BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035O22

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761445.1|  PREDICTED: long chain base biosynthesis prot...    312   2e-100   Nicotiana sylvestris
dbj|BAE96963.1|  serine palmitpoyltransferase subunit2                  312   3e-100   Nicotiana tabacum [American tobacco]
ref|XP_009611514.1|  PREDICTED: long chain base biosynthesis prot...    311   6e-100   Nicotiana tomentosiformis
ref|XP_002284409.1|  PREDICTED: long chain base biosynthesis prot...    311   7e-100   Vitis vinifera
emb|CBI15735.3|  unnamed protein product                                311   9e-100   Vitis vinifera
dbj|BAG68298.1|  serine palmitoyltransferase                            310   1e-99    Nicotiana benthamiana
ref|XP_010249161.1|  PREDICTED: long chain base biosynthesis prot...    310   1e-99    Nelumbo nucifera [Indian lotus]
ref|XP_011083372.1|  PREDICTED: long chain base biosynthesis prot...    310   3e-99    Sesamum indicum [beniseed]
ref|XP_006446964.1|  hypothetical protein CICLE_v10017847mg             309   5e-99    Citrus clementina [clementine]
gb|EYU24476.1|  hypothetical protein MIMGU_mgv1a004686mg                304   9e-97    Erythranthe guttata [common monkey flower]
ref|XP_004235384.1|  PREDICTED: long chain base biosynthesis prot...    301   6e-96    
ref|XP_008379061.1|  PREDICTED: long chain base biosynthesis prot...    300   9e-96    
ref|XP_008231042.1|  PREDICTED: long chain base biosynthesis prot...    300   1e-95    Prunus mume [ume]
ref|XP_008341247.1|  PREDICTED: long chain base biosynthesis prot...    300   1e-95    Malus domestica [apple tree]
emb|CDO98665.1|  unnamed protein product                                300   1e-95    Coffea canephora [robusta coffee]
ref|XP_006364387.1|  PREDICTED: long chain base biosynthesis prot...    300   2e-95    Solanum tuberosum [potatoes]
ref|XP_010678318.1|  PREDICTED: long chain base biosynthesis prot...    299   3e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007031988.1|  Long chain base2 isoform 2                         298   3e-95    
ref|XP_007209963.1|  hypothetical protein PRUPE_ppa004890mg             298   5e-95    Prunus persica
ref|XP_007031987.1|  Long chain base2 isoform 1                         298   7e-95    Theobroma cacao [chocolate]
ref|XP_006347368.1|  PREDICTED: long chain base biosynthesis prot...    298   8e-95    Solanum tuberosum [potatoes]
ref|XP_011042943.1|  PREDICTED: long chain base biosynthesis prot...    298   8e-95    Populus euphratica
ref|XP_004241473.1|  PREDICTED: long chain base biosynthesis prot...    298   9e-95    Solanum lycopersicum
ref|XP_011073130.1|  PREDICTED: long chain base biosynthesis prot...    298   1e-94    Sesamum indicum [beniseed]
ref|XP_009378026.1|  PREDICTED: long chain base biosynthesis prot...    297   1e-94    Pyrus x bretschneideri [bai li]
ref|XP_007038096.1|  Long chain base2 isoform 2                         296   3e-94    
ref|XP_002318160.1|  serine palmitoyltransferase family protein         296   5e-94    Populus trichocarpa [western balsam poplar]
ref|XP_007215280.1|  hypothetical protein PRUPE_ppa004859mg             295   7e-94    
ref|XP_010096046.1|  Serine palmitoyltransferase 2                      296   7e-94    
emb|CAB44316.1|  serine palmitoyltransferase                            295   7e-94    Solanum tuberosum [potatoes]
dbj|BAF01511.1|  serine palmitoyltransferase-like protein               287   8e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC55228.1|  serine palmitoyltransferase                            295   2e-93    Lotus japonicus
gb|KDP41837.1|  hypothetical protein JCGZ_26855                         294   2e-93    Jatropha curcas
ref|XP_008464380.1|  PREDICTED: long chain base biosynthesis prot...    293   8e-93    Cucumis melo [Oriental melon]
gb|KEH25646.1|  long chain base biosynthesis 2a-like protein            293   8e-93    Medicago truncatula
ref|XP_010907607.1|  PREDICTED: long chain base biosynthesis prot...    292   1e-92    Elaeis guineensis
gb|KHN13380.1|  Serine palmitoyltransferase 2                           292   2e-92    Glycine soja [wild soybean]
ref|XP_003548027.1|  PREDICTED: long chain base biosynthesis prot...    292   2e-92    Glycine max [soybeans]
ref|XP_009150176.1|  PREDICTED: long chain base biosynthesis prot...    291   3e-92    Brassica rapa
ref|XP_004138028.1|  PREDICTED: long chain base biosynthesis prot...    291   3e-92    Cucumis sativus [cucumbers]
ref|XP_004161364.1|  PREDICTED: LOW QUALITY PROTEIN: long chain b...    291   3e-92    
ref|XP_004304557.1|  PREDICTED: long chain base biosynthesis prot...    291   4e-92    Fragaria vesca subsp. vesca
ref|XP_008791061.1|  PREDICTED: long chain base biosynthesis prot...    291   4e-92    Phoenix dactylifera
gb|KHG30176.1|  Serine palmitoyltransferase 2                           291   5e-92    Gossypium arboreum [tree cotton]
gb|KJB51269.1|  hypothetical protein B456_008G209600                    290   6e-92    Gossypium raimondii
dbj|BAH19645.1|  AT5G23670                                              282   6e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDX87007.1|  BnaC03g52770D                                          290   8e-92    
ref|XP_003518128.1|  PREDICTED: long chain base biosynthesis prot...    290   8e-92    Glycine max [soybeans]
ref|XP_006404217.1|  hypothetical protein EUTSA_v10010322mg             290   9e-92    Eutrema salsugineum [saltwater cress]
gb|KJB51268.1|  hypothetical protein B456_008G209600                    290   1e-91    Gossypium raimondii
gb|KHN00617.1|  Serine palmitoyltransferase 2                           290   1e-91    Glycine soja [wild soybean]
ref|XP_010929641.1|  PREDICTED: long chain base biosynthesis prot...    289   2e-91    Elaeis guineensis
ref|XP_008775142.1|  PREDICTED: long chain base biosynthesis prot...    289   2e-91    Phoenix dactylifera
gb|ADN33867.1|  serine palmitoyltransferase                             278   2e-91    Cucumis melo subsp. melo
ref|XP_002275468.1|  PREDICTED: long chain base biosynthesis prot...    289   3e-91    Vitis vinifera
ref|XP_010660694.1|  PREDICTED: long chain base biosynthesis prot...    288   4e-91    Vitis vinifera
gb|ABW97708.1|  serine palmitoyltransferase long chain base subunit     288   4e-91    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010036863.1|  PREDICTED: long chain base biosynthesis prot...    288   5e-91    Eucalyptus grandis [rose gum]
ref|XP_006290987.1|  hypothetical protein CARUB_v10017101mg             288   7e-91    Capsella rubella
ref|NP_190447.1|  serine palmitoyltransferase 1                         287   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151745.1|  hypothetical protein PHAVU_004G071100g             286   2e-90    Phaseolus vulgaris [French bean]
ref|XP_009151545.1|  PREDICTED: long chain base biosynthesis prot...    286   5e-90    Brassica rapa
gb|KDO47369.1|  hypothetical protein CISIN_1g040324mg                   285   5e-90    Citrus sinensis [apfelsine]
ref|XP_006446965.1|  hypothetical protein CICLE_v10015046mg             285   5e-90    Citrus clementina [clementine]
ref|XP_009403784.1|  PREDICTED: long chain base biosynthesis prot...    285   5e-90    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX68498.1|  BnaC01g25760D                                          285   6e-90    
ref|XP_010515202.1|  PREDICTED: long chain base biosynthesis prot...    285   6e-90    Camelina sativa [gold-of-pleasure]
gb|KFK34178.1|  hypothetical protein AALP_AA5G110700                    285   1e-89    Arabis alpina [alpine rockcress]
ref|XP_002875925.1|  hypothetical protein ARALYDRAFT_485232             285   1e-89    
ref|XP_008353440.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    297   1e-89    
ref|XP_006468870.1|  PREDICTED: long chain base biosynthesis prot...    284   2e-89    Citrus sinensis [apfelsine]
ref|XP_009403558.1|  PREDICTED: long chain base biosynthesis prot...    282   2e-89    
emb|CDX83048.1|  BnaA01g20480D                                          284   2e-89    
ref|XP_006287613.1|  hypothetical protein CARUB_v10000825mg             283   4e-89    Capsella rubella
ref|XP_002512864.1|  serine palmitoyltransferase, putative              283   5e-89    Ricinus communis
ref|XP_009421040.1|  PREDICTED: long chain base biosynthesis prot...    283   6e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073129.1|  PREDICTED: long chain base biosynthesis prot...    283   6e-89    
ref|XP_007038095.1|  Long chain base2 isoform 1                         283   6e-89    
dbj|BAB03231.1|  serine palmitoyltransferase                            282   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197756.1|  serine palmitoyltransferase subunit LCB2              282   9e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872066.1|  LCB2 subunit protein                               282   1e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_010503519.1|  PREDICTED: long chain base biosynthesis prot...    282   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010493489.1|  PREDICTED: long chain base biosynthesis prot...    282   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010421176.1|  PREDICTED: long chain base biosynthesis prot...    281   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009419359.1|  PREDICTED: long chain base biosynthesis prot...    281   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010454654.1|  PREDICTED: long chain base biosynthesis prot...    281   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009403557.1|  PREDICTED: long chain base biosynthesis prot...    281   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394630.1|  hypothetical protein EUTSA_v10004251mg             280   2e-88    
ref|XP_011073128.1|  PREDICTED: long chain base biosynthesis prot...    282   2e-88    
ref|XP_006828786.1|  hypothetical protein AMTR_s00001p00112910          281   3e-88    Amborella trichopoda
ref|XP_004516386.1|  PREDICTED: long chain base biosynthesis prot...    280   5e-88    Cicer arietinum [garbanzo]
gb|KFK27657.1|  hypothetical protein AALP_AA8G411600                    280   8e-88    Arabis alpina [alpine rockcress]
ref|XP_009404745.1|  PREDICTED: long chain base biosynthesis prot...    279   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010519476.1|  PREDICTED: long chain base biosynthesis prot...    279   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_011002110.1|  PREDICTED: long chain base biosynthesis prot...    278   3e-87    Populus euphratica
gb|EEE52176.1|  hypothetical protein OsJ_34042                          277   4e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148953.1|  serine palmitoyltransferase 2                      278   5e-87    
ref|XP_004979342.1|  PREDICTED: long chain base biosynthesis prot...    278   5e-87    Setaria italica
ref|XP_003577540.1|  PREDICTED: long chain base biosynthesis prot...    277   9e-87    Brachypodium distachyon [annual false brome]
ref|NP_001067972.1|  Os11g0516000                                       277   1e-86    
ref|XP_002321740.1|  serine palmitoyltransferase family protein         276   2e-86    Populus trichocarpa [western balsam poplar]
ref|NP_001151995.1|  LOC100285632                                       276   3e-86    Zea mays [maize]
ref|XP_009150174.1|  PREDICTED: long chain base biosynthesis prot...    273   5e-86    Brassica rapa
ref|XP_002450805.1|  hypothetical protein SORBIDRAFT_05g018880          275   6e-86    Sorghum bicolor [broomcorn]
ref|XP_006662956.1|  PREDICTED: long chain base biosynthesis prot...    275   7e-86    Oryza brachyantha
emb|CDY69570.1|  BnaAnng30850D                                          271   3e-85    Brassica napus [oilseed rape]
ref|XP_008656901.1|  PREDICTED: long chain base biosynthesis prot...    272   1e-84    
ref|XP_009150173.1|  PREDICTED: long chain base biosynthesis prot...    271   1e-84    Brassica rapa
ref|XP_006645277.1|  PREDICTED: long chain base biosynthesis prot...    271   2e-84    Oryza brachyantha
ref|XP_004971156.1|  PREDICTED: long chain base biosynthesis prot...    271   3e-84    Setaria italica
ref|NP_001045279.1|  Os01g0928800                                       270   3e-84    
ref|XP_002459025.1|  hypothetical protein SORBIDRAFT_03g044700          270   3e-84    Sorghum bicolor [broomcorn]
ref|XP_003564989.1|  PREDICTED: long chain base biosynthesis prot...    269   1e-83    Brachypodium distachyon [annual false brome]
ref|XP_002450804.1|  hypothetical protein SORBIDRAFT_05g018870          269   1e-83    
ref|XP_008678155.1|  PREDICTED: long chain base biosynthesis prot...    268   2e-83    Zea mays [maize]
gb|EMT23338.1|  Serine palmitoyltransferase 2                           268   3e-83    
ref|XP_008678154.1|  PREDICTED: long chain base biosynthesis prot...    267   6e-83    Zea mays [maize]
emb|CDM85908.1|  unnamed protein product                                270   2e-81    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001045278.1|  Os01g0928700                                       263   4e-81    
gb|EMS46639.1|  Serine palmitoyltransferase 2                           260   4e-80    Triticum urartu
ref|XP_010322021.1|  PREDICTED: long chain base biosynthesis prot...    258   6e-80    
gb|EMS48138.1|  Serine palmitoyltransferase 2                           258   3e-79    Triticum urartu
ref|XP_006645275.1|  PREDICTED: long chain base biosynthesis prot...    257   6e-79    Oryza brachyantha
ref|XP_010093950.1|  Serine palmitoyltransferase 2                      258   1e-78    
ref|XP_008239635.1|  PREDICTED: long chain base biosynthesis prot...    255   2e-78    Prunus mume [ume]
ref|XP_008678152.1|  PREDICTED: long chain base biosynthesis prot...    256   4e-78    
ref|XP_006645276.1|  PREDICTED: long chain base biosynthesis prot...    254   7e-78    Oryza brachyantha
gb|ABR18369.1|  unknown                                                 254   9e-78    Picea sitchensis
gb|EAY77076.1|  hypothetical protein OsI_05036                          253   2e-77    Oryza sativa Indica Group [Indian rice]
sp|Q8RYL1.1|LCB2B_ORYSJ  RecName: Full=Long chain base biosynthes...    253   2e-77    Oryza sativa Japonica Group [Japonica rice]
ref|NP_190448.1|  Pyridoxal phosphate (PLP)-dependent transferase...    248   5e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KCW48525.1|  hypothetical protein EUGRSUZ_K02201                     251   2e-76    Eucalyptus grandis [rose gum]
pir||T49275  serine C-palmitoyltransferase (EC 2.3.1.50) [similar...    247   3e-76 
gb|EEC72089.1|  hypothetical protein OsI_05034                          242   6e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_009411041.1|  PREDICTED: long chain base biosynthesis prot...    242   3e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394629.1|  hypothetical protein EUTSA_v10004251mg             238   1e-72    
ref|XP_002978032.1|  hypothetical protein SELMODRAFT_108076             239   2e-72    Selaginella moellendorffii
ref|XP_002966707.1|  hypothetical protein SELMODRAFT_86377              237   3e-71    Selaginella moellendorffii
ref|XP_009394362.1|  PREDICTED: long chain base biosynthesis prot...    238   4e-70    
ref|XP_001783810.1|  predicted protein                                  221   3e-65    
emb|CDX87006.1|  BnaC03g52760D                                          211   5e-62    
ref|XP_008778939.1|  PREDICTED: long chain base biosynthesis prot...    211   7e-61    
ref|XP_008671350.1|  PREDICTED: long chain base biosynthesis prot...    195   2e-56    
gb|AAM82589.1|AF525281_1  serine palmitoyltransferase                   185   1e-55    Brassica oleracea
tpg|DAA46316.1|  TPA: hypothetical protein ZEAMMB73_317015              192   4e-54    
tpg|DAA63385.1|  TPA: hypothetical protein ZEAMMB73_716052              192   1e-53    
tpg|DAA63387.1|  TPA: hypothetical protein ZEAMMB73_716052              192   2e-53    
tpg|DAA38120.1|  TPA: hypothetical protein ZEAMMB73_853430              184   6e-52    
ref|XP_002875926.1|  hypothetical protein ARALYDRAFT_485233             181   3e-51    
gb|AFW88152.1|  hypothetical protein ZEAMMB73_846491                    179   2e-50    
ref|XP_005647033.1|  PLP-dependent transferase                          181   5e-50    Coccomyxa subellipsoidea C-169
ref|XP_005917126.1|  PREDICTED: serine palmitoyltransferase 2-like      174   7e-50    
emb|CAG00103.1|  unnamed protein product                                177   1e-48    Tetraodon nigroviridis
ref|XP_005848468.1|  hypothetical protein CHLNCDRAFT_144864             177   1e-48    Chlorella variabilis
ref|XP_003971560.1|  PREDICTED: serine palmitoyltransferase 2-like      176   1e-47    Takifugu rubripes [tiger puffer]
ref|XP_008280215.1|  PREDICTED: serine palmitoyltransferase 2-like      175   2e-47    Stegastes partitus
ref|XP_011401811.1|  Serine palmitoyltransferase 2                      173   4e-47    Auxenochlorella protothecoides
ref|XP_005724923.1|  PREDICTED: serine palmitoyltransferase 2-like      174   7e-47    Pundamilia nyererei
ref|XP_010789508.1|  PREDICTED: serine palmitoyltransferase 2-like      166   1e-46    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007566208.1|  PREDICTED: serine palmitoyltransferase 2           172   2e-46    Poecilia formosa
ref|XP_003440868.1|  PREDICTED: serine palmitoyltransferase 2-like      172   4e-46    Oreochromis niloticus
ref|XP_010880781.1|  PREDICTED: serine palmitoyltransferase 2-like      172   5e-46    Esox lucius
ref|XP_008310964.1|  PREDICTED: serine palmitoyltransferase 2 iso...    171   6e-46    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004083402.1|  PREDICTED: serine palmitoyltransferase 2-like      171   6e-46    Oryzias latipes [Japanese rice fish]
ref|XP_010739223.1|  PREDICTED: serine palmitoyltransferase 2           171   8e-46    Larimichthys crocea [croceine croaker]
gb|ADY39561.1|  putative serine palmitoyltransferase                    163   1e-45    Hottentotta judaicus
ref|XP_008396458.1|  PREDICTED: serine palmitoyltransferase 2-like      171   1e-45    Poecilia reticulata
ref|XP_005809327.1|  PREDICTED: serine palmitoyltransferase 2-like      170   1e-45    Xiphophorus maculatus
gb|AAM82590.1|AF525282_1  serine palmitoyltransferase                   158   3e-45    Brassica oleracea
emb|CDQ72138.1|  unnamed protein product                                169   5e-45    Oncorhynchus mykiss
ref|NP_001108213.1|  serine palmitoyltransferase, long chain base...    167   1e-44    Danio rerio [leopard danio]
ref|XP_005820282.1|  hypothetical protein GUITHDRAFT_98377              168   1e-44    Guillardia theta CCMP2712
ref|XP_004349889.1|  serine palmitoyltransferase                        166   3e-44    Capsaspora owczarzaki ATCC 30864
emb|CAF94268.1|  unnamed protein product                                165   5e-44    Tetraodon nigroviridis
ref|XP_004344667.1|  serine palmitoyltransferase, long chain base...    165   6e-44    Acanthamoeba castellanii str. Neff
dbj|BAD32243.1|  mKIAA0526 protein                                      157   7e-44    Mus musculus [mouse]
gb|ETM56090.1|  hypothetical protein L914_00839                         156   8e-44    Phytophthora parasitica
ref|XP_002287833.1|  predicted protein                                  166   9e-44    Thalassiosira pseudonana CCMP1335
ref|XP_002186044.1|  predicted protein                                  164   1e-43    Phaeodactylum tricornutum CCAP 1055/1
gb|EPZ34220.1|  Pyridoxal phosphate-dependent transferase domain-...    164   2e-43    Rozella allomycis CSF55
ref|XP_003962837.1|  PREDICTED: serine palmitoyltransferase 2-like      164   2e-43    Takifugu rubripes [tiger puffer]
ref|XP_003445532.1|  PREDICTED: serine palmitoyltransferase 2-lik...    164   3e-43    Oreochromis niloticus
ref|XP_006632191.1|  PREDICTED: serine palmitoyltransferase 2-like      164   4e-43    Lepisosteus oculatus
ref|XP_010118582.1|  PREDICTED: serine palmitoyltransferase 2           159   5e-43    Chlamydotis macqueenii
ref|XP_008275494.1|  PREDICTED: serine palmitoyltransferase 2-like      163   6e-43    Stegastes partitus
dbj|BAE21805.1|  unnamed protein product                                157   7e-43    Mus musculus [mouse]
ref|XP_006036023.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    161   7e-43    Alligator sinensis
dbj|BAC37842.1|  unnamed protein product                                157   8e-43    Mus musculus [mouse]
ref|XP_005750502.1|  PREDICTED: serine palmitoyltransferase 2-like      162   8e-43    Pundamilia nyererei
ref|XP_009948862.1|  PREDICTED: serine palmitoyltransferase 2           159   9e-43    Leptosomus discolor
ref|XP_004542426.1|  PREDICTED: serine palmitoyltransferase 2-like      162   9e-43    
ref|XP_002734813.1|  PREDICTED: serine palmitoyltransferase 2-like      162   1e-42    Saccoglossus kowalevskii
emb|CCI48496.1|  unnamed protein product                                160   2e-42    Albugo candida
ref|XP_007248546.1|  PREDICTED: serine palmitoyltransferase 2           161   3e-42    
gb|EFA83279.1|  serine C-palmitoyltransferase subunit                   160   3e-42    Heterostelium album PN500
ref|XP_010214677.1|  PREDICTED: serine palmitoyltransferase 2           159   4e-42    Tinamus guttatus
ref|XP_002734812.1|  PREDICTED: serine palmitoyltransferase 2-like      160   5e-42    Saccoglossus kowalevskii
ref|XP_010742461.1|  PREDICTED: serine palmitoyltransferase 2-like      160   5e-42    
emb|CCI10352.1|  unnamed protein product                                159   5e-42    Albugo candida
gb|AEB22067.1|  serine palmitoyl transferase                            149   6e-42    Solanum tuberosum [potatoes]
ref|XP_009317686.1|  PREDICTED: serine palmitoyltransferase 2           159   7e-42    Pygoscelis adeliae
ref|XP_005710134.1|  serine palmitoyltransferase, LCB2 subunit          159   7e-42    Chondrus crispus [carageen]
ref|XP_009279012.1|  PREDICTED: serine palmitoyltransferase 2           159   7e-42    Aptenodytes forsteri
ref|XP_011401812.1|  Serine palmitoyltransferase 2                      161   8e-42    Auxenochlorella protothecoides
ref|XP_010876930.1|  PREDICTED: serine palmitoyltransferase 2           160   8e-42    Esox lucius
ref|XP_002908237.1|  serine palmitoyltransferase, putative              158   9e-42    Phytophthora infestans T30-4
ref|XP_011488917.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    159   1e-41    
ref|XP_010010806.1|  PREDICTED: serine palmitoyltransferase 2           159   1e-41    Nestor notabilis
ref|XP_009512509.1|  PREDICTED: serine palmitoyltransferase 2           159   1e-41    Phalacrocorax carbo [common cormorant]
ref|XP_006263848.1|  PREDICTED: serine palmitoyltransferase 2           160   1e-41    
ref|NP_001085763.1|  serine palmitoyltransferase, long chain base...    159   1e-41    Xenopus laevis [clawed frog]
ref|NP_001018455.1|  serine palmitoyltransferase 2                      159   1e-41    Danio rerio [leopard danio]
ref|XP_005502422.1|  PREDICTED: serine palmitoyltransferase 2           159   1e-41    Columba livia [carrier pigeon]
ref|XP_009644944.1|  PREDICTED: serine palmitoyltransferase 2           158   1e-41    Egretta garzetta
ref|XP_009988351.1|  PREDICTED: serine palmitoyltransferase 2           158   1e-41    Tauraco erythrolophus
ref|XP_002613183.1|  hypothetical protein BRAFLDRAFT_210501             158   2e-41    Branchiostoma floridae
gb|EMC83907.1|  Serine palmitoyltransferase 2                           158   2e-41    
ref|XP_008890515.1|  hypothetical protein PPTG_00771                    158   2e-41    Phytophthora parasitica INRA-310
ref|XP_009885296.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    158   2e-41    Charadrius vociferus
ref|XP_009705333.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Cariama cristata
ref|XP_009937612.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Opisthocomus hoazin [hoatzin]
ref|XP_009973956.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    158   2e-41    Tyto alba [Schleiereule]
ref|XP_009472775.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Nipponia nippon
ref|XP_009475844.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Pelecanus crispus
ref|XP_009580257.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    158   2e-41    Fulmarus glacialis
ref|XP_005417509.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Geospiza fortis
ref|XP_009080576.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Acanthisitta chloris
ref|XP_009992209.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Chaetura pelagica
ref|XP_005013979.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    
ref|XP_005990149.1|  PREDICTED: serine palmitoyltransferase 2           158   2e-41    Latimeria chalumnae
gb|EOB05513.1|  Serine palmitoyltransferase 2                           158   3e-41    Anas platyrhynchos [duck]
ref|XP_009565075.1|  PREDICTED: serine palmitoyltransferase 2           157   3e-41    Cuculus canorus
ref|XP_008923197.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    157   3e-41    
ref|XP_010643886.1|  PREDICTED: serine palmitoyltransferase 2           157   3e-41    
ref|XP_006157148.1|  PREDICTED: serine palmitoyltransferase 2           158   3e-41    Tupaia chinensis
dbj|GAM19483.1|  hypothetical protein SAMD00019534_026580               157   3e-41    Acytostelium subglobosum LB1
ref|XP_009907650.1|  PREDICTED: serine palmitoyltransferase 2           158   3e-41    Picoides pubescens
ref|XP_006746809.1|  PREDICTED: serine palmitoyltransferase 2           156   3e-41    Leptonychotes weddellii
ref|XP_008400962.1|  PREDICTED: serine palmitoyltransferase 2-like      158   3e-41    Poecilia reticulata
ref|XP_005605438.1|  PREDICTED: serine palmitoyltransferase 2           157   3e-41    
ref|XP_010710079.1|  PREDICTED: serine palmitoyltransferase 2           158   3e-41    Meleagris gallopavo [common turkey]
ref|XP_005148932.1|  PREDICTED: serine palmitoyltransferase 2           157   3e-41    Melopsittacus undulatus
ref|XP_008503410.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    158   3e-41    Calypte anna
ref|XP_010582073.1|  PREDICTED: serine palmitoyltransferase 2           157   4e-41    Haliaeetus leucocephalus
ref|XP_005321334.1|  PREDICTED: serine palmitoyltransferase 2           157   4e-41    Ictidomys tridecemlineatus
ref|XP_006778946.1|  PREDICTED: serine palmitoyltransferase 2           157   4e-41    
gb|EPY81318.1|  serine palmitoyltransferase 2                           157   4e-41    Camelus ferus
ref|XP_009523454.1|  hypothetical protein PHYSODRAFT_313276             157   4e-41    Phytophthora sojae
ref|XP_005812989.1|  PREDICTED: serine palmitoyltransferase 2-like      158   4e-41    
ref|XP_005520283.1|  PREDICTED: serine palmitoyltransferase 2           157   5e-41    Pseudopodoces humilis [Tibetan ground-jay]
gb|EHH62679.1|  hypothetical protein EGM_21088                          157   5e-41    Macaca fascicularis [crab eating macaque]
gb|EHH28079.1|  hypothetical protein EGK_18422                          157   5e-41    Macaca mulatta [rhesus macaque]
ref|XP_010333697.1|  PREDICTED: serine palmitoyltransferase 2           157   5e-41    Saimiri boliviensis boliviensis
gb|EFX74435.1|  hypothetical protein DAPPUDRAFT_307317                  157   5e-41    Daphnia pulex
ref|XP_010391694.1|  PREDICTED: serine palmitoyltransferase 2           157   5e-41    Corvus cornix cornix
ref|NP_001006483.1|  serine palmitoyltransferase 2                      157   5e-41    Gallus gallus [bantam]
ref|XP_008534913.1|  PREDICTED: serine palmitoyltransferase 2           157   6e-41    Equus przewalskii [Przewalski horse]
ref|XP_005534958.1|  serine palmitoyltransferase                        158   6e-41    Cyanidioschyzon merolae strain 10D
ref|XP_005479814.1|  PREDICTED: serine palmitoyltransferase 2           157   6e-41    
emb|CEG69772.1|  Putative Aminotransferase class I/classII              157   6e-41    Rhizopus microsporus
ref|XP_005749399.1|  PREDICTED: serine palmitoyltransferase 3-lik...    157   6e-41    Pundamilia nyererei
ref|XP_009100102.1|  PREDICTED: serine palmitoyltransferase 2           157   6e-41    Serinus canaria [canary]
emb|CEI88574.1|  Putative Serine palmitoyltransferase                   157   6e-41    Rhizopus microsporus
ref|XP_008637852.1|  PREDICTED: serine palmitoyltransferase 2           156   6e-41    Corvus brachyrhynchos
ref|XP_009523452.1|  hypothetical protein PHYSODRAFT_559005             156   6e-41    Phytophthora sojae
ref|XP_005936388.1|  PREDICTED: serine palmitoyltransferase 3-lik...    157   6e-41    
ref|XP_009868294.1|  PREDICTED: serine palmitoyltransferase 2           156   6e-41    Apaloderma vittatum
ref|XP_005561960.1|  PREDICTED: serine palmitoyltransferase 2 iso...    157   7e-41    Macaca fascicularis [crab eating macaque]
ref|XP_510095.3|  PREDICTED: serine palmitoyltransferase 2              157   7e-41    
ref|NP_004854.1|  serine palmitoyltransferase 2                         157   7e-41    Homo sapiens [man]
ref|XP_005390267.1|  PREDICTED: serine palmitoyltransferase 2 iso...    157   7e-41    
ref|XP_003808928.1|  PREDICTED: serine palmitoyltransferase 2           157   7e-41    Pan paniscus [bonobo]
ref|XP_008890516.1|  hypothetical protein PPTG_00772                    156   7e-41    Phytophthora parasitica INRA-310
gb|ETP54405.1|  hypothetical protein F442_00863                         156   7e-41    Phytophthora parasitica P10297
ref|XP_009210304.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    157   7e-41    
ref|XP_003260859.1|  PREDICTED: serine palmitoyltransferase 2           157   7e-41    Nomascus leucogenys [White-cheeked Gibbon]
gb|EPQ03912.1|  Serine palmitoyltransferase 2                           157   7e-41    Myotis brandtii
ref|XP_006206208.1|  PREDICTED: serine palmitoyltransferase 2           157   7e-41    
ref|XP_010946223.1|  PREDICTED: serine palmitoyltransferase 2           157   7e-41    Camelus bactrianus [camel]
ref|XP_007986302.1|  PREDICTED: serine palmitoyltransferase 2           157   7e-41    
ref|XP_005860247.1|  PREDICTED: serine palmitoyltransferase 2           157   8e-41    
ref|XP_006184643.1|  PREDICTED: serine palmitoyltransferase 2           157   8e-41    
ref|XP_010186730.1|  PREDICTED: serine palmitoyltransferase 3-like      152   8e-41    
ref|NP_001032174.1|  serine palmitoyltransferase 2                      157   8e-41    
ref|XP_005561961.1|  PREDICTED: serine palmitoyltransferase 2 iso...    157   8e-41    
ref|XP_005047542.1|  PREDICTED: serine palmitoyltransferase 2 iso...    156   8e-41    
ref|XP_002719617.2|  PREDICTED: serine palmitoyltransferase 2           157   8e-41    
ref|XP_010381027.1|  PREDICTED: serine palmitoyltransferase 2           157   8e-41    
ref|XP_003787114.1|  PREDICTED: serine palmitoyltransferase 2           157   8e-41    
ref|XP_004649436.1|  PREDICTED: serine palmitoyltransferase 2           157   9e-41    
gb|EDL81646.1|  protein-O-mannosyltransferase 2, isoform CRA_a          157   9e-41    
ref|XP_006087019.1|  PREDICTED: serine palmitoyltransferase 2           157   9e-41    
ref|XP_005749398.1|  PREDICTED: serine palmitoyltransferase 3-lik...    157   9e-41    
ref|XP_004887616.1|  PREDICTED: serine palmitoyltransferase 2           157   9e-41    
ref|XP_002754273.2|  PREDICTED: serine palmitoyltransferase 2           157   9e-41    
ref|NP_035609.1|  serine palmitoyltransferase 2                         157   9e-41    
ref|XP_004559826.1|  PREDICTED: serine palmitoyltransferase 3-like      157   9e-41    
ref|XP_002200055.2|  PREDICTED: serine palmitoyltransferase 2           156   1e-40    
gb|KFZ48660.1|  Serine palmitoyltransferase 3                           152   1e-40    
ref|XP_004837176.1|  PREDICTED: serine palmitoyltransferase 2           157   1e-40    
ref|XP_005936386.1|  PREDICTED: serine palmitoyltransferase 3-lik...    157   1e-40    
ref|XP_005390266.1|  PREDICTED: serine palmitoyltransferase 2 iso...    156   1e-40    
ref|XP_007095366.1|  PREDICTED: serine palmitoyltransferase 2           156   1e-40    
dbj|BAA25452.2|  KIAA0526 protein                                       157   1e-40    
ref|XP_010974728.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    156   1e-40    
ref|XP_002908238.1|  serine palmitoyltransferase, putative              155   1e-40    
ref|XP_007431401.1|  PREDICTED: serine palmitoyltransferase 2 iso...    155   1e-40    
ref|XP_006807001.1|  PREDICTED: serine palmitoyltransferase 3-lik...    156   1e-40    
ref|XP_011355387.1|  PREDICTED: serine palmitoyltransferase 2 iso...    156   2e-40    
ref|XP_006925548.1|  PREDICTED: serine palmitoyltransferase 2           156   2e-40    
ref|XP_010842693.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_008701100.1|  PREDICTED: serine palmitoyltransferase 2           156   2e-40    
ref|XP_011355388.1|  PREDICTED: serine palmitoyltransferase 2 iso...    156   2e-40    
ref|XP_003987918.1|  PREDICTED: serine palmitoyltransferase 2           156   2e-40    
ref|XP_003408845.1|  PREDICTED: serine palmitoyltransferase 2           156   2e-40    
ref|XP_004399370.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_002926395.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_005438817.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_003472501.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_005243943.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_004426463.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
gb|ELR47117.1|  Serine palmitoyltransferase 2                           155   2e-40    
ref|XP_006807000.1|  PREDICTED: serine palmitoyltransferase 3-lik...    155   2e-40    
ref|XP_004681719.1|  PREDICTED: serine palmitoyltransferase 2           155   2e-40    
ref|XP_004739221.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
ref|XP_008055245.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
ref|XP_008117220.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
ref|XP_004699112.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
ref|XP_005656496.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
ref|XP_005908476.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    155   3e-40    
gb|ESA21945.1|  hypothetical protein GLOINDRAFT_342892                  155   3e-40    
ref|XP_007939522.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
ref|XP_003441227.1|  PREDICTED: serine palmitoyltransferase 3 iso...    155   3e-40    
emb|CDS03531.1|  hypothetical protein LRAMOSA00933                      155   3e-40    
ref|XP_008137006.1|  PREDICTED: serine palmitoyltransferase 2           155   3e-40    
gb|KFP31443.1|  Serine palmitoyltransferase 3                           150   3e-40    
ref|XP_005706634.1|  serine palmitoyltransferase                        155   3e-40    
ref|XP_010199542.1|  PREDICTED: serine palmitoyltransferase 3           150   3e-40    
ref|XP_003411518.2|  PREDICTED: serine palmitoyltransferase 3           155   3e-40    
gb|ERE72836.1|  serine palmitoyltransferase 2                           154   3e-40    
ref|XP_001373999.2|  PREDICTED: serine palmitoyltransferase 2           155   4e-40    
ref|XP_004453603.1|  PREDICTED: serine palmitoyltransferase 2           155   4e-40    
ref|XP_006052949.1|  PREDICTED: serine palmitoyltransferase 2           155   4e-40    
ref|NP_001092551.1|  serine palmitoyltransferase 2                      155   4e-40    
ref|XP_010161310.1|  PREDICTED: serine palmitoyltransferase 3-like      149   5e-40    
ref|XP_008940980.1|  PREDICTED: serine palmitoyltransferase 3-like      150   5e-40    
gb|KFQ19135.1|  Serine palmitoyltransferase 3                           150   5e-40    
ref|XP_005474018.1|  PREDICTED: serine palmitoyltransferase 3 iso...    155   5e-40    
ref|XP_007459840.1|  PREDICTED: serine palmitoyltransferase 2           154   5e-40    
ref|XP_005967637.1|  PREDICTED: serine palmitoyltransferase 2           154   6e-40    
ref|XP_007531255.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    154   6e-40    
gb|AFW60622.1|  hypothetical protein ZEAMMB73_847772                    154   6e-40    
ref|XP_635115.1|  serine C-palmitoyltransferase subunit                 154   6e-40    
ref|XP_006990382.1|  PREDICTED: serine palmitoyltransferase 2           154   6e-40    
ref|XP_007431400.1|  PREDICTED: serine palmitoyltransferase 2 iso...    154   7e-40    
ref|XP_008588506.1|  PREDICTED: serine palmitoyltransferase 2 iso...    154   7e-40    
ref|XP_006894811.1|  PREDICTED: serine palmitoyltransferase 3           154   7e-40    
ref|XP_004584633.1|  PREDICTED: serine palmitoyltransferase 2           154   7e-40    
ref|XP_010865155.1|  PREDICTED: serine palmitoyltransferase 3           151   7e-40    
ref|XP_008588501.1|  PREDICTED: serine palmitoyltransferase 2 iso...    154   8e-40    
emb|CEI99151.1|  Putative Serine palmitoyltransferase                   149   8e-40    
ref|XP_008838153.1|  PREDICTED: serine palmitoyltransferase 2           154   8e-40    
ref|XP_002938915.1|  PREDICTED: serine palmitoyltransferase 2           154   8e-40    
ref|NP_001233609.1|  serine palmitoyltransferase 2                      154   8e-40    
ref|XP_002711016.1|  PREDICTED: serine palmitoyltransferase 3           154   8e-40    
ref|XP_002951879.1|  hypothetical protein VOLCADRAFT_92508              157   9e-40    
ref|XP_005084054.1|  PREDICTED: serine palmitoyltransferase 2           154   9e-40    
gb|KFV97396.1|  Serine palmitoyltransferase 3                           150   9e-40    
ref|XP_007068889.1|  PREDICTED: serine palmitoyltransferase 2           154   9e-40    
ref|XP_009809724.1|  PREDICTED: serine palmitoyltransferase 3-like      150   9e-40    
ref|XP_004010868.1|  PREDICTED: serine palmitoyltransferase 2           154   9e-40    
ref|XP_009579627.1|  PREDICTED: serine palmitoyltransferase 3-like      150   9e-40    
ref|XP_005686244.1|  PREDICTED: serine palmitoyltransferase 2-like      154   9e-40    
ref|XP_004376519.1|  PREDICTED: serine palmitoyltransferase 3           154   9e-40    
ref|XP_006884832.1|  PREDICTED: serine palmitoyltransferase 2           154   1e-39    
emb|CDH48525.1|  serine palmitoyltransferase                            154   1e-39    
ref|XP_003289939.1|  serine C-palmitoyltransferase subunit              153   1e-39    
emb|CEP14917.1|  hypothetical protein                                   154   1e-39    
ref|XP_009511498.1|  PREDICTED: serine palmitoyltransferase 3-like      149   1e-39    
ref|XP_004262337.1|  PREDICTED: serine palmitoyltransferase 2           154   1e-39    
gb|KIZ01369.1|  serine palmitoyltransferase                             153   1e-39    
ref|XP_008588493.1|  PREDICTED: serine palmitoyltransferase 2 iso...    153   2e-39    
ref|XP_004359950.1|  serine C-palmitoyltransferase subunit              153   2e-39    
ref|XP_004371137.1|  PREDICTED: serine palmitoyltransferase 2           153   2e-39    
emb|CDS13464.1|  hypothetical protein LRAMOSA05640                      153   2e-39    
ref|XP_005343462.1|  PREDICTED: serine palmitoyltransferase 2           152   3e-39    
ref|XP_007184598.1|  PREDICTED: serine palmitoyltransferase 2           152   3e-39    
gb|KFH71158.1|  serine palmitoyltransferase                             152   3e-39    
ref|XP_004624949.1|  PREDICTED: serine palmitoyltransferase 2           152   3e-39    
ref|XP_003756275.1|  PREDICTED: serine palmitoyltransferase 2           144   5e-39    
ref|XP_009708146.1|  PREDICTED: serine palmitoyltransferase 3           151   5e-39    
ref|XP_005147521.1|  PREDICTED: serine palmitoyltransferase 3           152   6e-39    
ref|XP_004661509.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    152   6e-39    
emb|CBN76133.1|  Serine palmitoyltransferase                            150   6e-39    
ref|XP_009022446.1|  hypothetical protein HELRODRAFT_66644              151   7e-39    
gb|KFP60479.1|  Serine palmitoyltransferase 3                           151   7e-39    
ref|XP_006864826.1|  PREDICTED: serine palmitoyltransferase 2           151   7e-39    
gb|KFH65713.1|  serine palmitoyltransferase                             151   7e-39    
ref|XP_005160430.1|  PREDICTED: serine palmitoyltransferase 3 iso...    151   8e-39    
ref|XP_537524.3|  PREDICTED: serine palmitoyltransferase 2              151   8e-39    
ref|XP_005488564.1|  PREDICTED: serine palmitoyltransferase 3           151   9e-39    
ref|XP_004697882.1|  PREDICTED: serine palmitoyltransferase 3           151   1e-38    
ref|XP_008763045.1|  PREDICTED: serine palmitoyltransferase 2 iso...    151   1e-38    
ref|XP_006186834.1|  PREDICTED: serine palmitoyltransferase 3-like      145   1e-38    
gb|EIE85063.1|  hypothetical protein RO3G_09773                         151   1e-38    
ref|XP_005525490.1|  PREDICTED: serine palmitoyltransferase 3           151   1e-38    
dbj|GAN03028.1|  serine palmitoyltransferase protein                    151   1e-38    
ref|XP_004876895.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    150   1e-38    
ref|XP_001692248.1|  component of serine palmitoyltransferase           149   1e-38    
ref|XP_005301717.1|  PREDICTED: serine palmitoyltransferase 2 iso...    151   1e-38    
gb|EPB82229.1|  serine palmitoyltransferase                             151   1e-38    
gb|KFV72394.1|  Serine palmitoyltransferase 3                           150   1e-38    
ref|XP_005301718.1|  PREDICTED: serine palmitoyltransferase 2 iso...    150   1e-38    
gb|KFP99674.1|  Serine palmitoyltransferase 3                           150   1e-38    
gb|ELU16750.1|  hypothetical protein CAPTEDRAFT_165279                  150   1e-38    
ref|XP_009932517.1|  PREDICTED: serine palmitoyltransferase 3           150   1e-38    
ref|NP_001003562.1|  serine palmitoyltransferase 3                      150   1e-38    
ref|XP_005365590.1|  PREDICTED: serine palmitoyltransferase 3           150   1e-38    
ref|XP_009483184.1|  PREDICTED: serine palmitoyltransferase 3           150   1e-38    
ref|XP_007165324.1|  PREDICTED: serine palmitoyltransferase 3           150   1e-38    
gb|EWM21787.1|  serine palmitoyltransferase                             151   1e-38    
ref|XP_009952463.1|  PREDICTED: serine palmitoyltransferase 3           150   1e-38    
gb|KFU91545.1|  Serine palmitoyltransferase 3                           150   2e-38    
ref|XP_005995089.1|  PREDICTED: serine palmitoyltransferase 3 iso...    150   2e-38    
emb|CEG83685.1|  Putative Aminotransferase class I/classII              149   2e-38    
ref|XP_009911585.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_009905195.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
gb|KFO29017.1|  Serine palmitoyltransferase 3                           150   2e-38    
ref|XP_008825419.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_010118931.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_006816918.1|  PREDICTED: serine palmitoyltransferase 2-like      150   2e-38    
ref|XP_005995088.1|  PREDICTED: serine palmitoyltransferase 3 iso...    150   2e-38    
ref|XP_008499119.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
gb|KFQ62240.1|  Serine palmitoyltransferase 3                           150   2e-38    
gb|KFQ13427.1|  Serine palmitoyltransferase 3                           150   2e-38    
ref|XP_009893730.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_005380940.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    150   2e-38    
gb|KFP06332.1|  Serine palmitoyltransferase 3                           150   2e-38    
ref|XP_010150842.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_005238658.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
gb|KGL88305.1|  Serine palmitoyltransferase 3                           150   2e-38    
gb|KFV97820.1|  Serine palmitoyltransferase 3                           150   2e-38    
ref|XP_009998479.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_004634397.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    150   2e-38    
ref|XP_005068752.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
emb|CEG83281.1|  Putative Aminotransferase class I/classII              149   2e-38    
ref|XP_007105166.1|  PREDICTED: serine palmitoyltransferase 3-like      150   2e-38    
ref|XP_010632397.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_010284205.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_009317836.1|  PREDICTED: serine palmitoyltransferase 3           150   2e-38    
ref|XP_002682326.1|  serine C-palmitoyltransferase                      149   2e-38    
ref|XP_002197576.2|  PREDICTED: serine palmitoyltransferase 3           150   3e-38    
ref|XP_005428099.1|  PREDICTED: serine palmitoyltransferase 3           150   3e-38    
ref|XP_006116050.1|  PREDICTED: serine palmitoyltransferase 2           149   3e-38    
ref|XP_009280805.1|  PREDICTED: serine palmitoyltransferase 3           149   3e-38    
emb|CEP10201.1|  hypothetical protein                                   151   3e-38    
ref|XP_005320528.1|  PREDICTED: serine palmitoyltransferase 3           149   3e-38    
ref|XP_784261.1|  PREDICTED: serine palmitoyltransferase 2-like         149   3e-38    
gb|KFW89092.1|  Serine palmitoyltransferase 3                           149   3e-38    
ref|XP_006865685.1|  PREDICTED: serine palmitoyltransferase 3           149   4e-38    
ref|XP_010986859.1|  PREDICTED: serine palmitoyltransferase 3 iso...    147   4e-38    
ref|XP_004475329.1|  PREDICTED: serine palmitoyltransferase 3           149   5e-38    
ref|XP_005634837.1|  PREDICTED: serine palmitoyltransferase 3 iso...    149   5e-38    
emb|CEI86344.1|  Putative Serine palmitoyl transferase subunit          149   5e-38    
ref|XP_008931233.1|  PREDICTED: serine palmitoyltransferase 3           149   5e-38    
ref|XP_004276523.1|  PREDICTED: serine palmitoyltransferase 3           149   5e-38    
ref|XP_006114764.1|  PREDICTED: serine palmitoyltransferase 3-like      147   5e-38    
ref|XP_002155095.2|  PREDICTED: serine palmitoyltransferase 2-like      149   6e-38    
gb|EOB01188.1|  Serine palmitoyltransferase 3                           149   6e-38    
ref|XP_005974698.1|  PREDICTED: serine palmitoyltransferase 3           149   6e-38    
ref|XP_542889.2|  PREDICTED: serine palmitoyltransferase 3 isofor...    149   6e-38    
gb|ELK34571.1|  Serine palmitoyltransferase 3                           147   7e-38    
ref|XP_007064226.1|  PREDICTED: serine palmitoyltransferase 3           148   7e-38    
ref|XP_010307007.1|  PREDICTED: serine palmitoyltransferase 3           148   8e-38    
gb|KFR10371.1|  Serine palmitoyltransferase 3                           148   8e-38    
ref|XP_005687874.1|  PREDICTED: serine palmitoyltransferase 3           148   9e-38    
ref|XP_009071680.1|  PREDICTED: serine palmitoyltransferase 3           148   9e-38    
gb|KFO13972.1|  Serine palmitoyltransferase 3                           148   9e-38    
ref|XP_005019855.1|  PREDICTED: serine palmitoyltransferase 3 iso...    148   9e-38    
ref|XP_003788058.1|  PREDICTED: serine palmitoyltransferase 3           148   9e-38    
emb|CEG83280.1|  Putative Serine palmitoyltransferase 2                 148   9e-38    
ref|XP_008870566.1|  hypothetical protein H310_07061                    148   9e-38    
ref|XP_007450261.1|  PREDICTED: serine palmitoyltransferase 3           148   1e-37    
ref|XP_011368579.1|  PREDICTED: serine palmitoyltransferase 3           148   1e-37    
ref|XP_004611033.1|  PREDICTED: serine palmitoyltransferase 3           148   1e-37    
ref|XP_006143721.1|  PREDICTED: serine palmitoyltransferase 3           148   1e-37    
ref|XP_006071134.1|  PREDICTED: serine palmitoyltransferase 3-lik...    147   1e-37    
ref|XP_004014209.1|  PREDICTED: serine palmitoyltransferase 3           148   1e-37    
ref|XP_009870048.1|  PREDICTED: serine palmitoyltransferase 3           147   1e-37    
ref|XP_007546379.1|  PREDICTED: serine palmitoyltransferase 3           147   1e-37    
ref|XP_005604533.1|  PREDICTED: serine palmitoyltransferase 3 iso...    147   1e-37    
ref|XP_008562961.1|  PREDICTED: serine palmitoyltransferase 3           147   1e-37    
gb|KFP80488.1|  Serine palmitoyltransferase 3                           147   1e-37    
gb|KFO65436.1|  Serine palmitoyltransferase 3                           147   1e-37    
ref|XP_006921647.1|  PREDICTED: serine palmitoyltransferase 3           147   2e-37    
ref|XP_010401357.1|  PREDICTED: serine palmitoyltransferase 3 iso...    147   2e-37    
ref|XP_010401358.1|  PREDICTED: serine palmitoyltransferase 3 iso...    147   2e-37    
ref|XP_007476744.1|  PREDICTED: serine palmitoyltransferase 3 iso...    147   2e-37    
ref|XP_004333725.1|  serine palmitoyltransferase, long chain base...    147   2e-37    
ref|XP_008640227.1|  PREDICTED: serine palmitoyltransferase 3           147   2e-37    



>ref|XP_009761445.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
sylvestris]
Length=489

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI++LKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEFLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL KALEVISRVGDLVGIKYFPAEPKKQQLEENR+KLE
Sbjct  437  LARARICISAAHSREDLNKALEVISRVGDLVGIKYFPAEPKKQQLEENRVKLE  489



>dbj|BAE96963.1| serine palmitpoyltransferase subunit2 [Nicotiana tabacum]
 gb|ABW97709.1| serine palmitoyltransferase long chain base subunit [Nicotiana 
benthamiana]
Length=489

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI++LKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEFLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL KALEVISRVGDLVGIKYFPAEPKKQQLEENR+KLE
Sbjct  437  LARARICISAAHSREDLNKALEVISRVGDLVGIKYFPAEPKKQQLEENRVKLE  489



>ref|XP_009611514.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
tomentosiformis]
Length=489

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI++LKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEFLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL KALEVISRVGD+VGIKYFPAEPKKQQLEENR+KLE
Sbjct  437  LARARICISAAHSREDLNKALEVISRVGDVVGIKYFPAEPKKQQLEENRVKLE  489



>ref|XP_002284409.1| PREDICTED: long chain base biosynthesis protein 2a [Vitis vinifera]
Length=489

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIK LEVISRVGDLV IKYFPAEP+KQQLEE R+KLE
Sbjct  437  LARARICISASHTREDLIKGLEVISRVGDLVAIKYFPAEPRKQQLEEGRVKLE  489



>emb|CBI15735.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   311 bits (797),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  341  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  400

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  401  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  460

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIK LEVISRVGDLV IKYFPAEP+KQQLEE R+KLE
Sbjct  461  LARARICISASHTREDLIKGLEVISRVGDLVAIKYFPAEPRKQQLEEGRVKLE  513



>dbj|BAG68298.1| serine palmitoyltransferase [Nicotiana benthamiana]
Length=489

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI++LK+TCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEFLKHTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL KALEVISRVGDLVGIKYFPAEPKKQQLEENR+KLE
Sbjct  437  LARARICISAAHSREDLNKALEVISRVGDLVGIKYFPAEPKKQQLEENRVKLE  489



>ref|XP_010249161.1| PREDICTED: long chain base biosynthesis protein 2a [Nelumbo nucifera]
Length=489

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSP+MPIMLYNP+KIPAFSRECL+QNVA+VTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPIMPIMLYNPAKIPAFSRECLKQNVAIVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAHT+EDLIKALEVIS+VGDLVGIKYFPAEPKKQQ E+ RLKL+
Sbjct  437  LARARICISAAHTKEDLIKALEVISQVGDLVGIKYFPAEPKKQQEEDGRLKLD  489



>ref|XP_011083372.1| PREDICTED: long chain base biosynthesis protein 2a [Sesamum indicum]
Length=489

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLA+IRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLAKIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRRNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAHTREDL+KALEVIS VGDLVGIKYFPAEPKKQQLE  R+KLE
Sbjct  437  LARARICISAAHTREDLVKALEVISSVGDLVGIKYFPAEPKKQQLEGERVKLE  489



>ref|XP_006446964.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 ref|XP_006468873.1| PREDICTED: long chain base biosynthesis protein 2a-like [Citrus 
sinensis]
 gb|ESR60204.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 gb|KDO47368.1| hypothetical protein CISIN_1g046230mg [Citrus sinensis]
Length=489

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAA+QIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIKALEVISRVGDLVGIKYFPAEP+KQ  EE R+KLE
Sbjct  437  LARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEPRKQMEEEERMKLE  489



>gb|EYU24476.1| hypothetical protein MIMGU_mgv1a004686mg [Erythranthe guttata]
Length=515

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGS+ELIQ+LKYTCPAHLYATSISPPAAQQIIS+IKV+LGEDGSSRGA+KLA+IRE
Sbjct  343  GGYIAGSQELIQFLKYTCPAHLYATSISPPAAQQIISSIKVLLGEDGSSRGAQKLAKIRE  402

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++NVAVVTVAFPATPLL
Sbjct  403  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKRNVAVVTVAFPATPLL  462

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL+KALEVIS VGDLVGIKYFPAEPKKQQLE +R+KLE
Sbjct  463  LARARICISAAHSREDLVKALEVISTVGDLVGIKYFPAEPKKQQLEGDRVKLE  515



>ref|XP_004235384.1| PREDICTED: long chain base biosynthesis protein 2b [Solanum lycopersicum]
Length=489

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKY+CPAHLYATSISPPAAQQIISAIKVILGEDG+SRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEYLKYSCPAHLYATSISPPAAQQIISAIKVILGEDGTSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP+KIPAFSRECL+ NVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPAKIPAFSRECLKHNVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL KALEV S VGDL GIKYFPAEP+KQQ+EENR+KLE
Sbjct  437  LARARICISAAHSREDLNKALEVFSEVGDLTGIKYFPAEPQKQQVEENRVKLE  489



>ref|XP_008379061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Malus 
domestica]
Length=490

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI+GSKELIQYLKYTCPAHLYATSISPPAAQQII AIKV+LGEDGS+RGA+KLARIRE
Sbjct  317  GGYISGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIKVLLGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRL  192
            LARARICISA+HTREDLIKALEVI RVGDLVGIKYFPAEPKK Q EE RL
Sbjct  437  LARARICISASHTREDLIKALEVIGRVGDLVGIKYFPAEPKKAQAEEERL  486



>ref|XP_008231042.1| PREDICTED: long chain base biosynthesis protein 2a-like [Prunus 
mume]
Length=489

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGS+ELIQYLKYTCPAHLYATSISPPAA+QIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSEELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDL+KALEV  RVGDLVGIKYFPAEPKK Q EE  LKLE
Sbjct  437  LARARICISASHTREDLLKALEVFGRVGDLVGIKYFPAEPKKLQEEERLLKLE  489



>ref|XP_008341247.1| PREDICTED: long chain base biosynthesis protein 2a [Malus domestica]
Length=490

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQII AIKV+LGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIKVLLGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRL  192
            LARARICISA+HTREDLIKALEV  RVGDLVGIKYFPAEPKK Q EE RL
Sbjct  437  LARARICISASHTREDLIKALEVFGRVGDLVGIKYFPAEPKKAQAEEERL  486



>emb|CDO98665.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQY+KYTCPAHLYATSISPPAAQQIISAI+VILGEDG+SRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYMKYTCPAHLYATSISPPAAQQIISAIRVILGEDGTSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMP+MLYNP+KIPAFSRECL+  VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPVMLYNPAKIPAFSRECLKNQVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIKALEV S+VGDL+GIKYFPAEP KQQ +E R+KLE
Sbjct  437  LARARICISASHTREDLIKALEVFSKVGDLIGIKYFPAEPDKQQQDEGRVKLE  489



>ref|XP_006364387.1| PREDICTED: long chain base biosynthesis protein 2b-like [Solanum 
tuberosum]
Length=489

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKY+CPAHLYATSISPPAAQQIISAIKVILGEDG+SRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEYLKYSCPAHLYATSISPPAAQQIISAIKVILGEDGTSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP KIPAFSRECL++NVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPGKIPAFSRECLKRNVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL  ALEVIS+VGDL GIKYFPAEP+KQQ+EENR+KLE
Sbjct  437  LARARICISAAHSREDLNIALEVISKVGDLTGIKYFPAEPQKQQVEENRVKLE  489



>ref|XP_010678318.1| PREDICTED: long chain base biosynthesis protein 2a [Beta vulgaris 
subsp. vulgaris]
Length=489

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLY TSISPPAAQQI+SAIKV+LGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYGTSISPPAAQQIMSAIKVLLGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNVAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDL++ALEVIS VGDLVGIKYFPAEP+K+  E   +KL+
Sbjct  437  LARARICISASHTREDLVRALEVISNVGDLVGIKYFPAEPRKEHRENGMVKLD  489



>ref|XP_007031988.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY02914.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=454

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 170/173 (98%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILG+DGS+RGA+KLA+IRE
Sbjct  283  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGQDGSNRGAQKLAQIRE  342

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  343  NSNFFRSELIKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  402

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIKALEVISRVGDLVGIKYFPAEP+KQQ EE R+KLE
Sbjct  403  LARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEPEKQQQEE-RMKLE  454



>ref|XP_007209963.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
 gb|EMJ11162.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
Length=487

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 168/173 (97%), Gaps = 2/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKE+IQYLKYTCPAHLYATS+SPPAAQQIISAIKVILGEDG+SRGA+KLARIRE
Sbjct  317  GGYIAGSKEVIQYLKYTCPAHLYATSVSPPAAQQIISAIKVILGEDGTSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDL++ALEVISRVGDLVGIKYFPAEP KQ  E N +KLE
Sbjct  437  LARARICISASHTKEDLLRALEVISRVGDLVGIKYFPAEPSKQ--ETNAIKLE  487



>ref|XP_007031987.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY02913.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=489

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 170/173 (98%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILG+DGS+RGA+KLA+IRE
Sbjct  318  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGQDGSNRGAQKLAQIRE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  378  NSNFFRSELIKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIKALEVISRVGDLVGIKYFPAEP+KQQ EE R+KLE
Sbjct  438  LARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEPEKQQQEE-RMKLE  489



>ref|XP_006347368.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006347369.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Solanum tuberosum]
Length=489

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILG DGSSRGA+KLA+IRE
Sbjct  317  GGYIAGSKELIEYLKYTCPAHLYATSISPPAAQQIISSIKVILGVDGSSRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKRKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+R+DLIKALEVIS VGDLVGIKYFPAEP K+QLE NR+KLE
Sbjct  437  LARARICISAAHSRDDLIKALEVISEVGDLVGIKYFPAEPNKEQLEANRVKLE  489



>ref|XP_011042943.1| PREDICTED: long chain base biosynthesis protein 2a [Populus euphratica]
Length=489

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDL+KALEVIS+VGDLVGIKYFPAE  KQ  E   LKLE
Sbjct  437  LARARICISASHTKEDLLKALEVISQVGDLVGIKYFPAESDKQHQEPGALKLE  489



>ref|XP_004241473.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=489

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+I VILGEDGSSRGA+KLA+IRE
Sbjct  317  GGYIAGSKELIEYLKYTCPAHLYATSISPPAAQQIISSINVILGEDGSSRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKRKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+R+DLIKALEVIS VGDLVGIKYFP EP K+QLE NR+KLE
Sbjct  437  LARARICISAAHSRDDLIKALEVISEVGDLVGIKYFPVEPNKEQLEANRVKLE  489



>ref|XP_011073130.1| PREDICTED: long chain base biosynthesis protein 2b isoform X3 
[Sesamum indicum]
Length=489

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLK+ CPAHLYATSISPPAAQQI+S+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEYLKHNCPAHLYATSISPPAAQQIMSSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++NVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKRNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAHTREDL KALEVISRVGD+VG+KYFPAEPKKQQLE   +K++
Sbjct  437  LARARICISAAHTREDLTKALEVISRVGDMVGVKYFPAEPKKQQLEGEGIKMD  489



>ref|XP_009378026.1| PREDICTED: long chain base biosynthesis protein 2a [Pyrus x bretschneideri]
Length=490

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQII AIKV+LGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIKVLLGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRL  192
            LARARICISA+HTREDLIKALEV  RVGDLVGIKYFPA+PKK + EE RL
Sbjct  437  LARARICISASHTREDLIKALEVFGRVGDLVGIKYFPAQPKKAEAEEERL  486



>ref|XP_007038096.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY22597.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=489

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLY TSISPPAA+QIISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYTTSISPPAARQIISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QN+AVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNIAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAHT+EDL+KALEVIS VGD+VGIKYFPAEPKK +  ++ +KLE
Sbjct  437  LARARICISAAHTKEDLLKALEVISEVGDMVGIKYFPAEPKKLEQGKDTIKLE  489



>ref|XP_002318160.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEE96380.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKY CPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYNCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDL+KALEVIS+VGDLVGIKYFPAE  KQ  E   LKLE
Sbjct  437  LARARICISASHTKEDLLKALEVISQVGDLVGIKYFPAESDKQHQEPGALKLE  489



>ref|XP_007215280.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
 gb|EMJ16479.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
Length=488

 Score =   295 bits (756),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 166/173 (96%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGS ELIQYLKYTCPAHLYATSISPPAA+QIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGS-ELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGEDGSNRGAQKLARIRE  375

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  376  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  435

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDL+KALEV  RVGDLVGIKYFPAEPKK Q EE  LKLE
Sbjct  436  LARARICISASHTREDLLKALEVFGRVGDLVGIKYFPAEPKKLQEEERLLKLE  488



>ref|XP_010096046.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB62852.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=508

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDG++RGA+KL RIRE
Sbjct  336  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGTNRGAQKLLRIRE  395

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  396  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  455

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDL++ALEVISRVGDLVGIKYFPAEP KQ+ +E+  KL+
Sbjct  456  LARARICISASHTKEDLVQALEVISRVGDLVGIKYFPAEPNKQEQDESLKKLD  508



>emb|CAB44316.1| serine palmitoyltransferase [Solanum tuberosum]
Length=489

 Score =   295 bits (756),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKY+CPAHLYATSISPPAAQQIISAIKVILGEDG+SRGA+KLARIRE
Sbjct  317  GGYIAGSKELIEYLKYSCPAHLYATSISPPAAQQIISAIKVILGEDGTSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP KIPAFSRECL+++VAVV V FPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPGKIPAFSRECLKRSVAVVIVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDL  ALEVIS+VGDL GIKYFPAEP+KQQ+EE+R+KLE
Sbjct  437  LARARICISAAHSREDLNIALEVISKVGDLTGIKYFPAEPQKQQVEESRVKLE  489



>dbj|BAF01511.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
Length=246

 Score =   287 bits (734),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLK+ CPAHLYATSIS P+A QIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  74   GGYIAGSKDLIQYLKHQCPAHLYATSISTPSATQIISAIKVILGEDGSNRGAQKLARIRE  133

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+N+AVV V FPATPLL
Sbjct  134  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENLAVVVVGFPATPLL  193

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ++E+N +KL+
Sbjct  194  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEVEKNGIKLD  246



>dbj|BAC55228.1| serine palmitoyltransferase [Lotus japonicus]
Length=489

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGS+ELIQYLKYTCPAHLYATS+SPPAAQQIIS+IKVILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAGSQELIQYLKYTCPAHLYATSVSPPAAQQIISSIKVILGEDGSNRGAQKLAKIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDL+ AL+VISRVGDLVGIKYFPAEP KQQ E   +K +
Sbjct  437  LARARICISASHSREDLVTALQVISRVGDLVGIKYFPAEPSKQQQEGKTVKYD  489



>gb|KDP41837.1| hypothetical protein JCGZ_26855 [Jatropha curcas]
Length=489

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAA+QIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELIKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIKALEVIS+VGDLVGIKYFPAEP K + +   +KL+
Sbjct  437  LARARICISASHTKEDLIKALEVISQVGDLVGIKYFPAEPNKHEEDNKMVKLD  489



>ref|XP_008464380.1| PREDICTED: long chain base biosynthesis protein 2a [Cucumis melo]
Length=490

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLNQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            LARARICISA+HT++DL+KALEVISRVGDLVGIKYFPAE +KQQ E +
Sbjct  437  LARARICISASHTKDDLLKALEVISRVGDLVGIKYFPAEAQKQQSEND  484



>gb|KEH25646.1| long chain base biosynthesis 2a-like protein [Medicago truncatula]
Length=490

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLA+IRE
Sbjct  317  GGYIAGSKELIEYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLAKIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENR  195
            LARARICISA+H+REDL KAL+VIS VGDL+GIKYFPAEP KQQ ++ +
Sbjct  437  LARARICISASHSREDLTKALQVISSVGDLIGIKYFPAEPTKQQQQDGK  485



>ref|XP_010907607.1| PREDICTED: long chain base biosynthesis protein 2a [Elaeis guineensis]
Length=487

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 165/173 (95%), Gaps = 2/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIK LEVIS+VGDLVGIKYFPAEP K   E++R KLE
Sbjct  437  LARARICISASHTREDLIKGLEVISKVGDLVGIKYFPAEPPKH--EQDRKKLE  487



>gb|KHN13380.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=490

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQ+LKYTCPAHLYATSISPPAAQQIIS+I+VILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAGSKDLIQHLKYTCPAHLYATSISPPAAQQIISSIRVILGEDGSNRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVA+VTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAIVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENR  195
            LARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP KQQ E  +
Sbjct  437  LARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEPTKQQQEGGK  485



>ref|XP_003548027.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=490

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQ+LKYTCPAHLYATSISPPAAQQIIS+I+VILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAGSKDLIQHLKYTCPAHLYATSISPPAAQQIISSIRVILGEDGSNRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVA+VTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAIVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENR  195
            LARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP KQQ E  +
Sbjct  437  LARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEPTKQQQEGGK  485



>ref|XP_009150176.1| PREDICTED: long chain base biosynthesis protein 2b [Brassica 
rapa]
 emb|CDY37911.1| BnaA06g19060D [Brassica napus]
Length=489

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+ E++R+KL+
Sbjct  437  LARARICISASHSREDLIKALKVISKAGDLTGIKYFPAAPKKQEEEKDRIKLD  489



>ref|XP_004138028.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cucumis 
sativus]
 gb|KGN63448.1| hypothetical protein Csa_1G000720 [Cucumis sativus]
Length=490

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLNQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            LARARICISA+HT++DL+KALEVISRVGDLVGIKYFPAE +KQ  E +
Sbjct  437  LARARICISASHTKDDLLKALEVISRVGDLVGIKYFPAEAQKQHSEND  484



>ref|XP_004161364.1| PREDICTED: LOW QUALITY PROTEIN: long chain base biosynthesis 
protein 2a-like [Cucumis sativus]
Length=490

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLNQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            LARARICISA+HT++DL+KALEVISRVGDLVGIKYFPAE +KQ  E +
Sbjct  437  LARARICISASHTKDDLLKALEVISRVGDLVGIKYFPAEAQKQHSEND  484



>ref|XP_004304557.1| PREDICTED: long chain base biosynthesis protein 2a [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLK+TCPAHLYATSISPPAA+QIIS+IKV+LGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKHTCPAHLYATSISPPAAEQIISSIKVLLGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDL KAL+VI RVGDLVGIKYFPAEP+K Q +E  LKL+
Sbjct  437  LARARICISASHTREDLQKALDVIGRVGDLVGIKYFPAEPEKLQEDERVLKLD  489



>ref|XP_008791061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=487

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 165/173 (95%), Gaps = 2/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTR+DLIK LEVIS+VGDLVGIKYFPAEP K   E++R KLE
Sbjct  437  LARARICISASHTRDDLIKGLEVISKVGDLVGIKYFPAEPPKH--EQDRKKLE  487



>gb|KHG30176.1| Serine palmitoyltransferase 2 [Gossypium arboreum]
Length=496

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL+QYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELVQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HT+EDL+KALEVIS+VGD+VGIKYFPAEP K
Sbjct  437  LARARICISASHTKEDLLKALEVISQVGDMVGIKYFPAEPNK  478



>gb|KJB51269.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=478

 Score =   290 bits (743),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  299  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  358

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSP+MPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  359  NSNFFRSELQKMGFEVLGDNDSPIMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  418

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HT+EDL+KALEVIS+VGD+VGIKYFPAEP K
Sbjct  419  LARARICISASHTKEDLLKALEVISQVGDMVGIKYFPAEPNK  460



>dbj|BAH19645.1| AT5G23670 [Arabidopsis thaliana]
Length=242

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  70   GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  129

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  130  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  189

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  190  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQSKNDIKLD  242



>emb|CDX87007.1| BnaC03g52770D [Brassica napus]
Length=489

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+ E++R+KL+
Sbjct  437  LARARICISASHSREDLIKALKVISKAGDLTGIKYFPAAPKKQEEEKDRIKLD  489



>ref|XP_003518128.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=489

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQ+LKY CPAHLYATSISPPAAQQIIS+I+VILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAGSKDLIQHLKYACPAHLYATSISPPAAQQIISSIRVILGEDGSNRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP KQQ     +K +
Sbjct  437  LARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEPTKQQQGGKSVKFD  489



>ref|XP_006404217.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
 gb|ESQ45670.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
Length=489

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+ E+N +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEQEKNSIKLD  489



>gb|KJB51268.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=496

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSP+MPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPIMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HT+EDL+KALEVIS+VGD+VGIKYFPAEP K
Sbjct  437  LARARICISASHTKEDLLKALEVISQVGDMVGIKYFPAEPNK  478



>gb|KHN00617.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=505

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQ+LKY CPAHLYATSISPPAAQQIIS+I+VILGEDGS+RGA+KLA+IRE
Sbjct  333  GGYIAGSKDLIQHLKYACPAHLYATSISPPAAQQIISSIRVILGEDGSNRGAQKLAQIRE  392

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  393  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  452

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP KQQ     +K +
Sbjct  453  LARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEPTKQQQGGKSVKFD  505



>ref|XP_010929641.1| PREDICTED: long chain base biosynthesis protein 2a-like [Elaeis 
guineensis]
Length=487

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVA+VTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAIVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLK  189
            LARARICISA+HTREDLIK LEVIS+VGDLVGIKYFP EP K + ++ +L+
Sbjct  437  LARARICISASHTREDLIKGLEVISKVGDLVGIKYFPVEPPKHEQDQKKLE  487



>ref|XP_008775142.1| PREDICTED: long chain base biosynthesis protein 2a [Phoenix dactylifera]
Length=487

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 165/173 (95%), Gaps = 2/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK+ILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIKIILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKYFPAEP K   E++R KLE
Sbjct  437  LARARICISASHSREDLIKGLEVISKVGDLVGIKYFPAEPPK--YEQDRKKLE  487



>gb|ADN33867.1| serine palmitoyltransferase [Cucumis melo subsp. melo]
Length=170

 Score =   278 bits (711),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  680  KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRS  501
            +ELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRENSNFFRS
Sbjct  4    QELIKYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRENSNFFRS  63

Query  500  ELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARIC  321
            ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL QNVAVVTVAFPATPLLLARARIC
Sbjct  64   ELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLNQNVAVVTVAFPATPLLLARARIC  123

Query  320  ISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            ISA+HT++DL+KALEVISRVGDLVGIKYFPAE +KQQ E +
Sbjct  124  ISASHTKDDLLKALEVISRVGDLVGIKYFPAEAQKQQSEND  164



>ref|XP_002275468.1| PREDICTED: long chain base biosynthesis protein 2a isoform X2 
[Vitis vinifera]
 emb|CBI21293.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+T PAHLYATS+SPPA QQIISAIKVILGEDGS RGA+KLA+IRE
Sbjct  317  GGYIAGSKELIQYLKHTSPAHLYATSMSPPAVQQIISAIKVILGEDGSCRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQ MGFEVLGDNDSPVMPIMLYNP KIPAFSRECL+QNVAVV  AFPATPLL
Sbjct  377  NSNFFRSELQSMGFEVLGDNDSPVMPIMLYNPGKIPAFSRECLKQNVAVVMSAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIK LEVISRVGDLVGIKYFPA+PK+QQ EE   KL+
Sbjct  437  LARARICISASHTKEDLIKGLEVISRVGDLVGIKYFPAQPKEQQQEEKTSKLD  489



>ref|XP_010660694.1| PREDICTED: long chain base biosynthesis protein 2a isoform X1 
[Vitis vinifera]
Length=490

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+T PAHLYATS+SPPA QQIISAIKVILGEDGS RGA+KLA+IRE
Sbjct  318  GGYIAGSKELIQYLKHTSPAHLYATSMSPPAVQQIISAIKVILGEDGSCRGAQKLAQIRE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQ MGFEVLGDNDSPVMPIMLYNP KIPAFSRECL+QNVAVV  AFPATPLL
Sbjct  378  NSNFFRSELQSMGFEVLGDNDSPVMPIMLYNPGKIPAFSRECLKQNVAVVMSAFPATPLL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIK LEVISRVGDLVGIKYFPA+PK+QQ EE   KL+
Sbjct  438  LARARICISASHTKEDLIKGLEVISRVGDLVGIKYFPAQPKEQQQEEKTSKLD  490



>gb|ABW97708.1| serine palmitoyltransferase long chain base subunit [Brassica 
rapa subsp. chinensis]
Length=489

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+ E++ +KL+
Sbjct  437  LARARICISASHSREDLIKALKVISKAGDLTGIKYFPAAPKKQEEEKDGIKLD  489



>ref|XP_010036863.1| PREDICTED: long chain base biosynthesis protein 2a [Eucalyptus 
grandis]
 gb|KCW48524.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=489

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY+AGSKELIQYLK TCPAHLYATSISPPAAQQI+SAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYVAGSKELIQYLKNTCPAHLYATSISPPAAQQILSAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNF RSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+ NVAVVTVAFPATPLL
Sbjct  377  NSNFCRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKHNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLK  189
            LARARICISA+HT+EDL+KALEVIS VGDLVGIKYFPAEP K Q EE  +K
Sbjct  437  LARARICISASHTKEDLVKALEVISSVGDLVGIKYFPAEPNKLQKEEGMIK  487



>ref|XP_006290987.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
 gb|EOA23885.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
Length=489

 Score =   288 bits (736),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+N+AVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENLAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ  ++N +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQDQDKNGIKLD  489



>ref|NP_190447.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
 sp|Q9M304.1|LCB2B_ARATH RecName: Full=Long chain base biosynthesis protein 2b; Short=AtLCB2b; 
AltName: Full=Serine palmitoyltransferase 1; Short=AtSPT1 
[Arabidopsis thaliana]
 emb|CAB87906.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAK96680.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL24364.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 dbj|BAB78461.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM47981.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAP31959.1| At3g48780 [Arabidopsis thaliana]
 gb|AEE78455.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
Length=489

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLK+ CPAHLYATSIS P+A QIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKHQCPAHLYATSISTPSATQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+N+AVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENLAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ++E+N +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEVEKNGIKLD  489



>ref|XP_007151745.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
 gb|ESW23739.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
Length=487

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL+ YLK+ CPAHLYATSISPPAAQQIIS+I+VILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAGSKELVHYLKHACPAHLYATSISPPAAQQIISSIRVILGEDGSNRGAQKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQ  210
            LARARICISA+H+REDLIKAL+VISRVGDLVGIKYFPAEP KQQ
Sbjct  437  LARARICISASHSREDLIKALQVISRVGDLVGIKYFPAEPAKQQ  480



>ref|XP_009151545.1| PREDICTED: long chain base biosynthesis protein 2b-like [Brassica 
rapa]
Length=489

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+  ++ +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEEVKDTIKLD  489



>gb|KDO47369.1| hypothetical protein CISIN_1g040324mg [Citrus sinensis]
Length=488

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 165/173 (95%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKY CPAHLYATSISPPAA+QIISAI+V++GEDGS RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYNCPAHLYATSISPPAAEQIISAIQVVIGEDGSCRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRS+LQKMGFEVLGDNDSPVMPIM+YNP+K+ +FSRECL+QNVA+VTV FPATPLL
Sbjct  377  NSNFFRSKLQKMGFEVLGDNDSPVMPIMVYNPAKVSSFSRECLKQNVAIVTVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLI+ALEVISR+GDLVGIKYFPAEPKKQQ +   LKLE
Sbjct  437  LARARICISASHTKEDLIEALEVISRIGDLVGIKYFPAEPKKQQ-QVGMLKLE  488



>ref|XP_006446965.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
 gb|ESR60205.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
Length=488

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 165/173 (95%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKY CPAHLYATSISPPAA+QIISAI+V++GEDGS RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYNCPAHLYATSISPPAAEQIISAIQVVIGEDGSCRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRS+LQKMGFEVLGDNDSPVMPIM+YNP+K+ +FSRECL+QNVA+VTV FPATPLL
Sbjct  377  NSNFFRSKLQKMGFEVLGDNDSPVMPIMVYNPAKVSSFSRECLKQNVAIVTVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLI+ALEVISR+GDLVGIKYFPAEPKKQQ +   LKLE
Sbjct  437  LARARICISASHTKEDLIEALEVISRIGDLVGIKYFPAEPKKQQ-QVGMLKLE  488



>ref|XP_009403784.1| PREDICTED: long chain base biosynthesis protein 2a [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  319  GGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  379  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENR  195
            LARARICISA+H++EDL+K LEVIS+VGDLVGIKYFPAEP K   +E +
Sbjct  439  LARARICISASHSKEDLMKGLEVISKVGDLVGIKYFPAEPPKHAEQEKK  487



>emb|CDX68498.1| BnaC01g25760D [Brassica napus]
Length=489

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISA+KVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYQCPAHLYATSISTPSAQQIISAVKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+  ++ +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEEVKDTIKLD  489



>ref|XP_010515202.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
 ref|XP_010426376.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
Length=489

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLK+ CPAHLYATSIS P+AQQIISAI+VILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKHHCPAHLYATSISTPSAQQIISAIQVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+N+AVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENLAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ  E+N +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQDEEKNGIKLD  489



>gb|KFK34178.1| hypothetical protein AALP_AA5G110700 [Arabis alpina]
Length=489

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMG EVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGLEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDL+KAL+VIS+ GDL GIKYFPA PKKQ+ E++ +KL+
Sbjct  437  LARARICISASHSREDLVKALQVISKAGDLTGIKYFPAAPKKQEEEKDGIKLD  489



>ref|XP_002875925.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52184.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLK+ CPAHLYATSIS P+A QIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKHQCPAHLYATSISTPSATQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+ +AVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLREKLAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ++E+N +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEVEKNGIKLD  489



>ref|XP_008353440.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417009 
[Malus domestica]
Length=1099

 Score =   297 bits (760),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -1

Query  701   GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
             GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQII AIKV+LGEDGS+RGA+KLARIRE
Sbjct  926   GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIKVLLGEDGSNRGAQKLARIRE  985

Query  521   NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
             NSNFFRSELQKMGFEV GDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  986   NSNFFRSELQKMGFEVXGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  1045

Query  341   LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRL  192
             LARARICISA+HTREDLIKALEV  RVGDLVGIK FPAEPKK Q EE RL
Sbjct  1046  LARARICISASHTREDLIKALEVFGRVGDLVGIKXFPAEPKKAQAEEERL  1095



>ref|XP_006468870.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Citrus sinensis]
 ref|XP_006468871.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Citrus sinensis]
 ref|XP_006468872.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Citrus sinensis]
Length=488

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 165/173 (95%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKY CPAHLYATSISPPAA+QIISAI+V++GEDGS RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYNCPAHLYATSISPPAAEQIISAIQVVIGEDGSCRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRS+LQKMGFEVLGDNDSPVMPIM+YNP+K+ +FSRECL+QNVA+VTV FPATPLL
Sbjct  377  NSNFFRSKLQKMGFEVLGDNDSPVMPIMVYNPAKVSSFSRECLKQNVAIVTVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLI+ALEVI+R+GDLVGIKYFPAEPKKQQ +   LKLE
Sbjct  437  LARARICISASHTKEDLIEALEVINRIGDLVGIKYFPAEPKKQQ-QVGMLKLE  488



>ref|XP_009403558.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403559.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE++QYLKYTCPA+LYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  257  GGYIAASKEIVQYLKYTCPAYLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  316

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGD+DSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  317  NSNFFRSELQKMGFEVLGDSDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  376

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDLIK LEVIS+VGDL GIKYFP EP K + + ++ KLE
Sbjct  377  LARARICISAAHSREDLIKGLEVISKVGDLAGIKYFPVEPPKHETQGHK-KLE  428



>emb|CDX83048.1| BnaA01g20480D [Brassica napus]
Length=489

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAI VILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAITVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+  ++ +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQEEVKDTIKLD  489



>ref|XP_006287613.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
 gb|EOA20511.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
Length=489

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIKALKVISKVGDLSGIKYFPAEPKKIEQTKNDIKLD  489



>ref|XP_002512864.1| serine palmitoyltransferase, putative [Ricinus communis]
 gb|EEF49367.1| serine palmitoyltransferase, putative [Ricinus communis]
Length=488

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 165/173 (95%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAA+QIIS+IKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISSIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRE   + VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRE-XXKGVAVVTVAFPATPLL  435

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HT+EDLIKALEVIS+VGDLVGIKYFPAEP KQQ ++  +KL+
Sbjct  436  LARARICISASHTKEDLIKALEVISQVGDLVGIKYFPAEPNKQQEDDKIVKLD  488



>ref|XP_009421040.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=488

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LKYTCPAHLYATSISPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  319  GGYIAASKEIIQFLKYTCPAHLYATSISPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  379  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAE-PKKQQLEEN  198
            LARARICISA+H+REDL+K LEVIS+VGDLVGIKYFPAE PK  + ++N
Sbjct  439  LARARICISASHSREDLVKGLEVISKVGDLVGIKYFPAESPKLAEQKKN  487



>ref|XP_011073129.1| PREDICTED: long chain base biosynthesis protein 2b isoform X2 
[Sesamum indicum]
Length=498

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 168/204 (82%), Gaps = 31/204 (15%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRG---------  549
            GGYIAGSKELI+YLK+ CPAHLYATSISPPAAQQI+S+IKVILGEDGSSRG         
Sbjct  295  GGYIAGSKELIEYLKHNCPAHLYATSISPPAAQQIMSSIKVILGEDGSSRGWDLSALCLL  354

Query  548  ----------------------AEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIML  435
                                  A+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIML
Sbjct  355  HKTMFFVVYLQVTHFLHYVNTGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIML  414

Query  434  YNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGD  255
            YNP+KIPAFSRECL++NVAVVTVAFPATPLLLARARICISAAHTREDL KALEVISRVGD
Sbjct  415  YNPAKIPAFSRECLKRNVAVVTVAFPATPLLLARARICISAAHTREDLTKALEVISRVGD  474

Query  254  LVGIKYFPAEPKKQQLEENRLKLE  183
            +VG+KYFPAEPKKQQLE   +K++
Sbjct  475  MVGVKYFPAEPKKQQLEGEGIKMD  498



>ref|XP_007038095.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY22596.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=512

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 167/196 (85%), Gaps = 23/196 (12%)
 Frame = -1

Query  701  GGYIAGSK-----------------------ELIQYLKYTCPAHLYATSISPPAAQQIIS  591
            GGYIAGSK                       ELIQYLKYTCPAHLY TSISPPAA+QIIS
Sbjct  317  GGYIAGSKLLEGFYSVMMAGAIGKICPVIREELIQYLKYTCPAHLYTTSISPPAARQIIS  376

Query  590  AIKVILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPA  411
            AIKVILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPA
Sbjct  377  AIKVILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPA  436

Query  410  FSRECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFP  231
            FSRECL+QN+AVVTVAFPATPLLLARARICISAAHT+EDL+KALEVIS VGD+VGIKYFP
Sbjct  437  FSRECLKQNIAVVTVAFPATPLLLARARICISAAHTKEDLLKALEVISEVGDMVGIKYFP  496

Query  230  AEPKKQQLEENRLKLE  183
            AEPKK +  ++ +KLE
Sbjct  497  AEPKKLEQGKDTIKLE  512



>dbj|BAB03231.1| serine palmitoyltransferase [Arabidopsis thaliana]
Length=489

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQSKNDIKLD  489



>ref|NP_197756.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 ref|NP_001031932.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 sp|Q9LSZ9.1|LCB2A_ARATH RecName: Full=Long chain base biosynthesis protein 2a; Short=AtLCB2a; 
AltName: Full=Long chain base biosynthesis protein 
2; Short=AtLCB2 [Arabidopsis thaliana]
 dbj|BAA97234.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAK92764.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM91761.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AED93196.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 gb|AED93197.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
Length=489

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQSKNDIKLD  489



>ref|XP_002872066.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48325.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQSKNDIKLD  489



>ref|XP_010503519.1| PREDICTED: long chain base biosynthesis protein 2b-like [Camelina 
sativa]
Length=489

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LIQYLK+ CPAHLYATSIS P+AQQIISAI+VILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKDLIQYLKHHCPAHLYATSISTPSAQQIISAIQVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+N+AVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENLAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ  E+  +KL+
Sbjct  437  LARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAPKKQDEEKYGIKLD  489



>ref|XP_010493489.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL+QYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELVQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQTKNDIKLD  489



>ref|XP_010421176.1| PREDICTED: long chain base biosynthesis protein 2a [Camelina 
sativa]
Length=489

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL+QYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELVQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQTKNDIKLD  489



>ref|XP_009419359.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419360.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKY+CPAHLYATS+SPPA QQ+ISAIKVILGEDGSSRGA+KLA IRE
Sbjct  319  GGYIAASKEIIQYLKYSCPAHLYATSMSPPAVQQVISAIKVILGEDGSSRGAQKLAHIRE  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGD+DSPVMPIMLYNP+KIPAFSRECL+QNVA+VTVAFPATPLL
Sbjct  379  NSNFFRSELQKMGFEVLGDSDSPVMPIMLYNPAKIPAFSRECLKQNVAIVTVAFPATPLL  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH++EDLIK LEVIS+VGDLVGIKYFPAEP   Q + ++ KLE
Sbjct  439  LARARICISAAHSKEDLIKGLEVISKVGDLVGIKYFPAEPPNHQGQGHK-KLE  490



>ref|XP_010454654.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL+QYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELVQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEQTKNDIKLD  489



>ref|XP_009403557.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE++QYLKYTCPA+LYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  319  GGYIAASKEIVQYLKYTCPAYLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGD+DSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  379  NSNFFRSELQKMGFEVLGDSDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISAAH+REDLIK LEVIS+VGDL GIKYFP EP K + + ++ KLE
Sbjct  439  LARARICISAAHSREDLIKGLEVISKVGDLAGIKYFPVEPPKHETQGHK-KLE  490



>ref|XP_006394630.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31916.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=434

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  262  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  321

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIP+FSRECLRQ VAVV V FPATPLL
Sbjct  322  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPSFSRECLRQKVAVVVVGFPATPLL  381

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEPKK +  +N  KLE
Sbjct  382  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPKKIEETKNDTKLE  434



>ref|XP_011073128.1| PREDICTED: long chain base biosynthesis protein 2b isoform X1 
[Sesamum indicum]
Length=520

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 168/204 (82%), Gaps = 31/204 (15%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRG---------  549
            GGYIAGSKELI+YLK+ CPAHLYATSISPPAAQQI+S+IKVILGEDGSSRG         
Sbjct  317  GGYIAGSKELIEYLKHNCPAHLYATSISPPAAQQIMSSIKVILGEDGSSRGWDLSALCLL  376

Query  548  ----------------------AEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIML  435
                                  A+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIML
Sbjct  377  HKTMFFVVYLQVTHFLHYVNTGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIML  436

Query  434  YNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGD  255
            YNP+KIPAFSRECL++NVAVVTVAFPATPLLLARARICISAAHTREDL KALEVISRVGD
Sbjct  437  YNPAKIPAFSRECLKRNVAVVTVAFPATPLLLARARICISAAHTREDLTKALEVISRVGD  496

Query  254  LVGIKYFPAEPKKQQLEENRLKLE  183
            +VG+KYFPAEPKKQQLE   +K++
Sbjct  497  MVGVKYFPAEPKKQQLEGEGIKMD  520



>ref|XP_006828786.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
 gb|ERM96202.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
Length=487

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 163/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KL R+RE
Sbjct  316  GGYIAGSKELIQYLKYTCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLVRVRE  375

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR CL ++VAVVTVAFPATPLL
Sbjct  376  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRGCLEEDVAVVTVAFPATPLL  435

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLI+ LEVIS++GDL+GIKY P EP+KQ LE+ R KLE
Sbjct  436  LARARICISASHTREDLIRGLEVISQIGDLIGIKYLPMEPEKQHLED-REKLE  487



>ref|XP_004516386.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cicer 
arietinum]
Length=489

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGS+RGA+KL++IRE
Sbjct  317  GGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSNRGAQKLSKIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQN+AVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNIAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDL KAL+VIS VGDLVGIK    EP KQQ +   +K E
Sbjct  437  LARARICISASHSREDLTKALQVISSVGDLVGIKXXXXEPMKQQQDGKTVKFE  489



>gb|KFK27657.1| hypothetical protein AALP_AA8G411600 [Arabis alpina]
Length=489

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGD+DSPVMPIMLYNP+KIP+FSRECLRQNVAVV V FPATPLL
Sbjct  377  NSNFFRAELQKMGFEVLGDDDSPVMPIMLYNPAKIPSFSRECLRQNVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP+K +  ++ +KL+
Sbjct  437  LARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEPQKMEQTKHDIKLD  489



>ref|XP_009404745.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=489

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLK+TCPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLA IR+
Sbjct  319  GGYIAASKEIIQYLKHTCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLASIRQ  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVVTVAFPATPLL
Sbjct  379  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRRNVAVVTVAFPATPLL  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            LARARICISA+HTREDL+K L+VIS+VGDLVGIKYFPAEP K  +E+++  L
Sbjct  439  LARARICISASHTREDLMKGLDVISKVGDLVGIKYFPAEPPK-HVEQDKKTL  489



>ref|XP_010519476.1| PREDICTED: long chain base biosynthesis protein 2a [Tarenaya 
hassleriana]
Length=487

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL+Q+LK  CPAHLYATSISPPAAQQIIS+IKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAGSKELVQFLKKHCPAHLYATSISPPAAQQIISSIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+EL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVV V FPATPLL
Sbjct  377  NSNFFRAELHKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRL  192
            LARARICISA+H+REDLI+AL+VIS+VGD+ GIKYFPAEP K + +  +L
Sbjct  437  LARARICISASHSREDLIRALQVISKVGDVTGIKYFPAEPSKPEKDTTKL  486



>ref|XP_011002110.1| PREDICTED: long chain base biosynthesis protein 2a-like [Populus 
euphratica]
Length=489

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGF+V+GDNDSPV+ IMLYNP KIPAFSRECL+QNVAVV  AFPATPLL
Sbjct  377  NSNFFRSELQKMGFDVIGDNDSPVIAIMLYNPGKIPAFSRECLKQNVAVVMTAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICIS+ H  EDL+KALEVI++VGDL+GIKY PA   KQ  E++ +KLE
Sbjct  437  LARARICISSCHAMEDLLKALEVINQVGDLIGIKYSPAGSDKQHQEQDAMKLE  489



>gb|EEE52176.1| hypothetical protein OsJ_34042 [Oryza sativa Japonica Group]
Length=466

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK +CPAH+YATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  295  GGYIAASKEIIQHLKLSCPAHIYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  354

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  355  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVTVAFPATPLL  414

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP K   E +  KLE
Sbjct  415  LARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPKIA-EADHDKLE  466



>ref|NP_001148953.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACG33631.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN26506.1| unknown [Zea mays]
 tpg|DAA42006.1| TPA: Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK++CPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQHLKHSCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP K
Sbjct  437  LARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEPPK  478



>ref|XP_004979342.1| PREDICTED: long chain base biosynthesis protein 2a-like [Setaria 
italica]
Length=488

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK++CPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQHLKHSCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP K
Sbjct  437  LARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEPPK  478



>ref|XP_003577540.1| PREDICTED: long chain base biosynthesis protein 2a [Brachypodium 
distachyon]
Length=488

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 161/173 (93%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SK+LIQ+LK++CPAHLYATS+SPPA QQ+IS+IKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKDLIQHLKHSCPAHLYATSMSPPAVQQVISSIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+Q VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLI AL VISRVGDLVGIKYFPAEP K   E N  KLE
Sbjct  437  LARARICISASHTREDLINALNVISRVGDLVGIKYFPAEPPKIS-EANHDKLE  488



>ref|NP_001067972.1| Os11g0516000 [Oryza sativa Japonica Group]
 sp|Q2R3K3.1|LCB2A_ORYSJ RecName: Full=Long chain base biosynthesis protein 2a [Oryza 
sativa Japonica Group]
 gb|ABA93932.1| Serine palmitoyltransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28335.1| Os11g0516000 [Oryza sativa Japonica Group]
 gb|EEC68247.1| hypothetical protein OsI_36267 [Oryza sativa Indica Group]
Length=488

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK +CPAH+YATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQHLKLSCPAHIYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP K   E +  KLE
Sbjct  437  LARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPKIA-EADHDKLE  488



>ref|XP_002321740.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEF05867.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KL RIRE
Sbjct  317  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLERIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGF+V+GDNDSPV+ IMLYNP KIPAFSRECL+QNVAVV  AFPATPLL
Sbjct  377  NSNFFRSELQKMGFDVIGDNDSPVIAIMLYNPGKIPAFSRECLKQNVAVVMSAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA H  EDL+KALEVI++VGDL+GIKY PA   KQ  E+  +KLE
Sbjct  437  LARARICISACHAMEDLLKALEVINQVGDLIGIKYSPAGSDKQHQEQGAMKLE  489



>ref|NP_001151995.1| LOC100285632 [Zea mays]
 gb|ACG45307.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN25731.1| unknown [Zea mays]
 gb|AFW60856.1| Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I++LK++CPAHLYATS+SPPA QQ+ISAIKVILGEDGSSRGA+KLARIRE
Sbjct  317  GGYIAASKEIIKHLKHSCPAHLYATSMSPPAVQQVISAIKVILGEDGSSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N NFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  377  NGNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP K
Sbjct  437  LARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEPPK  478



>ref|XP_009150174.1| PREDICTED: long chain base biosynthesis protein 2b-like isoform 
X2 [Brassica rapa]
Length=410

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CP HLYATSIS P+AQQIISAI+VILGEDGS+RGA+KLARIRE
Sbjct  238  GGYIAGSKELIQYLKHHCPGHLYATSISTPSAQQIISAIRVILGEDGSNRGAQKLARIRE  297

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+KIPAFSRECLR+NVA+  V FPATPL+
Sbjct  298  NSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPAKIPAFSRECLRENVAIAVVGFPATPLM  357

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            L RARICISA+H+++DLIKALEVIS+VGDL GIKYFPA PKKQ+ E++ +KL
Sbjct  358  LGRARICISASHSKQDLIKALEVISKVGDLTGIKYFPAAPKKQEAEKDTIKL  409



>ref|XP_002450805.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
 gb|EES09793.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
Length=488

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK +CPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQHLKQSCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRRKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP K   E +  KLE
Sbjct  437  LARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEPPKIA-EADHDKLE  488



>ref|XP_006662956.1| PREDICTED: long chain base biosynthesis protein 2a-like [Oryza 
brachyantha]
Length=488

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK +CPAHLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQHLKLSCPAHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+EL+KMGFEVLG+NDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  377  NSNFFRAELKKMGFEVLGNNDSPVMPIMLYNPAKIPAFSRECLRQKVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP K   E +  KLE
Sbjct  437  LARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPKIA-EADHDKLE  488



>emb|CDY69570.1| BnaAnng30850D, partial [Brassica napus]
Length=402

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CP HLYATSIS P+AQQIISAI+VILGEDGS+RGA+KLARIRE
Sbjct  230  GGYIAGSKELIQYLKHHCPGHLYATSISTPSAQQIISAIRVILGEDGSNRGAQKLARIRE  289

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+KIPAFS+ECLR+NVA+  V FPATPL+
Sbjct  290  NSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPAKIPAFSKECLRENVAIPVVGFPATPLM  349

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            L RARICISA+H+++DLIKALEVIS+VGDL GIKYFPA PKKQ+ E++ +KL
Sbjct  350  LGRARICISASHSKQDLIKALEVISKVGDLTGIKYFPAAPKKQEAEKDTIKL  401



>ref|XP_008656901.1| PREDICTED: long chain base biosynthesis protein 2d [Zea mays]
 gb|ACG26228.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACL52834.1| unknown [Zea mays]
 gb|AFW84058.1| putative serine palmitoyltransferase [Zea mays]
Length=489

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S E+I +LK+TCPAH+YATS+SPPA QQ+ISAIKVILGEDG++RGA+KLA+IRE
Sbjct  317  GGYIAASNEIIHHLKHTCPAHIYATSMSPPAVQQVISAIKVILGEDGTNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQAVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E +K    EN  K++
Sbjct  437  LARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEQEKTTAVENLKKIQ  489



>ref|XP_009150173.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Brassica rapa]
Length=485

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CP HLYATSIS P+AQQIISAI+VILGEDGS+RGA+KLARIRE
Sbjct  313  GGYIAGSKELIQYLKHHCPGHLYATSISTPSAQQIISAIRVILGEDGSNRGAQKLARIRE  372

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+KIPAFSRECLR+NVA+  V FPATPL+
Sbjct  373  NSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPAKIPAFSRECLRENVAIAVVGFPATPLM  432

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            L RARICISA+H+++DLIKALEVIS+VGDL GIKYFPA PKKQ+ E++ +KL
Sbjct  433  LGRARICISASHSKQDLIKALEVISKVGDLTGIKYFPAAPKKQEAEKDTIKL  484



>ref|XP_006645277.1| PREDICTED: long chain base biosynthesis protein 2d-like [Oryza 
brachyantha]
Length=489

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIKVILGEDGSNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ+VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQHVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E +K    E   KL+
Sbjct  437  LARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEHEKTTSVEKTKKLQ  489



>ref|XP_004971156.1| PREDICTED: long chain base biosynthesis protein 2d-like [Setaria 
italica]
Length=489

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+TCPAH+YATS+SPPA QQ+ISAIKVILGEDG++RGA+KLA+IRE
Sbjct  317  GGYIAASKEIIHHLKHTCPAHIYATSMSPPAVQQVISAIKVILGEDGTNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK L VIS+VGDLVGIKYFP E +K    E   K++
Sbjct  437  LARARICISASHSREDLIKGLGVISKVGDLVGIKYFPVEQEKTAAVEKLKKIQ  489



>ref|NP_001045279.1| Os01g0928800 [Oryza sativa Japonica Group]
 sp|Q5JK39.1|LCB2D_ORYSJ RecName: Full=Long chain base biosynthesis protein 2d [Oryza 
sativa Japonica Group]
 dbj|BAD88168.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07193.1| Os01g0928800 [Oryza sativa Japonica Group]
 dbj|BAH00095.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72091.1| hypothetical protein OsI_05038 [Oryza sativa Indica Group]
 gb|EEE55940.1| hypothetical protein OsJ_04635 [Oryza sativa Japonica Group]
Length=489

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIKVILGEDGSNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ+VAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQHVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E +K    E   KL+
Sbjct  437  LARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEHEKTASVEKLKKLQ  489



>ref|XP_002459025.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
 gb|EES04145.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
Length=489

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S E+I +LK TCPAH+YATS+SPPA QQ+ISAIKVILGEDG++RGA+KLA+IRE
Sbjct  317  GGYIAASNEIIHHLKLTCPAHIYATSMSPPAVQQVISAIKVILGEDGTNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E +K    E   K++
Sbjct  437  LARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEQEKTTAVEKLKKIQ  489



>ref|XP_003564989.1| PREDICTED: long chain base biosynthesis protein 2d [Brachypodium 
distachyon]
Length=489

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK+ CPAH+YATS+SPPA QQ+ISAIKV+LGEDGS+RGA+KLA+IRE
Sbjct  318  GGYIAASKEIIQHLKHQCPAHIYATSMSPPAVQQVISAIKVVLGEDGSNRGAKKLAQIRE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  378  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEE  201
            LARARICISA+ +REDLIK LEVIS+VGDLVGIKYFP E +K   ++
Sbjct  438  LARARICISASQSREDLIKGLEVISKVGDLVGIKYFPVEQEKTSADK  484



>ref|XP_002450804.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
 gb|EES09792.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
Length=490

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SK++IQ+LK +CPAHLYATS+SPPA QQ+ISAIKVILGEDG++RGA+KLARIRE
Sbjct  319  GGYIAASKDIIQHLKQSCPAHLYATSMSPPAVQQVISAIKVILGEDGTNRGAQKLARIRE  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSREC RQ VAV++V+FP TPLL
Sbjct  379  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECFRQKVAVISVSFPVTPLL  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            L RARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAE  K
Sbjct  439  LGRARICISASHTREDLMKALDVISRVGDLVGIKYFPAESAK  480



>ref|XP_008678155.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Zea mays]
Length=464

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E++Q+LK+TCP HLYATS+SPPA QQ+ISAI+V+LGEDGSSRGA+KLARIRE
Sbjct  295  GGYIAASEEIVQHLKHTCPGHLYATSMSPPAVQQVISAIRVVLGEDGSSRGAQKLARIRE  354

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSREC RQ VAV+TVAFP TPLL
Sbjct  355  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECFRQKVAVITVAFPVTPLL  414

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARAR CISA+HTREDL KAL+VISRVGDLVGIKYFPA+  K
Sbjct  415  LARARFCISASHTREDLTKALDVISRVGDLVGIKYFPAQRPK  456



>gb|EMT23338.1| Serine palmitoyltransferase 2 [Aegilops tauschii]
Length=489

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIKV+LGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAASKEIIHHLKHACPAHIYATSMSPPAVQQVISAIKVVLGEDGSNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+ +REDLIK LEVIS+VGDL+GIKYFP E +K    +   KLE
Sbjct  437  LARARICISASQSREDLIKGLEVISKVGDLIGIKYFPVEQEKVASVDKLKKLE  489



>ref|XP_008678154.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Zea mays]
Length=491

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E++Q+LK+TCP HLYATS+SPPA QQ+ISAI+V+LGEDGSSRGA+KLARIRE
Sbjct  322  GGYIAASEEIVQHLKHTCPGHLYATSMSPPAVQQVISAIRVVLGEDGSSRGAQKLARIRE  381

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSREC RQ VAV+TVAFP TPLL
Sbjct  382  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECFRQKVAVITVAFPVTPLL  441

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARAR CISA+HTREDL KAL+VISRVGDLVGIKYFPA+  K
Sbjct  442  LARARFCISASHTREDLTKALDVISRVGDLVGIKYFPAQRPK  483



>emb|CDM85908.1| unnamed protein product [Triticum aestivum]
Length=757

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIKV+LGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAASKEIIHHLKHACPAHIYATSMSPPAVQQVISAIKVVLGEDGSNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            LARARICISA+ +REDLIK LEVIS+VGDL+GIKYFP E +KQ  E++
Sbjct  437  LARARICISASQSREDLIKGLEVISKVGDLIGIKYFPVEQEKQPQEQH  484



>ref|NP_001045278.1| Os01g0928700 [Oryza sativa Japonica Group]
 sp|Q8RYL0.1|LCB2C_ORYSJ RecName: Full=Long chain base biosynthesis protein 2c [Oryza 
sativa Japonica Group]
 dbj|BAB90752.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07192.1| Os01g0928700 [Oryza sativa Japonica Group]
 gb|EAY77077.1| hypothetical protein OsI_05037 [Oryza sativa Indica Group]
 gb|EAZ14710.1| hypothetical protein OsJ_04634 [Oryza sativa Japonica Group]
Length=497

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAI+VILGEDGS RGA+KLA+IRE
Sbjct  325  GGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIEVILGEDGSDRGAKKLAQIRE  384

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+K+PAFSRECLRQ VA+VTV+FPATPLL
Sbjct  385  NSNFFRSELEKMGFEVLGDNDSPVMPIMLYNPAKMPAFSRECLRQKVAIVTVSFPATPLL  444

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKY P E +K    E   K++
Sbjct  445  LARARICISASHSREDLIKGLEVISKVGDLVGIKYLPVEHEKTTSAEKLKKIQ  497



>gb|EMS46639.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=487

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATSISPPAAQQ+ISA+KVILGEDGS+RGA+KLARIRE
Sbjct  315  GGYIAASKEIIHHLKHACPAHIYATSISPPAAQQVISAMKVILGEDGSNRGAKKLARIRE  374

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N NFFR EL+KMGFEVLGDN SPVMPIMLYNP+K+PAFSRECLR+NVAV T+A+PATPLL
Sbjct  375  NGNFFRLELKKMGFEVLGDNGSPVMPIMLYNPAKMPAFSRECLRKNVAVCTIAYPATPLL  434

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+H+REDLIK LEVIS+VGDLVG+KY P E KK
Sbjct  435  LARARICISASHSREDLIKGLEVISKVGDLVGVKYCPVEEKK  476



>ref|XP_010322021.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=452

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKE+I+YLKYTCPAH+YA SISPPAAQQIISAIKV+LGEDGS RGA+K+AR+RE
Sbjct  288  GGYIAGSKEVIEYLKYTCPAHVYAISISPPAAQQIISAIKVLLGEDGSKRGAQKIARLRE  347

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGF+VLGD DSPVMPIMLYN +K+PAFSRECL+QNVAVV VAFPATPLL
Sbjct  348  NSNFFRSELQKMGFDVLGDYDSPVMPIMLYNIAKLPAFSRECLKQNVAVVVVAFPATPLL  407

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYF  234
            LARARICISAAH++EDLIKALEVI RVGDL+GIKY 
Sbjct  408  LARARICISAAHSKEDLIKALEVIGRVGDLLGIKYL  443



>gb|EMS48138.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=508

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 159/192 (83%), Gaps = 19/192 (10%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK+ CPAH+YATS+SPPA QQ+ISAIKV+LGEDGS+RGA+KLA+IRE
Sbjct  317  GGYIAASKEIIQHLKHACPAHIYATSMSPPAVQQVISAIKVVLGEDGSNRGAKKLAQIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALE-------------------VISRVGDLVGIKYFPAEPK  219
            LARARICISA+ +REDLIK LE                   VIS+VGDL+GIKYFP E +
Sbjct  437  LARARICISASQSREDLIKGLEIMRCVHNTSPDHNFMQIVQVISKVGDLIGIKYFPVEQE  496

Query  218  KQQLEENRLKLE  183
            K    +   KLE
Sbjct  497  KVASVDKLKKLE  508



>ref|XP_006645275.1| PREDICTED: long chain base biosynthesis protein 2b-like [Oryza 
brachyantha]
Length=498

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+KV+LGEDG+ RG +K+A+IR+
Sbjct  326  GGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMKVVLGEDGTDRGIKKIAQIRD  385

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQ+MGFEVLGDNDSPVMP M+YNP+K+PAFSRECLRQNVAVV V FPATPLL
Sbjct  386  NSNFFRSELQRMGFEVLGDNDSPVMPFMVYNPAKMPAFSRECLRQNVAVVPVGFPATPLL  445

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            L R RICISA+HTREDLIK LEVIS+VGDLVGIKYFP E ++    E + KL
Sbjct  446  LGRIRICISASHTREDLIKGLEVISKVGDLVGIKYFPVEQEETTSIEKQKKL  497



>ref|XP_010093950.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB54913.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=530

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKEL++YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDG+SRGA+KLARI E
Sbjct  333  GGYIAGSKELVEYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGTSRGAQKLARIGE  392

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++NVAVVTVAFPATPLL
Sbjct  393  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKKNVAVVTVAFPATPLL  452

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFP  231
            LARARICISA+H++EDL++ALEVIS VGDL+ +   P
Sbjct  453  LARARICISASHSKEDLLRALEVISEVGDLLHLTIPP  489



>ref|XP_008239635.1| PREDICTED: long chain base biosynthesis protein 2a [Prunus mume]
Length=464

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKE+IQYLKYTCPAHLYATS+SPPAAQQIISAIKVILGEDG+SRGA+KLARIRE
Sbjct  317  GGYIAGSKEVIQYLKYTCPAHLYATSVSPPAAQQIISAIKVILGEDGTSRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+QNVAVVTVAFPATPLL
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKQNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEV  273
            LARARICISA+HT+EDL++ALEV
Sbjct  437  LARARICISASHTKEDLLRALEV  459



>ref|XP_008678152.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
 ref|XP_008678153.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
Length=526

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  680  KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRS  501
            +E++Q+LK+TCP HLYATS+SPPA QQ+ISAI+V+LGEDGSSRGA+KLARIRENSNFFRS
Sbjct  364  QEIVQHLKHTCPGHLYATSMSPPAVQQVISAIRVVLGEDGSSRGAQKLARIRENSNFFRS  423

Query  500  ELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARIC  321
            EL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSREC RQ VAV+TVAFP TPLLLARAR C
Sbjct  424  ELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECFRQKVAVITVAFPVTPLLLARARFC  483

Query  320  ISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            ISA+HTREDL KAL+VISRVGDLVGIKYFPA+  K
Sbjct  484  ISASHTREDLTKALDVISRVGDLVGIKYFPAQRPK  518



>ref|XP_006645276.1| PREDICTED: long chain base biosynthesis protein 2c-like [Oryza 
brachyantha]
Length=492

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+I +LK+ CPAH+YATS+SPPA Q +ISAIKVILGEDGS+RGA+KL +IRE
Sbjct  322  GGYIAASKEIIDHLKHICPAHIYATSMSPPAVQLVISAIKVILGEDGSNRGAKKLFQIRE  381

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRS+LQKMGF+VLGDNDSPVMPIMLYNP+KIPAFSRECLRQ+VAVVTVAFPATPLL
Sbjct  382  NSNFFRSQLQKMGFQVLGDNDSPVMPIMLYNPAKIPAFSRECLRQHVAVVTVAFPATPLL  441

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEE  201
            LARARICISA+H+REDLIK LEVIS+VGDLVGIKY   E K   +EE
Sbjct  442  LARARICISASHSREDLIKGLEVISKVGDLVGIKYLKHE-KTTSVEE  487



>gb|ABR18369.1| unknown [Picea sitchensis]
Length=493

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LI+YLK   P HLYAT++SPPA QQ+ISA+KVILGEDGS+RGA+KLARIRE
Sbjct  316  GGYIAGSKDLIKYLKAVSPGHLYATAMSPPAVQQVISALKVILGEDGSNRGAQKLARIRE  375

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMG EVLGD+DSPVMPIMLYNP+KIPAFSRECL+++VAVV VAFPATPLL
Sbjct  376  NSNFFRAELQKMGCEVLGDHDSPVMPIMLYNPAKIPAFSRECLKRHVAVVGVAFPATPLL  435

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEE  201
            LARAR+C+SA+HT+EDL+KALEVIS V D+V IKYFP +P+KQ  EE
Sbjct  436  LARARMCLSASHTKEDLLKALEVISEVSDMVQIKYFPKDPEKQLKEE  482



>gb|EAY77076.1| hypothetical protein OsI_05036 [Oryza sativa Indica Group]
Length=499

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+KVILGEDG+ RGA+K+A+IR+
Sbjct  328  GGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMKVILGEDGTDRGAKKIAQIRD  387

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMP M+YNP+K+PAFSRECL+QNVAVV V FPATPLL
Sbjct  388  NSNFFRSELQKMGFEVLGDNDSPVMPFMVYNPAKMPAFSRECLKQNVAVVPVGFPATPLL  447

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            L R RICISA+H+REDLIK LEVIS VGDLVGIKY P E ++    E   KL
Sbjct  448  LGRIRICISASHSREDLIKGLEVISNVGDLVGIKYLPVEQEETTSVEKPKKL  499



>sp|Q8RYL1.1|LCB2B_ORYSJ RecName: Full=Long chain base biosynthesis protein 2b [Oryza 
sativa Japonica Group]
 dbj|BAB90751.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 gb|EAZ14709.1| hypothetical protein OsJ_04633 [Oryza sativa Japonica Group]
 dbj|BAH00934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=499

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+KVILGEDG+ RGA+K+A+IR+
Sbjct  328  GGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMKVILGEDGTDRGAKKIAQIRD  387

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFRSELQKMGFEVLGDNDSPVMP M+YNP+K+PAFSRECL+QNVAVV V FPATPLL
Sbjct  388  NSNFFRSELQKMGFEVLGDNDSPVMPFMVYNPAKMPAFSRECLKQNVAVVPVGFPATPLL  447

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            L R RICISA+H+REDLIK LEVIS VGDLVGIKY P E ++    E   KL
Sbjct  448  LGRIRICISASHSREDLIKGLEVISNVGDLVGIKYLPVEQEETTSVEKPKKL  499



>ref|NP_190448.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE78456.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
Length=350

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+L+QYLK   PAHLYATSIS PAAQQ+ISAIKVI G DGS+RG  KLARIRE
Sbjct  174  GGYIAGSKDLVQYLKQHYPAHLYATSISTPAAQQVISAIKVIFGVDGSNRGELKLARIRE  233

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGF+VLG  DSP+MPIMLYNP+KI AFSRECLR+N+A+V V+FP  PLL
Sbjct  234  NSNFFRAELQKMGFKVLGVYDSPIMPIMLYNPAKIAAFSRECLRENLAIVVVSFPPIPLL  293

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            LARARIC SA+H REDLIKAL+VISR GDL GIKYF A PKKQ+ E+N
Sbjct  294  LARARICNSASHLREDLIKALQVISRAGDLTGIKYFTAAPKKQE-EKN  340



>gb|KCW48525.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=501

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY+AGSKELIQYLK TCPAHLYATSISPPAAQQI+SAIKVILGEDGS+RGA+KLARIRE
Sbjct  317  GGYVAGSKELIQYLKNTCPAHLYATSISPPAAQQILSAIKVILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNF RSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL+ NVAVVTVAFPATPLL
Sbjct  377  NSNFCRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKHNVAVVTVAFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDL  252
            LARARICISA+HT+EDL+KALEVIS +  L
Sbjct  437  LARARICISASHTKEDLVKALEVISCICTL  466



>pir||T49275 serine C-palmitoyltransferase (EC 2.3.1.50) [similarity] - Arabidopsis 
thaliana (fragment)
 emb|CAB87907.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
Length=386

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+L+QYLK   PAHLYATSIS PAAQQ+ISAIKVI G DGS+RG  KLARIRE
Sbjct  210  GGYIAGSKDLVQYLKQHYPAHLYATSISTPAAQQVISAIKVIFGVDGSNRGELKLARIRE  269

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGF+VLG  DSP+MPIMLYNP+KI AFSRECLR+N+A+V V+FP  PLL
Sbjct  270  NSNFFRAELQKMGFKVLGVYDSPIMPIMLYNPAKIAAFSRECLRENLAIVVVSFPPIPLL  329

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            LARARIC SA+H REDLIKAL+VISR GDL GIKYF A PKKQ+ E+N
Sbjct  330  LARARICNSASHLREDLIKALQVISRAGDLTGIKYFTAAPKKQE-EKN  376



>gb|EEC72089.1| hypothetical protein OsI_05034 [Oryza sativa Indica Group]
Length=337

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  680  KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRS  501
            KE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+KVILGEDG+ RGA+K+A+IR+NSNFFRS
Sbjct  173  KEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMKVILGEDGTDRGAKKIAQIRDNSNFFRS  232

Query  500  ELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARIC  321
            ELQKMGFEVLGDNDSPVMP M+YNP+K+PAFSRECL+QNVAVV V FPATPLLL R RIC
Sbjct  233  ELQKMGFEVLGDNDSPVMPFMVYNPAKMPAFSRECLKQNVAVVPVGFPATPLLLGRIRIC  292

Query  320  ISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
            ISA+H+REDLIK LEVIS VGDLVGIKY P E ++    E   KL
Sbjct  293  ISASHSREDLIKGLEVISNVGDLVGIKYLPVEQEETTSVEKPKKL  337



>ref|XP_009411041.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=483

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+IQ+LK+ CPAHLYATS+SPPA QQ ISAIKV+LGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASEEIIQHLKHGCPAHLYATSMSPPAVQQAISAIKVVLGEDGSNRGAKKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            +SN+FRSEL+KMGF VLGDNDSPVM IMLYN +K+PAFSR CLRQNVAVV V +PATP+L
Sbjct  377  SSNYFRSELKKMGFVVLGDNDSPVMAIMLYNLAKLPAFSRACLRQNVAVVIVGYPATPVL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQ  210
            LARARICISA+HTREDLIK L+VI  VG LVG K  PAEP+K +
Sbjct  437  LARARICISASHTREDLIKGLKVIGEVGGLVGAKCLPAEPEKAK  480



>ref|XP_006394629.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31915.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=406

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIKVILGEDGS+RGA+KLARIRE
Sbjct  262  GGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIKVILGEDGSNRGAQKLARIRE  321

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIP+FSRECLRQ VAVV V FPATPLL
Sbjct  322  NSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPSFSRECLRQKVAVVVVGFPATPLL  381

Query  341  LARARICISAAHTREDLIKALE  276
            LARARICISA+H+REDLI+AL+
Sbjct  382  LARARICISASHSREDLIRALK  403



>ref|XP_002978032.1| hypothetical protein SELMODRAFT_108076 [Selaginella moellendorffii]
 gb|EFJ20689.1| hypothetical protein SELMODRAFT_108076 [Selaginella moellendorffii]
Length=477

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LI YLK   P H+YAT++SPP AQQ+ISA+KVI+GEDG+ RGA KLA++RE
Sbjct  320  GGYIAGSKDLIAYLKSISPGHMYATAMSPPVAQQVISAMKVIIGEDGTDRGARKLAQVRE  379

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR EL+KMGFEVLGD DSPVMPIMLYNP+KIPAFSRECLR+NVAVVTVAFPATPLL
Sbjct  380  NSNYFRQELRKMGFEVLGDRDSPVMPIMLYNPAKIPAFSRECLRRNVAVVTVAFPATPLL  439

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYF  234
            LARARICISA+HT+EDL +ALEVIS VGDLV IKYF
Sbjct  440  LARARICISASHTKEDLEQALEVISEVGDLVHIKYF  475



>ref|XP_002966707.1| hypothetical protein SELMODRAFT_86377 [Selaginella moellendorffii]
 gb|EFJ32734.1| hypothetical protein SELMODRAFT_86377 [Selaginella moellendorffii]
Length=477

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LI YLK   P H+YAT++SPP AQQ+ISA+KVI+GED + RGA KLA++RE
Sbjct  320  GGYIAGSKDLIAYLKSISPGHMYATAMSPPVAQQVISAMKVIIGEDDTDRGARKLAQVRE  379

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR EL+KMGFEVLGD DSPVMPIMLYNP+KIPAFSRECLR+NVAVVTVAFPATPLL
Sbjct  380  NSNYFRQELRKMGFEVLGDRDSPVMPIMLYNPAKIPAFSRECLRRNVAVVTVAFPATPLL  439

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYF  234
            LARARICISA+HT+EDL +ALEVIS VGDLV IKYF
Sbjct  440  LARARICISASHTKEDLEQALEVISEVGDLVHIKYF  475



>ref|XP_009394362.1| PREDICTED: long chain base biosynthesis protein 2d-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+I+YLK+ CPAHLYATS+SP A QQ+ISAIKV+LGEDGS+RGA+KLA+IRE
Sbjct  318  GGYIAASEEIIRYLKHACPAHLYATSMSPAAVQQVISAIKVVLGEDGSNRGAKKLAQIRE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
             SN+FRSEL+KMGF VLGDNDSPVM IMLYN +K+PAFSR CLRQNVAVVTV +PATP+L
Sbjct  378  GSNYFRSELKKMGFVVLGDNDSPVMAIMLYNLAKLPAFSRACLRQNVAVVTVGYPATPVL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            LARARICISA+HTREDL K L+VIS VG LVG K  PAEP+K
Sbjct  438  LARARICISASHTREDLNKGLKVISEVGGLVGAKCLPAEPEK  479



>ref|XP_001783810.1| predicted protein [Physcomitrella patens]
 gb|EDQ51402.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSKELIQY+K   PAH+YATS+S PA QQ+ISA++VILG DGS RGA+KLA++RE
Sbjct  318  GGYIAGSKELIQYMKSASPAHMYATSMSTPAVQQVISALEVILGLDGSDRGAKKLAQVRE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+ R EL+  GFEVLGD DSPVMP+MLYNP KIPAFSRECL++NVAVV VAFPATPLL
Sbjct  378  NSNYVRIELRNRGFEVLGDMDSPVMPVMLYNPGKIPAFSRECLKRNVAVVVVAFPATPLL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQ  210
            LAR R+C+SA+HTREDL +A++V+S VG++  IKYFP +  + +
Sbjct  438  LARTRVCMSASHTREDLDQAVKVLSEVGEMCNIKYFPRKASENE  481



>emb|CDX87006.1| BnaC03g52760D [Brassica napus]
Length=406

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  QIISAIKVILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPS  423
            QIISAI+VILGEDGS+RGA+KLARIRENSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+
Sbjct  267  QIISAIRVILGEDGSNRGAQKLARIRENSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPA  326

Query  422  KIPAFSRECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGI  243
            KIPAFSRECLR+NVA+  V FPATPL+L RARICISA+H+++DLIKALEVIS+VGDL G+
Sbjct  327  KIPAFSRECLRENVAIAVVGFPATPLMLGRARICISASHSKQDLIKALEVISKVGDLTGV  386

Query  242  KYFPAEPKKQQLEENRLKL  186
            KYFPA PKKQ+ E++ +KL
Sbjct  387  KYFPAAPKKQEEEKDTIKL  405



>ref|XP_008778939.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=554

 Score =   211 bits (537),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 104/106 (98%), Gaps = 0/106 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK+ILGEDGS+RGA+KLARIRE
Sbjct  317  GGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIKIILGEDGSNRGAQKLARIRE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQN  384
            NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQN
Sbjct  377  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQN  422



>ref|XP_008671350.1| PREDICTED: long chain base biosynthesis protein 2a-like [Zea 
mays]
Length=371

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI  S E+IQ+LK++CP HLYATS+SPP  Q +ISAIKVILGEDGS+RGA+KLARIRE
Sbjct  246  GGYIVASNEIIQHLKHSCPPHLYATSMSPPGVQHVISAIKVILGEDGSNRGAQKLARIRE  305

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQ  387
            NSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ
Sbjct  306  NSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQ  350



>gb|AAM82589.1|AF525281_1 serine palmitoyltransferase [Brassica oleracea]
Length=121

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -1

Query  545  EKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtv  366
            +KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V
Sbjct  1    QKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVV  60

Query  365  afpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  186
             FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA  KKQ+  ++ +KL
Sbjct  61   GFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAARKKQEEVKDTIKL  120

Query  185  E  183
            +
Sbjct  121  D  121



>tpg|DAA46316.1| TPA: hypothetical protein ZEAMMB73_317015 [Zea mays]
Length=500

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -1

Query  668  QYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRSELQK  489
            +Y  YT     ++      + + +   + V L +     GA+KLARIRENSNFFRSEL+K
Sbjct  340  KYKAYTYLDEAHSIGAVGQSGRGVCELLGVDLADVDIMMGAQKLARIRENSNFFRSELKK  399

Query  488  MGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISAA  309
            MGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ V VVTVAFPATPLLLARARICISA+
Sbjct  400  MGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVVVVTVAFPATPLLLARARICISAS  459

Query  308  HTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            HTREDLIKAL+VISRVGDLVGIKYFPAEP K
Sbjct  460  HTREDLIKALDVISRVGDLVGIKYFPAEPPK  490



>tpg|DAA63385.1| TPA: hypothetical protein ZEAMMB73_716052 [Zea mays]
Length=580

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -1

Query  668  QYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRSELQK  489
            +Y  YT     ++      + + +   + V L +     GA+KLARIRENSNFFRSEL+K
Sbjct  420  KYKAYTYLDEAHSIGAVGQSGRGVCELLGVDLADVDIMMGAQKLARIRENSNFFRSELKK  479

Query  488  MGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISAA  309
            MGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ V VVTVAFPATPLLLARARICISA+
Sbjct  480  MGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVVVVTVAFPATPLLLARARICISAS  539

Query  308  HTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            HTREDLIKAL+VISRVGDLVGIKYFPAEP K
Sbjct  540  HTREDLIKALDVISRVGDLVGIKYFPAEPPK  570



>tpg|DAA63387.1| TPA: hypothetical protein ZEAMMB73_716052 [Zea mays]
Length=638

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -1

Query  668  QYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRSELQK  489
            +Y  YT     ++      + + +   + V L +     GA+KLARIRENSNFFRSEL+K
Sbjct  478  KYKAYTYLDEAHSIGAVGQSGRGVCELLGVDLADVDIMMGAQKLARIRENSNFFRSELKK  537

Query  488  MGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISAA  309
            MGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ V VVTVAFPATPLLLARARICISA+
Sbjct  538  MGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVVVVTVAFPATPLLLARARICISAS  597

Query  308  HTREDLIKALEVISRVGDLVGIKYFPAEPKK  216
            HTREDLIKAL+VISRVGDLVGIKYFPAEP K
Sbjct  598  HTREDLIKALDVISRVGDLVGIKYFPAEPPK  628



>tpg|DAA38120.1| TPA: hypothetical protein ZEAMMB73_853430 [Zea mays]
Length=380

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = -1

Query  683  SKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFR  504
            + E+IQ+LK++CP HLYATS+SPP  Q +ISAIKVILGEDGS+RGA+KLARIRENSNFFR
Sbjct  229  ADEIIQHLKHSCPPHLYATSMSPPGVQHVISAIKVILGEDGSNRGAQKLARIRENSNFFR  288

Query  503  SELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQ  387
            SEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ
Sbjct  289  SELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQ  327



>ref|XP_002875926.1| hypothetical protein ARALYDRAFT_485233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52185.1| hypothetical protein ARALYDRAFT_485233 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 125/175 (71%), Gaps = 18/175 (10%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRG-------AE  543
            GGYIAGSK+LIQYLKY CPAHLYATSIS PAAQQ+IS IKVILGED S+RG         
Sbjct  168  GGYIAGSKDLIQYLKYHCPAHLYATSISTPAAQQVISVIKVILGEDASNRGNSIKLDRGT  227

Query  542  KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtva  363
            K+ + +     F +ELQKMG      N++          SKI AFSR  L++N+AVV V+
Sbjct  228  KVGKNKREQQLFWAELQKMGHA----NNA-------LQSSKIAAFSRAWLQENLAVVVVS  276

Query  362  fpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  198
            FPA PLLLARAR CIS +H REDLIKAL+VISRVGDL GI YF A PKKQ+ E+N
Sbjct  277  FPAIPLLLARARFCISVSHLREDLIKALKVISRVGDLTGIIYFTAAPKKQEDEKN  331



>gb|AFW88152.1| hypothetical protein ZEAMMB73_846491 [Zea mays]
Length=326

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  680  KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRS  501
            KE+IQ+LK++CP HLYATS+SPPA QQ+ISAIKVILGEDGS+RGA+KLARI ENSNFFRS
Sbjct  230  KEIIQHLKHSCPVHLYATSMSPPAVQQVISAIKVILGEDGSNRGAQKLARICENSNFFRS  289

Query  500  ELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  390
            EL+KMGFEVLGDNDS VMPIM YNP+KIPAFSRECLR
Sbjct  290  ELKKMGFEVLGDNDSHVMPIMFYNPAKIPAFSRECLR  326



>ref|XP_005647033.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE22489.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
Length=489

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG ++LI YL+   P H YATS++PPAAQQII+A++V+ G+DG+ RG+ K+A + E
Sbjct  317  GGYIAGDRDLIAYLRSVAPGHYYATSMAPPAAQQIIAALQVVSGQDGTDRGSRKIAALHE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR  L  MG  VLGD DSPVMP+ML+NP KI A SR C  + VA+V V FPATPLL
Sbjct  377  NSNYFRRRLLDMGCNVLGDWDSPVMPLMLFNPGKIAATSRLCWERGVALVVVGFPATPLL  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             ARARICISA+HTR+DL  ALEV+S   DLV  KY
Sbjct  437  TARARICISASHTRKDLDYALEVLSEACDLVMTKY  471



>ref|XP_005917126.1| PREDICTED: serine palmitoyltransferase 2-like [Haplochromis burtoni]
Length=241

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP AQQII+++K+I+GEDG++ GA++L ++ +
Sbjct  66   GGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSQ  125

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ FFR  L +MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  126  NTTFFRRRLHEMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  185

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  186  ESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  220



>emb|CAG00103.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=491

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL++   + LYATS+SPP AQQII+++K+I+GEDG++ GA++L ++ E
Sbjct  335  GGYIGGKKELIDYLRWHSHSALYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSE  394

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L +MGF + G+NDSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  395  NTTYFRRKLHEMGFILYGNNDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  454

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAHTRE L  AL+ IS VGDL+ +KY
Sbjct  455  ESRARFCISAAHTREMLDTALQAISEVGDLLQLKY  489



>ref|XP_005848468.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
 gb|EFN56366.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
Length=510

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGS EL+Q+L+  CPAHLYAT++SPPA + +ISA  VI G DGS RGA K+ ++R 
Sbjct  334  GGYIAGSAELVQFLRCQCPAHLYATAMSPPAVEMVISAFHVISGRDGSGRGAAKIGQLRA  393

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+N+FR  L ++G+ VLGD DSPVMPIML+NP+K+PA SR  LR+ +A+V V FPATPLL
Sbjct  394  NANYFRRRLLELGYNVLGDWDSPVMPIMLFNPAKLPAISRYMLRRGLAIVVVGFPATPLL  453

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             AR R+CISA+HT+ DL  ALEV   V     ++Y
Sbjct  454  TARMRVCISASHTKADLDYALEVFEEVAGRCHLRY  488



>ref|XP_003971560.1| PREDICTED: serine palmitoyltransferase 2-like [Takifugu rubripes]
Length=565

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL++   + LYATS+SPP AQQII+++K+I+GEDG++ GA++L+++ E
Sbjct  390  GGYIGGKKELIDYLRWHSHSALYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLSQLSE  449

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L +MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  450  NTTYFRRKLHEMGFILYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  509

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  AL+ IS VGDL+ +KY
Sbjct  510  ESRARFCVSAAHTREMLDTALQAISEVGDLLQLKY  544



>ref|XP_008280215.1| PREDICTED: serine palmitoyltransferase 2-like [Stegastes partitus]
Length=564

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + LYATS+SPP AQQII+++K+I+GEDG++ GA++L ++ E
Sbjct  389  GGYIGGKKELIDYLRRHSHSALYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSE  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L++MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTTYFRRKLREMGFIIYGNDDSPVVPMMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTRETLNTALEAISEVGDLLQLKY  543



>ref|XP_011401811.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28766.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=490

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY+A +K++I Y K  CPAHLYAT+++PPA Q ++SA+++I G DGS RGA KL+++R 
Sbjct  318  GGYVAANKDVIDYFKAQCPAHLYATAMTPPAVQMVLSALRLITGADGSDRGAHKLSQLRT  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+N+FRS L ++GF VLGD DSPVMP+M++ P+K+ A SRE LR  VAVV V FPATPLL
Sbjct  378  NANYFRSGLLRLGFNVLGDWDSPVMPVMIFQPAKLSATSREMLRLGVAVVEVGFPATPLL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +R R+CISA+HTR+DL  AL++   V +   I+Y
Sbjct  438  TSRMRVCISASHTRQDLDYALQLFDYVAERCDIRY  472



>ref|XP_005724923.1| PREDICTED: serine palmitoyltransferase 2-like [Pundamilia nyererei]
Length=564

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP AQQII+++K+I+GEDG++ GA++L ++ +
Sbjct  389  GGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSQ  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ FFR  L +MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTTFFRRRLHEMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_010789508.1| PREDICTED: serine palmitoyltransferase 2-like, partial [Notothenia 
coriiceps]
Length=243

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YA+S+SPP  +QII+++K I+GEDG++ G +++ ++ +
Sbjct  66   GGYIAGKRELIEYLRSHSHSAVYASSMSPPVVEQIITSMKCIMGEDGTTIGCDRVHQLAK  125

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +LQKMGF + G+ DSPV+P+MLY P+KI AFSRE L++N+ VV V FPATP++
Sbjct  126  NAVYFRRKLQKMGFIIYGNEDSPVVPMMLYMPAKIAAFSREMLKRNIGVVGVGFPATPII  185

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAHT++ L +AL VIS VGDLV +KY
Sbjct  186  ESRARFCISAAHTKDVLDRALSVISEVGDLVNLKY  220



>ref|XP_007566208.1| PREDICTED: serine palmitoyltransferase 2 [Poecilia formosa]
Length=564

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS++PP AQQII+++K I+GEDG+S G ++L ++ E
Sbjct  389  GGYIGGKKELIDYLRSHSHSAVYATSMAPPVAQQIITSMKTIMGEDGTSLGTDRLRQLSE  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+N+FR  L++MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTNYFRRRLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_003440868.1| PREDICTED: serine palmitoyltransferase 2-like [Oreochromis niloticus]
Length=564

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP AQQII+++K+I+GEDG++ GA++L ++ +
Sbjct  389  GGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSQ  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L +MGF + G+ DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTTYFRRSLHEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_010880781.1| PREDICTED: serine palmitoyltransferase 2-like [Esox lucius]
Length=584

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G +ELI YL+    + +YATS+SPP AQQII+++K+I+GEDG++ GA++L ++ E
Sbjct  396  GGYIGGKRELIDYLRSHSHSAIYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSE  455

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L++MGF + G+NDSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  456  NTTYFRRKLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  515

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTR+ L  ALE IS VGD++ +KY
Sbjct  516  ESRARFCVSAAHTRDMLDTALEAISEVGDVLQLKY  550



>ref|XP_008310964.1| PREDICTED: serine palmitoyltransferase 2 isoform X1 [Cynoglossus 
semilaevis]
 ref|XP_008310965.1| PREDICTED: serine palmitoyltransferase 2 isoform X2 [Cynoglossus 
semilaevis]
Length=564

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + LYATS+SPP AQQII+++K+I+GEDGS+ GA++L ++ +
Sbjct  389  GGYIGGKKELIDYLRSHSHSALYATSMSPPVAQQIITSMKIIMGEDGSTLGADRLRQLSQ  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L  MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTTYFRKKLWDMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGD++ +KY
Sbjct  509  ESRARFCVSAAHTREMLDIALEAISEVGDVLQLKY  543



>ref|XP_004083402.1| PREDICTED: serine palmitoyltransferase 2-like [Oryzias latipes]
Length=564

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + LYATS+SPP AQQIIS++K+I+GEDGS+ G ++L ++ E
Sbjct  389  GGYIGGRKELIDYLRCHSHSALYATSMSPPVAQQIISSMKIIMGEDGSTLGKDRLRQLSE  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L++MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTTYFRRKLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  AL  IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTALRAISEVGDLLQLKY  543



>ref|XP_010739223.1| PREDICTED: serine palmitoyltransferase 2 [Larimichthys crocea]
Length=564

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + LYATS+SPP AQQII+A+++I+GEDG+++GA +L ++ E
Sbjct  389  GGYIGGKKELIDYLRCHSHSALYATSMSPPVAQQIITAMRIIMGEDGTTQGAHRLRQLSE  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L  MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ +V V FPATP+ 
Sbjct  449  NTAYFRRKLNDMGFIIYGNKDSPVVPMMLYMPAKIGAFGREMLKRNIGIVAVGFPATPIT  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAHTRE L + L+VI  VGDL+ +KY
Sbjct  509  ESRARFCISAAHTREVLDQVLDVIDEVGDLLSLKY  543



>gb|ADY39561.1| putative serine palmitoyltransferase [Hottentotta judaicus]
Length=228

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK+LI YL+  C +  YATS+S P   QI SA+KVI+GEDG++ G +++ ++ +
Sbjct  63   GGYIAGSKDLINYLRSNCYSFSYATSMSSPVVCQITSAMKVIMGEDGTNEGQQRITQLAQ  122

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L++ GF + G+ DSPV+P++LY P+KIPAF RE L++ +A V VAFPATPL+
Sbjct  123  NTRYFRQKLKEKGFIIYGNKDSPVVPLLLYMPAKIPAFVRELLKRGIATVGVAFPATPLV  182

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAHTRE L KAL  I  VGDL+ +KY
Sbjct  183  ESRARFCISAAHTREMLDKALSAIDEVGDLLRLKY  217



>ref|XP_008396458.1| PREDICTED: serine palmitoyltransferase 2-like [Poecilia reticulata]
Length=564

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+ PP AQQII+++  I+GEDG++ GA++L ++ E
Sbjct  389  GGYIGGKKELIDYLRSHSHSAVYATSMPPPVAQQIITSMTTIMGEDGTTLGADRLKQLSE  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+N+FR  L++MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTNYFRRRLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_005809327.1| PREDICTED: serine palmitoyltransferase 2-like [Xiphophorus maculatus]
Length=564

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+ PP AQQII+++K+I+GEDG++ GA++L ++ E
Sbjct  389  GGYIGGKKELIDYLRSHSHSAVYATSMPPPVAQQIITSMKIIMGEDGTTLGADRLRQLSE  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+N+FR  L +MGF + G++DSPV+P+MLY P+KI AF RE +++N+  V V FPATP++
Sbjct  449  NTNYFRRRLCEMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMVKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>gb|AAM82590.1|AF525282_1 serine palmitoyltransferase [Brassica oleracea]
Length=103

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  491  KMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISA  312
            KM FEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V FPATPLLLARARICISA
Sbjct  1    KMEFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVVGFPATPLLLARARICISA  60

Query  311  AHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  183
            +H+REDLIKAL+VIS+ GDL GIKYFPA PKKQ+ E++R+KL+
Sbjct  61   SHSREDLIKALKVISKAGDLTGIKYFPAAPKKQEEEKDRIKLD  103



>emb|CDQ72138.1| unnamed protein product [Oncorhynchus mykiss]
Length=584

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G +ELI YL+    + +YAT++SPP +QQII+++K+I+GED ++ GAE+L ++ E
Sbjct  396  GGYIGGKRELIDYLRSHSHSSIYATAMSPPVSQQIITSMKIIMGEDNTTLGAERLKQLSE  455

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L++MGF + G+NDSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  456  NTTYFRRKLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  515

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTR+ L  ALE IS VGD++ +KY
Sbjct  516  ESRARFCVSAAHTRDMLDTALEAISEVGDVLQLKY  550



>ref|NP_001108213.1| serine palmitoyltransferase, long chain base subunit 2b [Danio 
rerio]
 gb|AAI59261.1| Zgc:175221 protein [Danio rerio]
Length=558

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  QQII+++K I+G+DG++ G E+L ++ E
Sbjct  384  GGYIGGKKELIDYLRLHSHSAVYATSMSPPITQQIITSMKCIMGKDGTTLGQERLRQLSE  443

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L +MGF + G+NDSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  444  NTTYFRRRLHEMGFIIYGNNDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  503

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  AL  IS VGDL+ +KY
Sbjct  504  ESRARFCVSAAHTREMLDTALNAISEVGDLLQLKY  538



>ref|XP_005820282.1| hypothetical protein GUITHDRAFT_98377 [Guillardia theta CCMP2712]
 gb|EKX33302.1| hypothetical protein GUITHDRAFT_98377 [Guillardia theta CCMP2712]
Length=694

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA +KE+I Y++   P  +YA S+SP    Q   A+++I GEDG+ +G +KL ++R 
Sbjct  379  GGYIASTKEVIDYIRRMSPGSIYACSMSPGCVTQASLALRMIAGEDGTDKGKKKLDQLRR  438

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN FR+ LQ+MG EVLG  DSPV+P+MLYNP+KIPAFSRECL + +AVV V FPATPL+
Sbjct  439  NSNLFRAGLQRMGCEVLGHTDSPVIPVMLYNPAKIPAFSRECLARKLAVVVVGFPATPLI  498

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +R R C+SAAHT EDLI AL+VI  V + V IKY
Sbjct  499  KSRVRFCLSAAHTEEDLISALKVIDEVAERVMIKY  533



>ref|XP_004349889.1| serine palmitoyltransferase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89979.1| serine palmitoyltransferase [Capsaspora owczarzaki ATCC 30864]
Length=508

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY AGSKE+I +++    +  +ATS+S P AQQIIS++ VI+G DG+  G  ++A++ +
Sbjct  341  GGYCAGSKEIINHMRTHAHSSFHATSMSAPVAQQIISSMTVIMGRDGTDDGQRRIAQLAD  400

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ FFR+EL+KMGF V G++ SP++P+M++  SKI AFSRECL++ V +V V FPATP++
Sbjct  401  NARFFRTELKKMGFIVYGNDASPIVPLMIFQASKIAAFSRECLKRGVGIVVVGFPATPII  460

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQ  213
             +RAR C+SA+HTREDL KAL VIS VG+L+G+K     P + 
Sbjct  461  TSRARFCLSASHTREDLEKALAVISEVGNLLGMKVSQKTPSRD  503



>emb|CAF94268.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=511

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG KELI+YL+    + +YATS+SPP  +QII+++K ++GEDG++ G E++ R+ E
Sbjct  334  GGYIAGKKELIEYLRSHSHSAVYATSMSPPVVEQIITSMKCVMGEDGTTIGRERIRRLAE  393

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  394  NTVYFRKRLREMGFTIYGNQDSPVIPMMLYMPAKIGAFGREMLKRNMGVVVVGFPATPII  453

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +R R CISAAHT++ L +AL VIS VGDL+ +KY
Sbjct  454  ESRVRFCISAAHTKQILDQALSVISEVGDLLQLKY  488



>ref|XP_004344667.1| serine palmitoyltransferase, long chain base subunit 2, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR20924.1| serine palmitoyltransferase, long chain base subunit 2, putative 
[Acanthamoeba castellanii str. Neff]
Length=516

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG K+ ++YL+ T    +Y  ++S P AQ IISA+ VI G DGS+ G +++  +R+
Sbjct  359  GGYIAGDKDFVRYLRQTSFCSMYEETMSIPCAQMIISALNVITGADGSNEGQKRIKALRD  418

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR++L+++GF V GD DSPV+P+MLY+P+KI  FSR CL +NVAVV V FPAT LL
Sbjct  419  NSNFFRNKLKELGFRVAGDEDSPVIPLMLYHPAKIAGFSRLCLLENVAVVVVGFPATSLL  478

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISA HTRE L +AL+ IS +GD + +KY
Sbjct  479  ASRARFCISAGHTREQLERALDSISDIGDRLMLKY  513



>dbj|BAD32243.1| mKIAA0526 protein [Mus musculus]
Length=178

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G+DG+S G E + ++ E
Sbjct  1    GGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAE  60

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  61   NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  120

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  121  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  155



>gb|ETM56090.1| hypothetical protein L914_00839 [Phytophthora parasitica]
Length=172

 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+I +++ +    +YATS+SP  AQQI++A+ ++ G DG+  G  KL  +RE
Sbjct  12   GGYIAASEEIISFIRNSSAGAIYATSLSPVIAQQILTALNIVAGLDGTDIGRNKLDSLRE  71

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR +L  MG   LGD DSPV+P+MLY+ SK+  +SRECL++N+AVVTV FPATPLL
Sbjct  72   NSNYFRQKLIDMGVITLGDFDSPVIPVMLYHMSKVGEYSRECLKRNLAVVTVGFPATPLL  131

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            L+R R CISAAHT+ED+ +AL+ I+ V ++  ++Y
Sbjct  132  LSRVRFCISAAHTKEDMDEALKAIAEVSEICHVRY  166



>ref|XP_002287833.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95276.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=622

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA  K ++  L+  C    Y  S+SP   QQIIS+ KVI+GEDG++ G +KL  +R+
Sbjct  462  GGYIAADKRVVDMLRKECAGSAYHNSLSPVVCQQIISSFKVIMGEDGTNIGKQKLNALRD  521

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR  L  MG  VLG+ DSP+MP+MLYNP+KI AFSRECL++ +AVV V FPA P+L
Sbjct  522  NSNYFRMRLTDMGLHVLGNYDSPIMPVMLYNPTKIAAFSRECLKRGLAVVVVGFPAVPIL  581

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            ++RAR CISA HTRE+L +AL+ +  + DL+ ++Y
Sbjct  582  MSRARFCISAGHTREELDRALKELDEITDLLKLRY  616



>ref|XP_002186044.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65514.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=486

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY+A  +  IQ+L+ TC A     ++SP   QQ+++A KVI+GEDG++ G +KL  +R+
Sbjct  326  GGYVAADRATIQHLRNTCAASSCHNALSPVVCQQVLTAFKVIMGEDGTNIGKQKLQSLRD  385

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR  L++MG +VLG  DSPVMPIMLYNP KI AFSREC ++ +AVV V FPA PLL
Sbjct  386  NSNYFRMRLEEMGLQVLGQYDSPVMPIMLYNPCKIAAFSRECYKRGLAVVVVGFPAVPLL  445

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            L+RAR CISA H REDL +AL  I  + +++ ++Y
Sbjct  446  LSRARFCISAGHAREDLDRALAEIDEIAEVLKLRY  480



>gb|EPZ34220.1| Pyridoxal phosphate-dependent transferase domain-containing protein 
1 [Rozella allomycis CSF55]
Length=486

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA SK++I +LK +C AHLYA  I  P  QQII+++K+I+G DG+  GA+ L+ I  
Sbjct  323  GGYIASSKKIIDHLKTSCHAHLYAEPIPTPVVQQIITSMKIIMGLDGTDTGAKLLSSIYR  382

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NS +F  +L+  GF V GD  SPV+P++L+NP+KIPAFSRECL++ +AVV V +PATP++
Sbjct  383  NSKYFMGKLKDKGFIVYGDEGSPVVPLLLFNPAKIPAFSRECLKRGIAVVVVGYPATPII  442

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIK  240
             +R R CISAAHT+EDL  AL VI  VGDL+ +K
Sbjct  443  TSRVRFCISAAHTKEDLDFALSVIDEVGDLLQLK  476



>ref|XP_003962837.1| PREDICTED: serine palmitoyltransferase 2-like [Takifugu rubripes]
Length=564

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E++ ++ E
Sbjct  387  GGYIAGKRELIEYLRTHSHSVVYATSMSPPVVEQIIASMKCIMGEDGTTVGQERIRQLAE  446

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF V G+ DSPV+P+MLY PSKI AF RE L++N+ VV V FPATP++
Sbjct  447  NTVYFRKRLREMGFTVYGNQDSPVIPMMLYMPSKIGAFGREMLKRNIGVVVVGFPATPII  506

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +R R CISAAHT+  L KAL VIS VGDL+ +KY
Sbjct  507  ESRVRFCISAAHTKHLLDKALSVISEVGDLLQLKY  541



>ref|XP_003445532.1| PREDICTED: serine palmitoyltransferase 2-like isoform X1 [Oreochromis 
niloticus]
Length=571

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K I+GEDG++ G+E++ ++ E
Sbjct  394  GGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGSERVQQLAE  453

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF+RE L++N+ VV V FPATP++
Sbjct  454  NTVYFRKRLREMGFIIYGNNDSPVVPMMLYMPAKIAAFAREMLKRNIGVVVVGFPATPII  513

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISA H++  L +AL VIS VGDL+ +KY
Sbjct  514  ESRARFCISAGHSKNMLDQALNVISEVGDLLQLKY  548



>ref|XP_006632191.1| PREDICTED: serine palmitoyltransferase 2-like [Lepisosteus oculatus]
Length=568

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E++ ++ E
Sbjct  391  GGYIGGRKELIDYLRTHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGLERVQQLAE  450

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L++MGF + G++DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  451  NTRYFRRKLREMGFIIYGNDDSPVVPMMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  510

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  222
             +RAR C+SAAHT+E L  AL VIS VGDL+ +KY    P
Sbjct  511  ESRARFCVSAAHTKEMLDTALNVISEVGDLLQLKYSRHRP  550



>ref|XP_010118582.1| PREDICTED: serine palmitoyltransferase 2, partial [Chlamydotis 
macqueenii]
Length=327

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  150  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  209

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  210  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  269

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  270  ESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  304



>ref|XP_008275494.1| PREDICTED: serine palmitoyltransferase 2-like [Stegastes partitus]
Length=567

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K I+GEDG++ G +++ ++ E
Sbjct  390  GGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGCDRVRQLAE  449

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  450  NTVYFRKRLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  509

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAH+++ L +AL VIS VGDL+ +KY
Sbjct  510  ESRARFCISAAHSKDMLDRALSVISEVGDLLQLKY  544



>dbj|BAE21805.1| unnamed protein product [Mus musculus]
Length=266

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G+DG+S G E + ++ E
Sbjct  89   GGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAE  148

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  149  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  208

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  209  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  243



>ref|XP_006036023.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2, 
partial [Alligator sinensis]
Length=459

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E + ++ E
Sbjct  282  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTSGKECVQQLAE  341

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L+KMGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  342  NTRYFRRQLKKMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIV  401

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  402  ESRARFCVSAAHTKEMLDTALKEINEVGDLLQLKY  436



>dbj|BAC37842.1| unnamed protein product [Mus musculus]
Length=278

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G+DG+S G E + ++ E
Sbjct  101  GGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAE  160

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  161  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  220

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  221  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  255



>ref|XP_005750502.1| PREDICTED: serine palmitoyltransferase 2-like [Pundamilia nyererei]
Length=571

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K I+GEDG++ G+E++ ++ E
Sbjct  394  GGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGSERVQQLAE  453

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  454  NTVYFRKRLREMGFIIYGNNDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  513

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISA H++  L +AL VIS VGDL+ +KY
Sbjct  514  ESRARFCISAGHSKNMLDQALNVISEVGDLLQLKY  548



>ref|XP_009948862.1| PREDICTED: serine palmitoyltransferase 2, partial [Leptosomus 
discolor]
Length=350

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+ +  + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  173  GGYIGGKKELIDYLRTSSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  232

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  233  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  292

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  293  ESRARFCLSAAHTKEMLDMALKEINEVGDLLQLKY  327



>ref|XP_004542426.1| PREDICTED: serine palmitoyltransferase 2-like [Maylandia zebra]
Length=571

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 121/162 (75%), Gaps = 7/162 (4%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP AQQII+++K+I+GEDG++ GA++L ++ +
Sbjct  389  GGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMKIIMGEDGTTLGADRLRQLSQ  448

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ FFR  L +MGF + G++DSPV+P+MLY P+KI AF RE L++N+  V V FPATP++
Sbjct  449  NTTFFRRRLHEMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPII  508

Query  341  LARARICISAAHTRE--DLIKAL-----EVISRVGDLVGIKY  237
             +RAR C+SAAHTRE  D +  +     + IS VGDL+ +KY
Sbjct  509  ESRARFCVSAAHTREMLDTVSPISNMKHKTISEVGDLLQLKY  550



>ref|XP_002734813.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=553

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG+KELI +LK+   + +YATS+SPP AQQIIS++K I+G DG++ G+++L R+  
Sbjct  374  GGYIAGTKELIAHLKFRSHSSVYATSMSPPVAQQIISSMKSIMGLDGTNTGSQRLQRLAW  433

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L +MGF V G++DSPV+P+++Y PSK+ AF RECL++ + VV V FPAT ++
Sbjct  434  NTRYFRRRLHEMGFIVYGNDDSPVVPLLIYLPSKVVAFCRECLKRKLGVVVVGFPATSII  493

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY--FPAEPKKQQLEEN  198
              RAR C+SA+HT+E L  AL+VI  V  ++ +KY   P E K +  E++
Sbjct  494  GGRARFCMSASHTKEMLDTALDVIKEVETILQLKYSKLPIEKKTELTEQD  543



>emb|CCI48496.1| unnamed protein product [Albugo candida]
Length=482

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 116/158 (73%), Gaps = 0/158 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+I Y++      +YA S+SP  AQQ+++++K+I+G DGS  G +KL  +RE
Sbjct  322  GGYIAASEEIISYIRTASAGSVYAASLSPVVAQQVLTSLKIIMGTDGSDYGRKKLDALRE  381

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR +L  MG   LG+ DSPV+P+ML+  SKIP FSR+CL +N+AVVTV FPATPLL
Sbjct  382  NSNYFRQQLMNMGVVTLGNFDSPVIPVMLFCLSKIPEFSRQCLERNLAVVTVGFPATPLL  441

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPA  228
            L+R R CISAAHT+EDL KAL+ I  V     I+Y  +
Sbjct  442  LSRVRFCISAAHTKEDLDKALKQIEEVSSNCNIRYLKS  479



>ref|XP_007248546.1| PREDICTED: serine palmitoyltransferase 2 [Astyanax mexicanus]
Length=633

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E++ ++ E
Sbjct  456  GGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAE  515

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L+++GF + G+NDSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  516  NTVYFRRRLREIGFIIYGNNDSPVVPVMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  575

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SA+HT+E L +AL  IS VGDL+ +KY
Sbjct  576  ESRARFCVSASHTKEMLDQALNAISEVGDLLQVKY  610



>gb|EFA83279.1| serine C-palmitoyltransferase subunit [Polysphondylium pallidum 
PN500]
Length=508

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA  K LI +L+ +  A+LYA S++PP A Q   A++ I G+DG+  GA K+ +++E
Sbjct  348  GGYIAADKSLIDHLRQSSFAYLYANSMAPPCAMQAYQALRAIAGDDGTDIGARKIKQLKE  407

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR  L++MGF++LG  DSPV+P+M YNPSKI  FSR CL +++AVV V +PATPL 
Sbjct  408  NSNFFRERLRQMGFQILGGKDSPVVPLMFYNPSKIATFSRMCLERHIAVVVVGYPATPLT  467

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
              RAR C+SA+HTREDL  ALE +  +GD + +K+
Sbjct  468  SPRARFCLSASHTREDLEWALEHLDTIGDQMNLKF  502



>ref|XP_010214677.1| PREDICTED: serine palmitoyltransferase 2 [Tinamus guttatus]
Length=435

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  QQII+++K I+GEDGS+ G  ++ ++ E
Sbjct  258  GGYIGGKKELIDYLRIHSHSAVYATSLSPPVVQQIITSMKCIMGEDGSTLGKARVQQLAE  317

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  318  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  377

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  378  ESRARFCLSAAHTKEILDIALKEINEVGDLLQLKY  412



>ref|XP_002734812.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=551

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 6/173 (3%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG+KELI +LK+   + +YA S+SPP AQQIIS+++ I+G DG++ G  +L ++  
Sbjct  374  GGYIAGTKELIAHLKFHSHSSVYAISMSPPVAQQIISSMQCIMGLDGTNTGRHRLRQLAW  433

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L +MGF + G +DSPV+P+MLY P+KI AF RECL++N+ VV V FPAT ++
Sbjct  434  NTRYFRRRLHEMGFLIYGSDDSPVVPLMLYMPAKIGAFGRECLKRNLGVVVVGFPATTII  493

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY--FPAEPK----KQQLEE  201
             +RAR C+SAAHT+E L +ALE+I   G ++ ++Y   P E K      +LEE
Sbjct  494  ESRARFCLSAAHTKEMLDQALEMIEEAGTVLHLRYSRLPLEKKTAITSHELEE  546



>ref|XP_010742461.1| PREDICTED: serine palmitoyltransferase 2-like [Larimichthys crocea]
Length=622

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K I+GEDG++ G +++ ++ E
Sbjct  445  GGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGCDRVRQLAE  504

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++++ VV V FPATP++
Sbjct  505  NTVYFRKRLREMGFIIYGNEDSPVVPMMLYMPAKIGAFGREMLKRDIGVVVVGFPATPII  564

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAHT+E L +AL VIS VGDL+ +KY
Sbjct  565  ESRARFCISAAHTKEMLDRALSVISEVGDLLQLKY  599



>emb|CCI10352.1| unnamed protein product [Albugo candida]
Length=479

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY+A S+E+I Y++ +    +YA S+SP  AQQI++++KVI+G DGS  G +KL  +RE
Sbjct  322  GGYVAASEEIISYIRTSSAGSMYAASLSPVVAQQILTSLKVIMGTDGSDYGKKKLDNLRE  381

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR +L  MG   LG+ DSPV+P+ML+  SKIP FSR+CL +N+AVVTV FPATPLL
Sbjct  382  NSNYFRQQLINMGVVTLGNFDSPVIPVMLFCLSKIPEFSRQCLERNLAVVTVGFPATPLL  441

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPA  228
            L+R R CISAAHT+EDL +AL+ I  V     I++  +
Sbjct  442  LSRVRFCISAAHTKEDLDEALKQIEEVSSNCNIQFLKS  479



>gb|AEB22067.1| serine palmitoyl transferase, partial [Solanum tuberosum]
Length=93

 Score =   149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -1

Query  551  GAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavv  372
            GA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP KIPAFSRECL++NVAVV
Sbjct  1    GAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPGKIPAFSRECLKRNVAVV  60

Query  371  tvafpatPLLLARARICISAAHTREDLIKALEV  273
             V FPATPLLLARARICISAAH+REDL  ALEV
Sbjct  61   IVGFPATPLLLARARICISAAHSREDLNIALEV  93



>ref|XP_009317686.1| PREDICTED: serine palmitoyltransferase 2 [Pygoscelis adeliae]
Length=496

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  319  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  378

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  379  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  438

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  439  ESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  473



>ref|XP_005710134.1| serine palmitoyltransferase, LCB2 subunit [Chondrus crispus]
 emb|CDF39840.1| serine palmitoyltransferase, LCB2 subunit [Chondrus crispus]
Length=537

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S  L++ ++    A LYA++++PP AQ I+ A   + G+DG+  GA K+  +R 
Sbjct  359  GGYIATSAALVERIRALSAASLYASAMAPPCAQHILWAFNQMAGKDGTGIGAGKIRALRV  418

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L+KMG + LGD DSPV+PIMLYNP+KI AFSREC ++ +AVV V FPATPLL
Sbjct  419  NAIYFREQLRKMGVQTLGDWDSPVIPIMLYNPAKIAAFSRECYKRGLAVVVVGFPATPLL  478

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            L+RARIC+SAAHTREDL  AL VI +V +++ IKY
Sbjct  479  LSRARICLSAAHTREDLDWALGVIDQVAEIIQIKY  513



>ref|XP_009279012.1| PREDICTED: serine palmitoyltransferase 2 [Aptenodytes forsteri]
Length=495

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  472



>ref|XP_011401812.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28767.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=760

 Score =   161 bits (407),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGY+A +K++I Y    CPAHL+AT+++PPA Q ++SA+++I G DGS RGA KL+++R 
Sbjct  318  GGYVAANKDVIDYFMAQCPAHLHATAMTPPAVQMVLSALRLITGADGSDRGAHKLSQLRT  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+N+FRS L  MGF VLGD DSPVMPIM++  +K+ A S E LR  VAVV V FPATPLL
Sbjct  378  NANYFRSRLLHMGFNVLGDWDSPVMPIMIFQLAKLSATSHEMLRLGVAVVVVGFPATPLL  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFP  231
             +R R+CISA+HTR+DL  AL++   V     I+  P
Sbjct  438  TSRMRVCISASHTRQDLDYALQLFDYVATKCDIRDPP  474



>ref|XP_010876930.1| PREDICTED: serine palmitoyltransferase 2 [Esox lucius]
Length=569

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G +ELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E++ R+ E
Sbjct  392  GGYIGGRRELIDYLRVHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTLGRERVKRLAE  451

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR ++ +MGF + G++DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  452  NTVYFRRKMTEMGFIIYGNSDSPVVPMMLYLPAKIGAFGREMLKRNIGVVVVGFPATPII  511

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAHT++ L  AL VIS VGDL+ +KY
Sbjct  512  ESRARFCISAAHTKDMLDTALCVISEVGDLLQVKY  546



>ref|XP_002908237.1| serine palmitoyltransferase, putative [Phytophthora infestans 
T30-4]
 gb|EEY61320.1| serine palmitoyltransferase, putative [Phytophthora infestans 
T30-4]
Length=443

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+I +++ +    +YATS+SP  AQQI++A+ +I G DG+  G +K+A +R+
Sbjct  283  GGYIAASEEIINFIRNSSSGAIYATSLSPVIAQQILTALNIIAGLDGTDIGRKKIASLRD  342

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR +L  MG   LGD DSPV+P+MLY+ SK+  FSR+CL++N+AVVTV FPATPLL
Sbjct  343  NSNYFRQKLIDMGVITLGDFDSPVIPVMLYHMSKVGEFSRQCLKRNLAVVTVGFPATPLL  402

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            LAR R CISAAHTRED+  AL  +  V DL  I++
Sbjct  403  LARVRFCISAAHTREDMDTALVALKEVCDLCNIRF  437



>ref|XP_011488917.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2-like 
[Oryzias latipes]
Length=574

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI+YL+    + +YA S+SPP  +QII+++K I+G+DG+S G ++L ++ E
Sbjct  396  GGYIAGKRELIEYLRSHSHSAVYAASMSPPVVEQIITSMKCIMGDDGTSIGCKRLQQLAE  455

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G++DSPV+P+MLY P+KI AF RE L++N+ VV V FPAT L+
Sbjct  456  NTTYFRRRLREMGFIIYGNDDSPVIPMMLYMPAKIGAFGREMLKKNIGVVVVGFPATSLV  515

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAH++E L  AL  IS VGD++ +KY
Sbjct  516  ESRARFCISAAHSKEILDTALSAISEVGDVLQLKY  550



>ref|XP_010010806.1| PREDICTED: serine palmitoyltransferase 2 [Nestor notabilis]
Length=494

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  317  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVKCIMGEDGTTVGKARVQQLAE  376

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  377  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  436

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L +AL+ I  VGDL+ +KY
Sbjct  437  ESRARFCLSAAHTKEMLDRALKEIDEVGDLLQLKY  471



>ref|XP_009512509.1| PREDICTED: serine palmitoyltransferase 2 [Phalacrocorax carbo]
Length=495

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTAVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTREMLDTALKEINEVGDLLQLKY  472



>ref|XP_006263848.1| PREDICTED: serine palmitoyltransferase 2 [Alligator mississippiensis]
Length=614

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG+  G E + ++ E
Sbjct  437  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTISGKECVQQLAE  496

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR +L+KMGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  497  NTRYFRRQLKKMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  556

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  557  ESRARFCVSAAHTKEMLDTALKEINEVGDLLQLKY  591



>ref|NP_001085763.1| serine palmitoyltransferase, long chain base subunit 2 [Xenopus 
laevis]
 gb|AAH73312.1| MGC80715 protein [Xenopus laevis]
Length=555

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI GSK LI YL+    +  YATS+SPP AQQIIS++K I+GEDGS+ G + + ++ E
Sbjct  378  GGYIGGSKVLIDYLRAHSHSSAYATSMSPPVAQQIISSMKCIMGEDGSTVGRKHVEQLAE  437

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L +MGF + G++DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  438  NTKYFRHRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  497

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL  I+ VGDL+ +KY
Sbjct  498  ESRARFCVSAAHTKEMLDAALREINEVGDLLQLKY  532



>ref|NP_001018455.1| serine palmitoyltransferase 2 [Danio rerio]
 gb|AAH95355.1| Serine palmitoyltransferase, long chain base subunit 2 [Danio 
rerio]
 gb|AAI65370.1| Sptlc2 protein [Danio rerio]
Length=534

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G K+LI YL+    + +YA+S+S P  +QII+++K I+GEDG++ G  ++ R+ E
Sbjct  357  GGYIGGRKDLIDYLRTHSHSAVYASSMSAPVVEQIITSMKCIMGEDGTTIGRSRIQRLAE  416

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  417  NTVYFRRRLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  476

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAH++E L +AL+VIS VGDL+ +KY
Sbjct  477  ESRARFCISAAHSKEMLDRALDVISEVGDLLQLKY  511



>ref|XP_005502422.1| PREDICTED: serine palmitoyltransferase 2 [Columba livia]
Length=495

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG+S G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTSVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009644944.1| PREDICTED: serine palmitoyltransferase 2 [Egretta garzetta]
Length=495

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG+S G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMKCIMGEDGTSVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009988351.1| PREDICTED: serine palmitoyltransferase 2 [Tauraco erythrolophus]
Length=490

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+ +  + +YATS+SPP  +QI++++K I+GEDG++ G  ++ ++ E
Sbjct  313  GGYIGGKKELIDYLRTSSHSAVYATSMSPPVVEQIVTSMKCIMGEDGTTVGKARVQQLAE  372

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  373  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  432

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  433  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  467



>ref|XP_002613183.1| hypothetical protein BRAFLDRAFT_210501 [Branchiostoma floridae]
 gb|EEN69192.1| hypothetical protein BRAFLDRAFT_210501, partial [Branchiostoma 
floridae]
Length=483

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAGSK LI +L+    +  YA S+S P AQQ+IS++K+I+GEDG++RG  ++ ++  
Sbjct  328  GGYIAGSKRLINHLRAYSHSTTYACSMSAPVAQQVISSMKIIMGEDGTNRGQLRIKQLAA  387

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NS +FR  L +MGF V G++DSP++P++LY P+KI AFSRE  +QNV VV V FPATPL+
Sbjct  388  NSKYFRQRLVEMGFIVYGNDDSPIVPVLLYMPAKIAAFSRELYQQNVGVVVVGFPATPLV  447

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L K L+ IS VGD + +KY
Sbjct  448  ESRARFCLSAAHTREMLDKVLDAISDVGDRLQLKY  482



>gb|EMC83907.1| Serine palmitoyltransferase 2, partial [Columba livia]
Length=518

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG+S G  ++ ++ E
Sbjct  341  GGYIGGKKELIDYLRTHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTSVGKARVQQLAE  400

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  401  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  460

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  461  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  495



>ref|XP_008890515.1| hypothetical protein PPTG_00771 [Phytophthora parasitica INRA-310]
 gb|ETI56619.1| hypothetical protein F443_00908 [Phytophthora parasitica P1569]
 gb|ETK96421.1| hypothetical protein L915_00851 [Phytophthora parasitica]
 gb|ETL49786.1| hypothetical protein L916_00840 [Phytophthora parasitica]
 gb|ETM02852.1| hypothetical protein L917_00807 [Phytophthora parasitica]
 gb|ETM56113.1| hypothetical protein L914_00837 [Phytophthora parasitica]
 gb|ETN24451.1| hypothetical protein PPTG_00771 [Phytophthora parasitica INRA-310]
 gb|ETO85426.1| hypothetical protein F444_00915 [Phytophthora parasitica P1976]
 gb|ETP26420.1| hypothetical protein F441_00886 [Phytophthora parasitica CJ01A1]
Length=483

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+I +++ +    +YATS+SP  AQQI++A+ +I G DG+  G +K+A +R+
Sbjct  323  GGYIAASEEIINFIRNSSSGAIYATSLSPVIAQQILTALDIIAGLDGTDIGRKKIASLRD  382

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR +L  MG   LGD DSPV+P+MLY+ SK+  FSR+CL++N+AVVTV FPATPLL
Sbjct  383  NSNYFRQKLIDMGVITLGDFDSPVIPVMLYHMSKVGEFSRQCLKRNLAVVTVGFPATPLL  442

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            LAR R CISAAHTRED+  AL  +  V DL  I++
Sbjct  443  LARVRFCISAAHTREDMDTALVALKEVCDLCNIRF  477



>ref|XP_009885296.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Charadrius vociferus]
Length=495

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009705333.1| PREDICTED: serine palmitoyltransferase 2 [Cariama cristata]
Length=491

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  314  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  373

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  374  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  433

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  434  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  468



>ref|XP_009937612.1| PREDICTED: serine palmitoyltransferase 2 [Opisthocomus hoazin]
Length=495

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL  I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALREINEVGDLLQVKY  472



>ref|XP_009973956.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Tyto alba]
Length=492

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  315  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  374

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  375  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  434

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  435  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  469



>ref|XP_009472775.1| PREDICTED: serine palmitoyltransferase 2 [Nipponia nippon]
Length=495

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009475844.1| PREDICTED: serine palmitoyltransferase 2 [Pelecanus crispus]
Length=500

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  323  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  382

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  383  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  442

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  443  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  477



>ref|XP_009580257.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2-like 
[Fulmarus glacialis]
Length=490

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  313  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  372

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  373  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  432

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  433  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  467



>ref|XP_005417509.1| PREDICTED: serine palmitoyltransferase 2 [Geospiza fortis]
Length=495

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG KELI YL+    +  YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIAGKKELIDYLRTYSHSAAYATSMSPPVVEQIITSVKCIMGEDGTTIGRARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009080576.1| PREDICTED: serine palmitoyltransferase 2 [Acanthisitta chloris]
Length=497

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  320  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVKCIMGEDGTTVGRARVQQLAE  379

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  380  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  439

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  440  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  474



>ref|XP_009992209.1| PREDICTED: serine palmitoyltransferase 2 [Chaetura pelagica]
Length=495

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +Q+I+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQVITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L+KMGF + G+ DSP++P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKKMGFIIYGNEDSPIVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ ++ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEVNEVGDLLQLKY  472



>ref|XP_005013979.1| PREDICTED: serine palmitoyltransferase 2 [Anas platyrhynchos]
Length=524

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E + ++ E
Sbjct  347  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTFGKECVQQLAE  406

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  407  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  466

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  467  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  501



>ref|XP_005990149.1| PREDICTED: serine palmitoyltransferase 2 [Latimeria chalumnae]
Length=560

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KEL+ YL+    + +YATS+SPP  +QII+++K I+G+DG++ G +++ ++ E
Sbjct  383  GGYIGGRKELLAYLRSHSHSAVYATSMSPPIVEQIITSMKCIMGKDGTTIGQDRVQQLAE  442

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L+KMGF + G++DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  443  NTRYFRGRLKKMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  502

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  222
             +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY   +P
Sbjct  503  ESRARFCVSAAHTKEMLDVALKEISEVGDLLQLKYSRHKP  542



>gb|EOB05513.1| Serine palmitoyltransferase 2, partial [Anas platyrhynchos]
Length=519

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E + ++ E
Sbjct  342  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTFGKECVQQLAE  401

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  402  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  461

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  462  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  496



>ref|XP_009565075.1| PREDICTED: serine palmitoyltransferase 2 [Cuculus canorus]
Length=495

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_008923197.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Manacus vitellinus]
Length=495

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVKCIMGEDGTTIGRARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_010643886.1| PREDICTED: serine palmitoyltransferase 2 [Fukomys damarensis]
 gb|KFO24287.1| Serine palmitoyltransferase 2 [Fukomys damarensis]
Length=495

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G+DG+S G E + ++ E
Sbjct  318  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSFGKECVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNMGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEIDEVGDLLQLKY  472



>ref|XP_006157148.1| PREDICTED: serine palmitoyltransferase 2 [Tupaia chinensis]
Length=536

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G DG+S G E + ++ E
Sbjct  359  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGHDGTSIGKECVQQLAE  418

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  419  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  478

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  479  ESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  513



>dbj|GAM19483.1| hypothetical protein SAMD00019534_026580 [Acytostelium subglobosum 
LB1]
Length=489

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG    I YL+ +  ++LYA S++P  A Q   A++ I GEDG+  GA K+ ++++
Sbjct  332  GGYIAGDAPFINYLRQSSYSYLYANSMAPACAMQAYQALRTIAGEDGTDIGARKIKQLKD  391

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSNFFR  L++MGF++LG  DSPV+P+M YNPSKI AFSR CL +++AVV V +PATPL 
Sbjct  392  NSNFFRERLRQMGFQILGGRDSPVVPMMFYNPSKISAFSRMCLERHIAVVVVGYPATPLT  451

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
              RAR C+SA+HTREDL  ALE +  +G+ + +KY
Sbjct  452  APRARFCLSASHTREDLEWALEHLEDIGEQLQLKY  486



>ref|XP_009907650.1| PREDICTED: serine palmitoyltransferase 2 [Picoides pubescens]
Length=517

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  340  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  399

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  400  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  459

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  460  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  494



>ref|XP_006746809.1| PREDICTED: serine palmitoyltransferase 2 [Leptonychotes weddellii]
Length=423

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QI++++K I+G+DG++ G E + ++ E
Sbjct  246  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIVTSMKCIMGQDGTTLGTECIQQLAE  305

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  306  NTKYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  365

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  366  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  400



>ref|XP_008400962.1| PREDICTED: serine palmitoyltransferase 2-like [Poecilia reticulata]
Length=565

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G++++ ++ E
Sbjct  388  GGYIAGKRELIDYLRCHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGSDRIRQLAE  447

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L+ MGF   G++DSPV+P+MLY P+KI AF RE L +N+ VV V FPATP++
Sbjct  448  NTAYFRQRLRGMGFIXYGNDDSPVVPMMLYMPAKIGAFGREMLSRNIGVVVVGFPATPII  507

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR CISAAH+RE L +AL  IS VGDL+ +KY
Sbjct  508  ESRARFCISAAHSRELLDQALSAISEVGDLLQLKY  542



>ref|XP_005605438.1| PREDICTED: serine palmitoyltransferase 2 [Equus caballus]
Length=495

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QI++++K I+G+DG++ G E + ++ E
Sbjct  318  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIVTSMKCIMGQDGTTLGKECIQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHTRE L  AL+ I  VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTREILDTALKEIDEVGDLLQLKY  472



>ref|XP_010710079.1| PREDICTED: serine palmitoyltransferase 2 [Meleagris gallopavo]
Length=532

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G E + ++ E
Sbjct  355  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTFGRECVQQLAE  414

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  415  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  474

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  475  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  509



>ref|XP_005148932.1| PREDICTED: serine palmitoyltransferase 2 [Melopsittacus undulatus]
Length=495

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG+  G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVKCIMGEDGTIVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L +AL+ I  VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDRALKEIDEVGDLLQLKY  472



>ref|XP_008503410.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Calypte anna]
Length=538

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  361  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMGEDGTTVGKARVQQLAE  420

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  421  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  480

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  481  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  515



>ref|XP_010582073.1| PREDICTED: serine palmitoyltransferase 2 [Haliaeetus leucocephalus]
Length=495

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +Q+I+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQVITSMKCIMGEDGTTVGKARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEIDEVGDLLQLKY  472



>ref|XP_005321334.1| PREDICTED: serine palmitoyltransferase 2 [Ictidomys tridecemlineatus]
Length=495

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G+DG+S G E + ++ E
Sbjct  318  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSLGKECVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  472



>ref|XP_006778946.1| PREDICTED: serine palmitoyltransferase 2 [Myotis davidii]
Length=528

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  QQII+++K I+G+DG++ G E + ++ E
Sbjct  351  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVQQIITSMKCIMGKDGTTLGKECVQQLAE  410

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  411  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  470

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  471  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  505



>gb|EPY81318.1| serine palmitoyltransferase 2 [Camelus ferus]
Length=484

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G+DG++ G E + ++ E
Sbjct  307  GGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTTLGKECIQQLAE  366

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++NV VV V FPATP++
Sbjct  367  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNVGVVVVGFPATPII  426

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  427  ESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  461



>ref|XP_009523454.1| hypothetical protein PHYSODRAFT_313276 [Phytophthora sojae]
 gb|EGZ20737.1| hypothetical protein PHYSODRAFT_313276 [Phytophthora sojae]
Length=457

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIA S+E+I +++ +    +YATS+SP  AQQI++A+ +I G DG+  G  KL  +RE
Sbjct  297  GGYIAASEEIINFIRNSSAGAIYATSLSPAIAQQILTALNIIAGLDGTDIGRNKLDSLRE  356

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            NSN+FR +L  MG   LGD DSPV+P+MLY+ SK+  +SRECL++N+AVVTV FPATPLL
Sbjct  357  NSNYFRQKLIDMGVITLGDFDSPVIPVMLYHMSKVGEYSRECLKRNLAVVTVGFPATPLL  416

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
            L+R R C+SAAHT+ED+ +AL+ I  V ++  ++Y
Sbjct  417  LSRVRFCVSAAHTKEDMDEALKAIEEVSEICHVRY  451



>ref|XP_005812989.1| PREDICTED: serine palmitoyltransferase 2-like [Xiphophorus maculatus]
Length=653

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYIAG +ELI YL+    + +YATS+SPP  +QII+++K I+GEDG++ G++++ ++ +
Sbjct  476  GGYIAGKRELIDYLRCHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGSDRIRQLAQ  535

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G++DSPV+P+MLY P+KI AF RE L +N+ VV V FPATP++
Sbjct  536  NTAYFRRRLREMGFIIYGNDDSPVVPMMLYMPAKIGAFGREMLSRNIGVVVVGFPATPII  595

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAH+RE L +AL  IS VGDL+ +KY
Sbjct  596  ESRARFCVSAAHSRELLDQALSAISEVGDLLQLKY  630



>ref|XP_005520283.1| PREDICTED: serine palmitoyltransferase 2 [Pseudopodoces humilis]
Length=495

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -1

Query  701  GGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRE  522
            GGYI G KELI YL+    +  YATS+SPP  +QII+++K I+GEDG++ G  ++ ++ E
Sbjct  318  GGYIGGKKELIDYLRTYSHSAAYATSMSPPVVEQIITSVKCIMGEDGTTVGRARVQQLAE  377

Query  521  NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLL  342
            N+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L++N+ VV V FPATP++
Sbjct  378  NTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPII  437

Query  341  LARARICISAAHTREDLIKALEVISRVGDLVGIKY  237
             +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  438  ESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320