



>emb|CDY32019.1| BnaC06g15970D [Brassica napus]
Length=157

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 82/118 (69%), Gaps = 17/118 (14%)
 Frame = -1

Query  521  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            PSDSPTIFDKII++EIP ++VYEDD VLAFRDI P+ P HIL+IPKVKDGLTGLSKAEE 
Sbjct  57   PSDSPTIFDKIISREIPHHVVYEDDNVLAFRDIRPQGPIHILVIPKVKDGLTGLSKAEEN  116

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            H                          +VINDG  G Q V+HIH+H+IGGRQ+NWPPG
Sbjct  117  HSTSWAAF-----------------STIVINDGPQGCQAVYHIHVHVIGGRQMNWPPG  157



>ref|XP_008416234.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X2 [Poecilia reticulata]
Length=164

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S  PTIF K+I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP+V   +  +S A++
Sbjct  49   YGSPGPTIFSKVIDKSIPADIIYEDDKCLAFRDISPQAPVHFLVIPRVP--IPRISTAKD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLSE-GYRVVINDGKHGSQSVYHLHIHVLGGRQMKWPPG  164



>ref|XP_005949185.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X3 [Haplochromis burtoni]
 ref|XP_006790105.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X3 [Neolamprologus brichardi]
Length=148

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI P+AP H L+IP++   +  +S+A++
Sbjct  33   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRIP--IPRISEAKD  90

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  91   DDAELLGHLLVVAKNVAKQESLTE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMKWPPG  148



>ref|WP_017299142.1| zinc-binding protein [Nodosilinea nodulosa]
Length=115

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIPANIVYEDD  LAF DI PKAPTHIL+IPK    +  LS +     E+L
Sbjct  5    TIFGKIIRKEIPANIVYEDDLCLAFTDITPKAPTHILVIPKKP--IPKLSDSTPADKELL  62

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL T K +A + GL E+G+R+VIN G DGGQTVFH+HLHL+GGR L WPPG
Sbjct  63   GHLLLTVKEIADRAGLTESGYRIVINTGDDGGQTVFHLHLHLLGGRSLGWPPG  115



>ref|XP_010729193.1| PREDICTED: histidine triad nucleotide-binding protein 1-like 
[Larimichthys crocea]
Length=164

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YEDD+ LAFRDI+P+AP H L+IP+V   +  +S+A++
Sbjct  49   YGSPAPTIFSKVIDKSIPADIIYEDDKCLAFRDINPQAPVHFLVIPRVP--IPRISEAKD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L++ G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLNK-GYRVVINDGKHGAQSVYHLHVHVLGGRQMMWPPG  164



>dbj|BAB75786.1| protein kinase C inhibitor [Nostoc sp. PCC 7120]
Length=122

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPANIVYEDD  LAF+D+ P+AP HIL+IPK    L  LS A+     
Sbjct  11   TETIFSKIIRREIPANIVYEDDLALAFKDVHPQAPVHILVIPK--QPLAKLSDADSHDHA  68

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL TAK VA++ GL ENG+R+VIN+G DGGQTV+H+HLH++GGR + WPPG
Sbjct  69   LLGHLLLTAKRVAQEAGL-ENGYRVVINNGNDGGQTVYHLHLHILGGRPMAWPPG  122



>ref|WP_044522083.1| zinc-binding protein [Nostoc sp. PCC 7120]
Length=116

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPANIVYEDD  LAF+D+ P+AP HIL+IPK    L  LS A+     
Sbjct  5    TETIFSKIIRREIPANIVYEDDLALAFKDVHPQAPVHILVIPK--QPLAKLSDADSHDHA  62

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL TAK VA++ GL ENG+R+VIN+G DGGQTV+H+HLH++GGR + WPPG
Sbjct  63   LLGHLLLTAKRVAQEAGL-ENGYRVVINNGNDGGQTVYHLHLHILGGRPMAWPPG  116



>ref|WP_015207374.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Cylindrospermum 
stagnale]
 gb|AFZ24118.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Cylindrospermum 
stagnale PCC 7417]
Length=116

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII +EIPA+IVYEDD  LAF+D++P+AP HIL+IPK    +  L++AE +   +L
Sbjct  7    TIFSKIIRREIPADIVYEDDLALAFKDVNPQAPVHILVIPK--KPIPQLAEAESQDHALL  64

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL TAK VA+Q GL +NG+RLVIN G DGGQTV+H+HLH++GGR L WPPG
Sbjct  65   GHLLLTAKRVAEQAGL-KNGYRLVINTGADGGQTVYHLHLHILGGRHLAWPPG  116



>ref|XP_003975269.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
[Takifugu rubripes]
Length=154

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            +PTIF K+I+K IPA+I+YED++ LAFRDI P+AP H L+IP+V   +  +S+A+E   E
Sbjct  43   APTIFSKVIDKSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRVP--IPRISEAKEDDAE  100

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL  AK VA QE L+E G+R+VINDGK G Q+V+H+H+H++GGRQL WPPG
Sbjct  101  LLGHLLIVAKKVAAQESLNE-GYRVVINDGKHGAQSVYHLHVHVLGGRQLTWPPG  154



>ref|XP_007557903.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
[Poecilia formosa]
Length=164

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S  PTIF K+I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP+V   +  +S A++
Sbjct  49   YGSPGPTIFSKVIDKSIPADIIYEDDKCLAFRDISPQAPIHFLVIPRVP--IPRISAAKD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLSE-GYRVVINDGKHGSQSVYHLHIHVLGGRQMEWPPG  164



>ref|WP_017289073.1| zinc-binding protein [Leptolyngbya boryana]
Length=116

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = -1

Query  518  SDS-PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER  342
            SDS  TIF KII KEIPA+IVYEDD  LAFRD++P+AP HIL+IP  K  +  L+ AE +
Sbjct  2    SDSNDTIFGKIIRKEIPADIVYEDDLALAFRDVNPQAPVHILVIP--KQPIAKLADAESQ  59

Query  341  HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               ++G LL T K VA+Q+GL  NG+R+VIN G++GGQTV+H+HLHL+GGR ++WPPG
Sbjct  60   DHALMGHLLLTVKRVAEQQGL-SNGYRVVINTGEEGGQTVYHMHLHLLGGRSMSWPPG  116



>ref|XP_003372141.1| histidine triad nucleotide-binding protein 1 [Trichinella spiralis]
 gb|EFV51914.1| histidine triad nucleotide-binding protein 1 [Trichinella spiralis]
Length=149

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = -1

Query  518  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH  339
            +D PTIFDKII+K IPA+I+YEDD+V+AF DI P+AP H L+IPK +  L  LS A E H
Sbjct  36   ADGPTIFDKIIDKSIPASIIYEDDEVMAFHDIHPQAPVHFLVIPKKR--LNQLSDATEEH  93

Query  338  CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
              +LG+LL TAK  A    L E G+R+VIN+G+DG Q+V+H+HLH++GGR++ WPPG
Sbjct  94   TALLGKLLLTAKNCANLLFL-EKGYRVVINNGRDGCQSVYHLHLHVLGGRKMKWPPG  149



>ref|XP_002591274.1| hypothetical protein BRAFLDRAFT_121424 [Branchiostoma floridae]
 gb|EEN47285.1| hypothetical protein BRAFLDRAFT_121424 [Branchiostoma floridae]
Length=118

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIP++I+YED+Q LAFRDI+P+AP H L+IPK    +  LSKAE+   ++L
Sbjct  8    TIFGKIIRKEIPSDILYEDNQCLAFRDINPQAPVHFLVIPKKP--IPQLSKAEDGDEQLL  65

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+  AK VA++EGL   G+R+  NDGK+GGQ VFHIHLH++GGRQ+ WPPG
Sbjct  66   GHLMIVAKKVAEKEGLAATGYRVTANDGKNGGQEVFHIHLHVMGGRQMGWPPG  118



>ref|XP_003455334.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
[Oreochromis niloticus]
Length=164

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI P+AP H L+IP++   +  +S+A++
Sbjct  49   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRIP--IPRISEAKD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLTE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMKWPPG  164



>ref|XP_008292381.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial 
isoform X1 [Stegastes partitus]
Length=206

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I++ IPA+I+YED++ LAFRDI P+AP H L+IP+V   +  +S A +
Sbjct  91   YGSPAPTIFSKVIDRSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRVP--IPRISAARD  148

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+NWPPG
Sbjct  149  DDAELLGHLLVVAKNVAKQESLHE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMNWPPG  206



>ref|XP_008416233.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X1 [Poecilia reticulata]
Length=211

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S  PTIF K+I+K IPA+I+YEDD+ LAFRDI P+AP H L+IP+V   +  +S A++
Sbjct  96   YGSPGPTIFSKVIDKSIPADIIYEDDKCLAFRDISPQAPVHFLVIPRVP--IPRISTAKD  153

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  154  DDAELLGHLLVVAKNVAKQESLSE-GYRVVINDGKHGSQSVYHLHIHVLGGRQMKWPPG  211



>gb|ELU01133.1| hypothetical protein CAPTEDRAFT_149440 [Capitella teleta]
Length=126

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIPA I+YEDD+ +AFRD+ P+APTH L+IPK    +T LS + +   ++L
Sbjct  16   TIFGKIIRKEIPATILYEDDECIAFRDVQPQAPTHFLVIPKKP--ITQLSASGKADNQLL  73

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L+  A+ VA QE LD++G+RL++NDGK+G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  74   GHLMAVARDVAAQENLDKDGYRLIVNDGKNGAQSVYHLHIHVMGGRQMGWPPG  126



>ref|XP_004575686.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X1 [Maylandia zebra]
 ref|XP_005949183.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X1 [Haplochromis burtoni]
 ref|XP_006790104.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X2 [Neolamprologus brichardi]
Length=164

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI P+AP H L+IP++   +  +S+A++
Sbjct  49   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRIP--IPRISEAKD  106

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  107  DDAELLGHLLVVAKNVAKQESLTE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMKWPPG  164



>ref|XP_005753798.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X4 [Pundamilia nyererei]
Length=148

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S  PTIF K+I+K IPA+I+YED++ LAFRDI P+AP H L+IP++   +  +S+A++
Sbjct  33   YGSPVPTIFSKVIDKSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRIP--IPRISEAKD  90

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  91   DDAELLGHLLVVAKNVAKQESLTE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMKWPPG  148



>gb|ABA20441.1| Histidine triad (HIT) protein [Anabaena variabilis ATCC 29413]
Length=122

 Score =   141 bits (355),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPANIVYEDD  LAF D+ P+AP HIL+IPK    L  LS A+     
Sbjct  11   TETIFSKIIRREIPANIVYEDDLALAFTDVHPQAPVHILVIPK--QPLAKLSDADSHDHA  68

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL TAK VA++ GL ENG+R+VIN+G DGGQTV+H+HLH++GGR + WPPG
Sbjct  69   LLGHLLLTAKRVAQKAGL-ENGYRVVINNGNDGGQTVYHLHLHILGGRLMAWPPG  122



>ref|XP_003383423.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
[Amphimedon queenslandica]
Length=141

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = -1

Query  515  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC  336
             SPTIF KII+KEIPA+I+YEDDQ LAF+D++P APTH L+IPK +  +  LS+A++   
Sbjct  29   SSPTIFSKIISKEIPADILYEDDQSLAFKDVNPVAPTHFLVIPKRQ--IPMLSQAKQSDS  86

Query  335  EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ++LG LL  A+ VA +EGL  +G+R+VIN+GK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  87   QLLGHLLSVAREVADKEGL-TDGYRVVINNGKQGCQSVYHLHIHVLGGRQMTWPPG  141



>ref|WP_011432043.1| zinc-binding protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01374.1| histidine triad family protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=113

 Score =   140 bits (354),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            S T+F KII +EIPA IVYEDD+ LAF+DI P+AP HIL++P  K+ + G+S+A+  H  
Sbjct  2    SDTVFGKIIRREIPAQIVYEDDRALAFKDIAPQAPVHILVVP--KEPIPGISQAKPEHEA  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL TA+ VA + GL++ G+RLVIN+G+DGGQTVFH+H+H++GGR + WPPG
Sbjct  60   LLGHLLLTAQRVAAEAGLNK-GYRLVINEGEDGGQTVFHLHIHVLGGRGMGWPPG  113



>ref|WP_015155974.1| histidine triad (HIT) protein [Chroococcidiopsis thermalis]
 gb|AFY89432.1| histidine triad (HIT) protein [Chroococcidiopsis thermalis PCC 
7203]
Length=116

 Score =   140 bits (354),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 3/113 (3%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII KEIPANIVYED+  +AF+DI+P+AP HIL+IP  K  +  LS AE R   ++
Sbjct  7    TIFGKIIRKEIPANIVYEDELAIAFKDINPQAPVHILVIP--KKPIAKLSDAESRDHALM  64

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G LL T K VA+Q GL+ NG+R+VIN G DGGQTV H+HLH++GGRQ++WPPG
Sbjct  65   GHLLLTVKRVAQQVGLN-NGYRVVINTGADGGQTVDHMHLHILGGRQMSWPPG  116



>ref|WP_041456001.1| zinc-binding protein [Anabaena variabilis]
Length=116

 Score =   140 bits (353),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPANIVYEDD  LAF D+ P+AP HIL+IPK    L  LS A+     
Sbjct  5    TETIFSKIIRREIPANIVYEDDLALAFTDVHPQAPVHILVIPK--QPLAKLSDADSHDHA  62

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL TAK VA++ GL ENG+R+VIN+G DGGQTV+H+HLH++GGR + WPPG
Sbjct  63   LLGHLLLTAKRVAQKAGL-ENGYRVVINNGNDGGQTVYHLHLHILGGRLMAWPPG  116



>ref|WP_006101479.1| zinc-binding protein [Coleofasciculus chthonoplastes]
 gb|EDX75206.1| hypothetical protein MC7420_2210 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=113

 Score =   140 bits (353),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            S TIF KII +EIPA+IVYEDD VLAF+D+ PKAP HILLIP  K  +  L+ AE     
Sbjct  2    SETIFSKIIRREIPADIVYEDDLVLAFKDVAPKAPIHILLIP--KKPIPQLAAAESHDHA  59

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            ++G LL TAK VA+Q GL++ G+R+VIN+G DGGQTV H+HLH++GGRQ++WPPG
Sbjct  60   LMGHLLLTAKRVAEQVGLNQ-GYRVVINNGADGGQTVDHLHLHILGGRQMDWPPG  113



>gb|EKD52510.1| HIT family protein [uncultured bacterium]
Length=111

 Score =   140 bits (353),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            TIF KII+KEIPANIVYEDD  LAFRDI+PKAPTHILLIPK  D +  ++ A   H E+L
Sbjct  2    TIFAKIIDKEIPANIVYEDDLCLAFRDINPKAPTHILLIPKTTD-IDRIANARADHKELL  60

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G ++   + +AK+EGL  N +RLVIN+G+  GQTVFH+H+H++GGR   WPPG
Sbjct  61   GHMMLVCRDIAKKEGL--NDYRLVINNGEGVGQTVFHLHIHIMGGRAFTWPPG  111



>ref|WP_017651366.1| zinc-binding protein [Microchaete sp. PCC 7126]
Length=116

 Score =   140 bits (353),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = -1

Query  512  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE  333
            + TIF KII +EIPA++VYEDD  LAF+DI+P+AP HIL+IP  K  +  L+ A+ +  +
Sbjct  5    TETIFSKIIRREIPADVVYEDDLALAFKDINPQAPVHILVIP--KQPIPKLADAQSQDHQ  62

Query  332  ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            +LG LL T KLVA+Q GLD NG+R+VIN G DGGQTV H+HLH++GGR L WPPG
Sbjct  63   LLGHLLLTVKLVAQQAGLD-NGYRVVINTGADGGQTVDHLHLHILGGRSLTWPPG  116



>ref|XP_004575687.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X2 [Maylandia zebra]
 ref|XP_005949184.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like 
isoform X2 [Haplochromis burtoni]
Length=162

 Score =   142 bits (357),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRDI P+AP H L+IP++   +  +S+A++
Sbjct  47   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDISPQAPVHFLVIPRIP--IPRISEAKD  104

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE L E G+R+VINDGK G Q+V+H+H+H++GGRQ+ WPPG
Sbjct  105  DDAELLGHLLVVAKNVAKQESLTE-GYRVVINDGKHGAQSVYHLHIHVLGGRQMKWPPG  162



>gb|ACQ58023.1| Histidine triad nucleotide-binding protein 2 [Anoplopoma fimbria]
Length=195

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
            + S +PTIF K+I+K IPA+I+YED++ LAFRD+ P+AP H L+IP+V   +  +S+ ++
Sbjct  80   YGSPAPTIFSKVIDKSIPADIIYEDEKCLAFRDVSPQAPVHFLVIPRVP--IPRISEVKD  137

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
               E+LG LL  AK VAKQE LDE G+R+VI+DGK G Q+V+H+H+H++GGRQ++WPPG
Sbjct  138  DDAELLGHLLVVAKNVAKQESLDE-GYRVVIDDGKHGAQSVYHLHVHVLGGRQMSWPPG  195



>ref|WP_028300883.1| zinc-binding protein [Oceanospirillum beijerinckii]
Length=113

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
             +F KII +EIPA+IV+EDD VLAFRDIDPKAP HIL+IPK    +  L+  +E  C ++
Sbjct  3    CLFCKIIAREIPADIVFEDDDVLAFRDIDPKAPEHILIIPKRH--IATLNDLQEEDCALV  60

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            GRL +TA+ +AK+ G+ E G+R+V+N  + GGQTV+HIH+HL+GGR + WPPG
Sbjct  61   GRLQFTAQKIAKELGMAEEGYRVVMNCNEAGGQTVYHIHMHLLGGRSMTWPPG  113



>ref|WP_006455256.1| zinc-binding protein [Synechococcus sp. PCC 7335]
 gb|EDX85513.1| hypothetical protein S7335_3214 [Synechococcus sp. PCC 7335]
Length=114

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = -1

Query  524  FPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEE  345
             P D  T+F KII KEIPA+IVYEDDQ LAFRDI P+APTHIL+IP  K  +  LS+A+E
Sbjct  1    MPED--TLFSKIIRKEIPADIVYEDDQCLAFRDIAPQAPTHILVIP--KKPIPKLSEAQE  56

Query  344  RHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
                +LG LL     +A+++ L ENG+R+VIN G++GGQTVFH+HLHL+GGR L WPPG
Sbjct  57   EDKSLLGHLLLVVSDIAREQKL-ENGYRVVINTGEEGGQTVFHLHLHLLGGRALGWPPG  114



>ref|XP_008626139.1| hypothetical protein YYE_04276 [Plasmodium vinckei vinckei]
 gb|KEG00830.1| hypothetical protein YYE_04276 [Plasmodium vinckei vinckei]
Length=130

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -1

Query  506  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL  327
            +IF KI+ KEI A+IVYEDD+VLAF DI+P+AP HIL+IPKV+DGLT LSKAEE+H EIL
Sbjct  20   SIFGKIVRKEIKADIVYEDDKVLAFNDINPQAPVHILVIPKVRDGLTRLSKAEEKHKEIL  79

Query  326  GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG  168
            G L++    + ++  L +  FRLV+N+G +  Q+V+++HLH++  RQ+ WPPG
Sbjct  80   GHLMWAVSEIVRRNNLGD--FRLVVNNGPEACQSVYYLHLHILAKRQMKWPPG  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515