BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035M16

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631909.1|  PREDICTED: aspartic proteinase Asp1                236   4e-72   Nicotiana tomentosiformis
ref|XP_006346815.1|  PREDICTED: aspartic proteinase Asp1-like           235   1e-71   Solanum tuberosum [potatoes]
ref|XP_009766881.1|  PREDICTED: aspartic proteinase Asp1                234   3e-71   Nicotiana sylvestris
ref|XP_004240685.1|  PREDICTED: aspartic proteinase Asp1                231   3e-70   
emb|CDP04854.1|  unnamed protein product                                220   3e-66   Coffea canephora [robusta coffee]
gb|KFK29973.1|  hypothetical protein AALP_AA7G201200                    219   9e-66   Arabis alpina [alpine rockcress]
ref|XP_006412352.1|  hypothetical protein EUTSA_v10025289mg             216   2e-64   Eutrema salsugineum [saltwater cress]
ref|XP_002867175.1|  hypothetical protein ARALYDRAFT_328390             216   2e-64   Arabidopsis lyrata subsp. lyrata
emb|CDX68982.1|  BnaC01g04710D                                          216   4e-64   
ref|XP_009121783.1|  PREDICTED: aspartic proteinase Asp1                215   6e-64   Brassica rapa
dbj|BAC43357.1|  putative nucellin                                      214   9e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190905.1|  aspartyl protease family protein                   214   1e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75359.1|  BnaA01g03430D                                          214   1e-63   
gb|KJB40494.1|  hypothetical protein B456_007G066800                    213   3e-63   Gossypium raimondii
ref|XP_006282959.1|  hypothetical protein CARUB_v10007649mg             213   4e-63   Capsella rubella
ref|XP_007048530.1|  Eukaryotic aspartyl protease family protein ...    212   8e-63   
ref|XP_011099684.1|  PREDICTED: aspartic proteinase Asp1                212   9e-63   Sesamum indicum [beniseed]
ref|XP_010527074.1|  PREDICTED: aspartic proteinase Asp1-like           211   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010432554.1|  PREDICTED: aspartic proteinase Asp1-like           211   2e-62   Camelina sativa [gold-of-pleasure]
gb|EYU20602.1|  hypothetical protein MIMGU_mgv1a007047mg                211   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_010437756.1|  PREDICTED: aspartic proteinase Asp1-like           211   2e-62   Camelina sativa [gold-of-pleasure]
dbj|BAD80835.1|  nucellin-like protein                                  210   5e-62   Daucus carota [carrots]
ref|XP_010447234.1|  PREDICTED: aspartic proteinase Asp1-like           208   2e-61   Camelina sativa [gold-of-pleasure]
gb|ABK95151.1|  unknown                                                 207   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002310541.2|  hypothetical protein POPTR_0007s04800g             208   3e-61   
ref|XP_006382886.1|  hypothetical protein POPTR_0005s07070g             207   3e-61   
ref|XP_002307058.2|  nucellin family protein                            207   4e-61   
gb|EPS67652.1|  hypothetical protein M569_07122                         207   4e-61   Genlisea aurea
ref|XP_006380399.1|  nucellin family protein                            203   6e-60   
emb|CAB38807.1|  nucellin-like protein                                  204   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031099.1|  PREDICTED: aspartic proteinase Asp1-like           204   1e-59   Populus euphratica
gb|KDP24798.1|  hypothetical protein JCGZ_25323                         204   1e-59   Jatropha curcas
ref|XP_002273988.1|  PREDICTED: aspartic proteinase Asp1                203   2e-59   Vitis vinifera
ref|XP_002522918.1|  nucellin, putative                                 203   2e-59   Ricinus communis
ref|XP_010025734.1|  PREDICTED: aspartic proteinase Asp1-like           203   3e-59   Eucalyptus grandis [rose gum]
ref|XP_011022861.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    201   1e-58   Populus euphratica
ref|XP_008227592.1|  PREDICTED: aspartic proteinase Asp1                201   1e-58   Prunus mume [ume]
ref|XP_007211687.1|  hypothetical protein PRUPE_ppa005961mg             201   1e-58   Prunus persica
ref|XP_006464925.1|  PREDICTED: aspartic proteinase Asp1-like           201   2e-58   Citrus sinensis [apfelsine]
gb|KGN62238.1|  hypothetical protein Csa_2G338820                       199   2e-58   Cucumis sativus [cucumbers]
ref|XP_006432088.1|  hypothetical protein CICLE_v10001122mg             201   2e-58   
ref|XP_004163385.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    200   4e-58   
gb|KDO52221.1|  hypothetical protein CISIN_1g013774mg                   200   4e-58   Citrus sinensis [apfelsine]
ref|XP_004147327.1|  PREDICTED: aspartic proteinase Asp1-like           199   5e-58   
ref|XP_010547875.1|  PREDICTED: aspartic proteinase Asp1                199   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_011022860.1|  PREDICTED: aspartic proteinase Asp1-like           197   3e-57   Populus euphratica
ref|XP_008460824.1|  PREDICTED: aspartic proteinase Asp1 isoform X3     196   4e-57   Cucumis melo [Oriental melon]
ref|XP_009350136.1|  PREDICTED: aspartic proteinase Asp1-like           197   5e-57   Pyrus x bretschneideri [bai li]
emb|CAN73001.1|  hypothetical protein VITISV_037997                     196   7e-57   Vitis vinifera
ref|XP_008460823.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     196   1e-56   Cucumis melo [Oriental melon]
ref|XP_008460822.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     196   1e-56   Cucumis melo [Oriental melon]
ref|XP_006432093.1|  hypothetical protein CICLE_v10001115mg             195   2e-56   
ref|XP_006464928.1|  PREDICTED: aspartic proteinase Asp1-like iso...    195   3e-56   
ref|XP_010111255.1|  Aspartic proteinase Asp1                           195   3e-56   Morus notabilis
ref|XP_006432092.1|  hypothetical protein CICLE_v10001115mg             195   4e-56   
ref|XP_006464927.1|  PREDICTED: aspartic proteinase Asp1-like iso...    195   5e-56   
ref|XP_008361087.1|  PREDICTED: aspartic proteinase Asp1-like           194   1e-55   
gb|AFK47184.1|  unknown                                                 186   8e-55   Lotus japonicus
ref|XP_007159874.1|  hypothetical protein PHAVU_002G275100g             191   9e-55   Phaseolus vulgaris [French bean]
ref|XP_009355861.1|  PREDICTED: aspartic proteinase Asp1-like           191   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_010674354.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     189   2e-54   
ref|XP_009355862.1|  PREDICTED: aspartic proteinase Asp1-like           189   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_010674353.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     189   5e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010463205.1|  PREDICTED: aspartic proteinase Asp1-like           183   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_003532363.2|  PREDICTED: aspartic proteinase Asp1-like           187   2e-53   Glycine max [soybeans]
ref|XP_009420564.1|  PREDICTED: aspartic proteinase Asp1-like           187   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES72936.2|  eukaryotic aspartyl protease family protein             186   8e-53   Medicago truncatula
gb|KHN31194.1|  Aspartic proteinase Asp1                                182   2e-52   Glycine soja [wild soybean]
ref|XP_003630348.1|  Aspartic proteinase Asp1                           185   2e-52   Medicago truncatula
ref|XP_009393816.1|  PREDICTED: aspartic proteinase Asp1-like           184   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007137749.1|  hypothetical protein PHAVU_009G152700g             185   2e-52   Phaseolus vulgaris [French bean]
gb|KHN20145.1|  Aspartic proteinase Asp1                                184   6e-52   Glycine soja [wild soybean]
gb|AAG51657.1|AC010704_1  nucellin-like protein; 27671-25467            183   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177872.3|  aspartyl protease                                     183   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532199.1|  PREDICTED: aspartic proteinase Asp1                182   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_006596210.1|  PREDICTED: aspartic proteinase Asp1-like iso...    183   2e-51   Glycine max [soybeans]
ref|XP_010243511.1|  PREDICTED: aspartic proteinase Asp1                183   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010479040.1|  PREDICTED: aspartic proteinase Asp1                182   2e-51   Camelina sativa [gold-of-pleasure]
ref|NP_850981.1|  aspartyl protease                                     183   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20610.1|  Aspartic proteinase Asp1                                182   3e-51   Glycine soja [wild soybean]
ref|XP_006472808.1|  PREDICTED: aspartic proteinase Asp1-like iso...    181   3e-51   Citrus sinensis [apfelsine]
ref|XP_003524315.1|  PREDICTED: aspartic proteinase Asp1-like           182   4e-51   Glycine max [soybeans]
ref|XP_003522473.1|  PREDICTED: aspartic proteinase Asp1-like           181   5e-51   Glycine max [soybeans]
ref|XP_003528065.1|  PREDICTED: aspartic proteinase Asp1-like           181   7e-51   Glycine max [soybeans]
ref|XP_006393742.1|  hypothetical protein EUTSA_v10011529mg             181   7e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006472807.1|  PREDICTED: aspartic proteinase Asp1-like iso...    181   8e-51   Citrus sinensis [apfelsine]
ref|XP_004502990.1|  PREDICTED: aspartic proteinase Asp1-like           181   9e-51   Cicer arietinum [garbanzo]
ref|XP_002889144.1|  hypothetical protein ARALYDRAFT_476912             181   2e-50   
ref|XP_009404862.1|  PREDICTED: aspartic proteinase Asp1-like           180   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003602685.1|  Aspartic proteinase Asp1                           180   2e-50   
ref|XP_004977228.1|  PREDICTED: aspartic proteinase Asp1-like iso...    179   2e-50   
ref|XP_006434233.1|  hypothetical protein CICLE_v10003265mg             180   3e-50   Citrus clementina [clementine]
ref|XP_008466731.1|  PREDICTED: aspartic proteinase Asp1-like           179   4e-50   Cucumis melo [Oriental melon]
ref|XP_004503902.1|  PREDICTED: aspartic proteinase Asp1-like           179   5e-50   Cicer arietinum [garbanzo]
ref|XP_011458802.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     178   6e-50   Fragaria vesca subsp. vesca
gb|KCW62450.1|  hypothetical protein EUGRSUZ_H05085                     173   6e-50   Eucalyptus grandis [rose gum]
emb|CDX88370.1|  BnaC06g38140D                                          179   7e-50   
ref|XP_007203973.1|  hypothetical protein PRUPE_ppa025075mg             177   9e-50   
ref|XP_004290889.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     178   1e-49   Fragaria vesca subsp. vesca
ref|XP_004977226.1|  PREDICTED: aspartic proteinase Asp1-like iso...    178   2e-49   Setaria italica
ref|XP_008219614.1|  PREDICTED: aspartic proteinase Asp1-like iso...    177   2e-49   Prunus mume [ume]
ref|XP_004977227.1|  PREDICTED: aspartic proteinase Asp1-like iso...    177   2e-49   
ref|XP_006663866.1|  PREDICTED: aspartic proteinase Asp1-like           176   2e-49   
ref|XP_010238658.1|  PREDICTED: aspartic proteinase Asp1-like           177   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_008219613.1|  PREDICTED: aspartic proteinase Asp1-like iso...    177   2e-49   Prunus mume [ume]
ref|XP_007223384.1|  hypothetical protein PRUPE_ppa005622mg             177   3e-49   Prunus persica
emb|CDX87518.1|  BnaA07g33550D                                          177   3e-49   
emb|CDY41786.1|  BnaC02g13700D                                          177   3e-49   Brassica napus [oilseed rape]
ref|XP_007223385.1|  hypothetical protein PRUPE_ppa005622mg             177   3e-49   Prunus persica
ref|XP_004171754.1|  PREDICTED: aspartic proteinase Asp1-like           176   4e-49   
ref|XP_010095410.1|  Aspartic proteinase Asp1                           177   5e-49   
gb|EMS63812.1|  Aspartic proteinase Asp1                                176   6e-49   Triticum urartu
gb|KHN47012.1|  Aspartic proteinase Asp1                                175   6e-49   Glycine soja [wild soybean]
ref|XP_010930726.1|  PREDICTED: aspartic proteinase Asp1-like           176   6e-49   
ref|XP_010027413.1|  PREDICTED: aspartic proteinase Asp1-like           176   7e-49   
ref|XP_010063407.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     175   1e-48   Eucalyptus grandis [rose gum]
ref|XP_003523438.1|  PREDICTED: aspartic proteinase Asp1-like           174   1e-48   
ref|XP_007019123.1|  Eukaryotic aspartyl protease family protein,...    175   2e-48   
ref|XP_004149806.1|  PREDICTED: aspartic proteinase Asp1-like           174   2e-48   Cucumis sativus [cucumbers]
ref|XP_010063406.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     174   2e-48   Eucalyptus grandis [rose gum]
ref|XP_004142705.1|  PREDICTED: aspartic proteinase Asp1-like           174   2e-48   Cucumis sativus [cucumbers]
emb|CDY10133.1|  BnaC05g03760D                                          174   2e-48   Brassica napus [oilseed rape]
ref|XP_010416691.1|  PREDICTED: aspartic proteinase Asp1-like           174   3e-48   Camelina sativa [gold-of-pleasure]
gb|EMT17342.1|  Aspartic proteinase Asp1                                166   4e-48   
ref|XP_006302228.1|  hypothetical protein CARUB_v10020249mg             174   4e-48   Capsella rubella
ref|XP_004498348.1|  PREDICTED: aspartic proteinase Asp1-like           174   5e-48   Cicer arietinum [garbanzo]
ref|XP_010930728.1|  PREDICTED: aspartic proteinase Asp1-like           173   5e-48   Elaeis guineensis
ref|XP_003523437.1|  PREDICTED: aspartic proteinase Asp1-like           173   6e-48   
ref|XP_010428825.1|  PREDICTED: aspartic proteinase Asp1-like           173   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008444185.1|  PREDICTED: aspartic proteinase Asp1-like           172   1e-47   Cucumis melo [Oriental melon]
ref|XP_009123049.1|  PREDICTED: aspartic proteinase Asp1                172   1e-47   Brassica rapa
gb|EEC68949.1|  hypothetical protein OsI_37668                          172   1e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_567922.2|  aspartyl protease family protein                      172   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781591.1|  PREDICTED: aspartic proteinase Asp1-like           173   1e-47   Phoenix dactylifera
gb|EYU31770.1|  hypothetical protein MIMGU_mgv1a006482mg                172   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_010471942.1|  PREDICTED: aspartic proteinase Asp1-like           173   2e-47   Camelina sativa [gold-of-pleasure]
gb|ABA96612.2|  Eukaryotic aspartyl protease family protein, expr...    172   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011069472.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     171   2e-47   
emb|CDY12535.1|  BnaC06g00610D                                          171   3e-47   Brassica napus [oilseed rape]
ref|XP_010025732.1|  PREDICTED: aspartic proteinase Asp1-like           171   3e-47   Eucalyptus grandis [rose gum]
ref|NP_001066301.1|  Os12g0177500                                       171   3e-47   
ref|XP_010521265.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     171   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_002888605.1|  hypothetical protein ARALYDRAFT_475850             171   4e-47   Arabidopsis lyrata subsp. lyrata
gb|EYU31771.1|  hypothetical protein MIMGU_mgv1a006482mg                171   4e-47   Erythranthe guttata [common monkey flower]
emb|CDP10935.1|  unnamed protein product                                171   5e-47   Coffea canephora [robusta coffee]
ref|XP_011003438.1|  PREDICTED: aspartic proteinase Asp1-like           171   6e-47   Populus euphratica
emb|CDY14973.1|  BnaA10g08830D                                          170   6e-47   Brassica napus [oilseed rape]
ref|XP_011069464.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     171   6e-47   Sesamum indicum [beniseed]
gb|KFK42141.1|  hypothetical protein AALP_AA2G216700                    171   7e-47   Arabis alpina [alpine rockcress]
gb|KEH40514.1|  eukaryotic aspartyl protease family protein             170   8e-47   Medicago truncatula
ref|XP_010521264.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     171   9e-47   Tarenaya hassleriana [spider flower]
ref|XP_010025731.1|  PREDICTED: aspartic proteinase Asp1-like           170   9e-47   
gb|KEH40515.1|  eukaryotic aspartyl protease family protein             170   2e-46   Medicago truncatula
ref|XP_010268980.1|  PREDICTED: aspartic proteinase Asp1-like           170   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009106403.1|  PREDICTED: aspartic proteinase Asp1                170   2e-46   Brassica rapa
ref|XP_002306645.2|  hypothetical protein POPTR_0005s20210g             169   2e-46   
ref|XP_006390086.1|  hypothetical protein EUTSA_v10018497mg             170   2e-46   Eutrema salsugineum [saltwater cress]
ref|NP_175079.1|  aspartyl protease family protein                      168   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011468243.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     168   2e-46   Fragaria vesca subsp. vesca
ref|XP_003526637.1|  PREDICTED: aspartic proteinase Asp1-like           169   3e-46   Glycine max [soybeans]
ref|XP_006303534.1|  hypothetical protein CARUB_v10010968mg             167   7e-46   Capsella rubella
gb|KJB29193.1|  hypothetical protein B456_005G089000                    163   9e-46   Gossypium raimondii
ref|XP_007019119.1|  Eukaryotic aspartyl protease family protein ...    167   1e-45   Theobroma cacao [chocolate]
ref|XP_007137426.1|  hypothetical protein PHAVU_009G126200g             166   2e-45   Phaseolus vulgaris [French bean]
ref|XP_004240544.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     166   2e-45   Solanum lycopersicum
ref|XP_004240543.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     166   3e-45   
ref|XP_011027496.1|  PREDICTED: aspartic proteinase Asp1-like iso...    166   4e-45   Populus euphratica
gb|KDP32842.1|  hypothetical protein JCGZ_12134                         166   4e-45   Jatropha curcas
ref|XP_002441914.1|  hypothetical protein SORBIDRAFT_08g004800          165   6e-45   
ref|XP_010322933.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     165   6e-45   Solanum lycopersicum
ref|XP_004242040.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     165   7e-45   Solanum lycopersicum
ref|XP_011027495.1|  PREDICTED: aspartic proteinase Asp1-like iso...    166   7e-45   Populus euphratica
ref|XP_002302227.1|  nucellin family protein                            165   8e-45   Populus trichocarpa [western balsam poplar]
gb|KJB29183.1|  hypothetical protein B456_005G088900                    161   9e-45   Gossypium raimondii
gb|KJB29192.1|  hypothetical protein B456_005G089000                    162   1e-44   Gossypium raimondii
ref|XP_010025733.1|  PREDICTED: aspartic proteinase Asp1-like           164   1e-44   Eucalyptus grandis [rose gum]
ref|XP_006386369.1|  hypothetical protein POPTR_0002s08190g             165   2e-44   Populus trichocarpa [western balsam poplar]
gb|KJB29184.1|  hypothetical protein B456_005G088900                    161   2e-44   Gossypium raimondii
ref|NP_001131929.1|  uncharacterized protein LOC100193320 precursor     164   2e-44   
ref|XP_006355805.1|  PREDICTED: aspartic proteinase Asp1-like iso...    162   2e-44   Solanum tuberosum [potatoes]
ref|NP_001152116.1|  aspartic proteinase Asp1 precursor                 164   2e-44   
gb|ACR34528.1|  unknown                                                 164   2e-44   Zea mays [maize]
gb|KJB29189.1|  hypothetical protein B456_005G089000                    162   5e-44   Gossypium raimondii
ref|XP_008661408.1|  PREDICTED: uncharacterized protein LOC100193...    163   9e-44   Zea mays [maize]
gb|KJB29190.1|  hypothetical protein B456_005G089000                    162   9e-44   Gossypium raimondii
ref|XP_006355804.1|  PREDICTED: aspartic proteinase Asp1-like iso...    162   1e-43   Solanum tuberosum [potatoes]
ref|XP_006365534.1|  PREDICTED: aspartic proteinase Asp1-like           162   2e-43   Solanum tuberosum [potatoes]
ref|XP_009611015.1|  PREDICTED: aspartic proteinase Asp1                161   2e-43   Nicotiana tomentosiformis
ref|XP_002520345.1|  nucellin, putative                                 161   2e-43   
ref|XP_006355850.1|  PREDICTED: aspartic proteinase Asp1-like           160   3e-43   
gb|KJB29187.1|  hypothetical protein B456_005G088900                    160   3e-43   Gossypium raimondii
gb|AES87275.2|  eukaryotic aspartyl protease family protein             160   4e-43   Medicago truncatula
gb|KJB29182.1|  hypothetical protein B456_005G088900                    160   4e-43   Gossypium raimondii
gb|KJB29181.1|  hypothetical protein B456_005G088900                    160   5e-43   Gossypium raimondii
gb|KHG10363.1|  Asparticase Asp1                                        160   6e-43   Gossypium arboreum [tree cotton]
ref|XP_004142630.1|  PREDICTED: aspartic proteinase Asp1-like           158   3e-42   Cucumis sativus [cucumbers]
ref|XP_009596730.1|  PREDICTED: aspartic proteinase Asp1-like           158   3e-42   Nicotiana tomentosiformis
ref|XP_004502513.1|  PREDICTED: aspartic proteinase Asp1-like           157   4e-42   Cicer arietinum [garbanzo]
ref|XP_009758779.1|  PREDICTED: aspartic proteinase Asp1-like           158   5e-42   Nicotiana sylvestris
ref|XP_011074834.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     157   5e-42   
emb|CBI18999.3|  unnamed protein product                                156   7e-42   Vitis vinifera
ref|XP_009802241.1|  PREDICTED: aspartic proteinase Asp1                157   7e-42   Nicotiana sylvestris
ref|XP_010664194.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     157   8e-42   Vitis vinifera
ref|XP_002285867.2|  PREDICTED: aspartic proteinase Asp1 isoform X1     157   1e-41   Vitis vinifera
ref|XP_003605080.1|  Aspartic proteinase Asp1                           156   2e-41   
ref|XP_004502512.1|  PREDICTED: aspartic proteinase Asp1-like           155   2e-41   Cicer arietinum [garbanzo]
gb|EPS72688.1|  hypothetical protein M569_02067                         155   2e-41   Genlisea aurea
ref|XP_008444184.1|  PREDICTED: aspartic proteinase Asp1-like           155   3e-41   Cucumis melo [Oriental melon]
ref|XP_011468246.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     154   4e-41   Fragaria vesca subsp. vesca
gb|KDO52229.1|  hypothetical protein CISIN_1g015972mg                   154   5e-41   Citrus sinensis [apfelsine]
ref|XP_007019121.1|  Eukaryotic aspartyl protease family protein        155   7e-41   
gb|KDO52225.1|  hypothetical protein CISIN_1g015972mg                   153   1e-40   Citrus sinensis [apfelsine]
gb|AAM76716.1|  nucellin-like aspartic protease                         152   1e-40   Zea mays [maize]
gb|AAY23266.1|  Similar to nucellin-like aspartic protease              150   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669793.1|  PREDICTED: aspartic proteinase Asp1                152   3e-40   
gb|ACG42043.1|  aspartic proteinase Asp1 precursor                      152   3e-40   Zea mays [maize]
ref|XP_010680865.1|  PREDICTED: aspartic proteinase Asp1-like           151   2e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH20924.1|  eukaryotic aspartyl protease family protein             150   2e-39   Medicago truncatula
gb|KDO80581.1|  hypothetical protein CISIN_1g014185mg                   146   2e-39   Citrus sinensis [apfelsine]
ref|XP_006662787.1|  PREDICTED: aspartic proteinase Asp1-like           149   6e-39   Oryza brachyantha
gb|EEC67807.1|  hypothetical protein OsI_35373                          148   9e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_003605078.1|  Aspartic proteinase Asp1                           148   1e-38   
ref|NP_001065913.1|  Os11g0183900                                       148   2e-38   
ref|XP_006472803.1|  PREDICTED: aspartic proteinase Asp1-like iso...    147   3e-38   Citrus sinensis [apfelsine]
ref|XP_006472802.1|  PREDICTED: aspartic proteinase Asp1-like iso...    147   3e-38   Citrus sinensis [apfelsine]
gb|KDO80580.1|  hypothetical protein CISIN_1g014185mg                   145   6e-38   Citrus sinensis [apfelsine]
gb|KDO80579.1|  hypothetical protein CISIN_1g014185mg                   146   9e-38   Citrus sinensis [apfelsine]
ref|XP_003577760.1|  PREDICTED: aspartic proteinase Asp1-like           144   3e-37   Brachypodium distachyon [annual false brome]
gb|EEE51772.1|  hypothetical protein OsJ_33215                          147   4e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62785.1|  Aspartic proteinase Asp1                                143   7e-37   Triticum urartu
gb|EMT29613.1|  Aspartic proteinase Asp1                                143   7e-37   
ref|XP_006856698.1|  hypothetical protein AMTR_s00054p00157640          142   3e-36   
ref|XP_004978884.1|  PREDICTED: aspartic proteinase Asp1-like           141   3e-36   Setaria italica
gb|KHG06665.1|  Asparticase Asp1                                        140   4e-36   Gossypium arboreum [tree cotton]
gb|KHG10362.1|  Asparticase Asp1                                        141   9e-36   Gossypium arboreum [tree cotton]
dbj|BAJ99780.1|  predicted protein                                      140   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12274.1|  Aspartic proteinase Asp1                                139   2e-35   
ref|XP_002511959.1|  protein with unknown function                      139   1e-34   Ricinus communis
ref|XP_001783556.1|  predicted protein                                  136   2e-34   
ref|XP_001766321.1|  predicted protein                                  135   3e-34   
ref|XP_008807681.1|  PREDICTED: aspartic proteinase Asp1-like           135   6e-34   Phoenix dactylifera
gb|ABR18371.1|  unknown                                                 135   7e-34   Picea sitchensis
gb|EMT05967.1|  Aspartic proteinase Asp1                                133   9e-34   
ref|XP_001782061.1|  predicted protein                                  130   5e-32   
gb|EMS52520.1|  Aspartic proteinase Asp1                                129   1e-31   Triticum urartu
ref|XP_006485774.1|  PREDICTED: aspartic proteinase Asp1-like           129   2e-31   Citrus sinensis [apfelsine]
gb|KDO41977.1|  hypothetical protein CISIN_1g008104mg                   128   6e-31   Citrus sinensis [apfelsine]
ref|XP_006440945.1|  hypothetical protein CICLE_v10019473mg             128   8e-31   Citrus clementina [clementine]
ref|XP_010912540.1|  PREDICTED: aspartic proteinase Asp1-like           126   1e-30   
ref|XP_007161478.1|  hypothetical protein PHAVU_001G072500g             126   1e-30   Phaseolus vulgaris [French bean]
ref|XP_010912572.1|  PREDICTED: aspartic proteinase Asp1-like           126   1e-30   Elaeis guineensis
ref|XP_007019120.1|  Eukaryotic aspartyl protease family protein ...    126   1e-30   
ref|XP_011027497.1|  PREDICTED: aspartic proteinase Asp1-like iso...    125   2e-30   Populus euphratica
gb|EMT31650.1|  Aspartic proteinase Asp1                                126   2e-30   
ref|XP_011027498.1|  PREDICTED: aspartic proteinase Asp1-like iso...    125   2e-30   Populus euphratica
gb|EMS61227.1|  Aspartic proteinase Asp1                                124   3e-30   Triticum urartu
emb|CBI15437.3|  unnamed protein product                                125   4e-30   Vitis vinifera
dbj|BAJ98705.1|  predicted protein                                      125   5e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AJA74410.1|  aspartic protease                                       124   6e-30   Cicer arietinum [garbanzo]
ref|XP_011012697.1|  PREDICTED: aspartic proteinase Asp1                125   6e-30   Populus euphratica
ref|XP_002452609.1|  hypothetical protein SORBIDRAFT_04g028990          125   6e-30   Sorghum bicolor [broomcorn]
gb|KHN32026.1|  Aspartic proteinase Asp1                                125   7e-30   Glycine soja [wild soybean]
emb|CDY18730.1|  BnaC08g08860D                                          124   7e-30   Brassica napus [oilseed rape]
gb|EMT27437.1|  Aspartic proteinase Asp1                                124   8e-30   
ref|XP_010663584.1|  PREDICTED: aspartic proteinase Asp1                125   8e-30   Vitis vinifera
gb|KDP20103.1|  hypothetical protein JCGZ_05872                         125   1e-29   Jatropha curcas
gb|KEH27052.1|  eukaryotic aspartyl protease family protein             124   1e-29   Medicago truncatula
ref|XP_006826817.1|  hypothetical protein AMTR_s00010p00056950          124   1e-29   Amborella trichopoda
ref|XP_007152781.1|  hypothetical protein PHAVU_004G159200g             124   2e-29   Phaseolus vulgaris [French bean]
gb|KJB29188.1|  hypothetical protein B456_005G088900                    122   2e-29   Gossypium raimondii
ref|XP_009776622.1|  PREDICTED: aspartic proteinase Asp1                124   3e-29   Nicotiana sylvestris
ref|NP_001065918.1|  Os11g0184800                                       122   3e-29   
ref|XP_006354730.1|  PREDICTED: aspartic proteinase Asp1-like           123   3e-29   Solanum tuberosum [potatoes]
gb|AAK81698.1|  aspartyl proteinase                                     122   3e-29   Oryza sativa [red rice]
gb|AAK81699.1|  aspartyl proteinase                                     122   4e-29   Oryza sativa [red rice]
sp|A2ZC67.2|ASP1_ORYSI  RecName: Full=Aspartic proteinase Asp1; S...    122   4e-29   Oryza sativa Indica Group [Indian rice]
gb|EEC67810.1|  hypothetical protein OsI_35379                          122   4e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_009621932.1|  PREDICTED: aspartic proteinase Asp1                123   4e-29   Nicotiana tomentosiformis
gb|KHG03472.1|  Asparticase Asp1                                        123   5e-29   Gossypium arboreum [tree cotton]
ref|XP_004241624.1|  PREDICTED: aspartic proteinase Asp1                122   7e-29   
gb|KJB39307.1|  hypothetical protein B456_007G006200                    122   7e-29   
ref|NP_001146528.1|  hypothetical protein                               119   7e-29   
ref|NP_001146721.1|  uncharacterized protein LOC100280323               122   8e-29   
ref|XP_004512995.1|  PREDICTED: lysine-specific histone demethyla...    124   9e-29   
gb|ACN34727.1|  unknown                                                 122   1e-28   
gb|KHN20716.1|  Aspartic proteinase Asp1                                122   1e-28   
ref|XP_006583400.1|  PREDICTED: aspartic proteinase Asp1-like           122   1e-28   
ref|NP_001077691.1|  aspartyl protease                                  120   1e-28   
ref|XP_006662788.1|  PREDICTED: aspartic proteinase Asp1-like           120   1e-28   
ref|XP_011097005.1|  PREDICTED: aspartic proteinase Asp1                120   3e-28   
ref|XP_010094778.1|  Aspartic proteinase Asp1                           120   3e-28   
ref|NP_564539.1|  aspartyl protease                                     120   3e-28   
ref|XP_003563970.2|  PREDICTED: aspartic proteinase Asp1-like           119   4e-28   
ref|XP_007036500.1|  Eukaryotic aspartyl protease family protein,...    120   5e-28   
ref|XP_008813298.1|  PREDICTED: aspartic proteinase Asp1                120   5e-28   
ref|XP_010908260.1|  PREDICTED: aspartic proteinase Asp1                120   5e-28   
ref|XP_010036874.1|  PREDICTED: aspartic proteinase Asp1                119   1e-27   
ref|XP_004980239.1|  PREDICTED: aspartic proteinase Asp1-like           117   1e-27   
ref|XP_008658519.1|  PREDICTED: uncharacterized protein LOC100280...    119   1e-27   
ref|XP_010549131.1|  PREDICTED: aspartic proteinase Asp1                118   2e-27   
ref|XP_010265186.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     118   2e-27   
gb|KJB39309.1|  hypothetical protein B456_007G006200                    118   2e-27   
gb|EYU33023.1|  hypothetical protein MIMGU_mgv1a009434mg                116   3e-27   
ref|XP_006304522.1|  hypothetical protein CARUB_v10011364mg             117   4e-27   
ref|XP_010479334.1|  PREDICTED: aspartic proteinase Asp1-like           117   4e-27   
ref|XP_010461710.1|  PREDICTED: aspartic proteinase Asp1-like           117   5e-27   
gb|EEE52860.1|  hypothetical protein OsJ_35411                          115   1e-26   
ref|XP_010500446.1|  PREDICTED: aspartic proteinase Asp1-like           116   1e-26   
ref|XP_002891474.1|  aspartyl protease family protein                   116   2e-26   
ref|XP_011074835.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     113   3e-26   
gb|KFK36042.1|  hypothetical protein AALP_AA4G070400                    115   4e-26   
ref|XP_009107742.1|  PREDICTED: aspartic proteinase Asp1-like           108   4e-26   
ref|XP_003570503.1|  PREDICTED: aspartic proteinase Asp1-like           114   5e-26   
emb|CDY60079.1|  BnaA05g36440D                                          114   7e-26   
ref|XP_009144992.1|  PREDICTED: aspartic proteinase Asp1                114   8e-26   
ref|XP_009406648.1|  PREDICTED: aspartic proteinase Asp1                114   8e-26   
ref|XP_006656867.1|  PREDICTED: aspartic proteinase Asp1-like           112   8e-26   
emb|CDO98445.1|  unnamed protein product                                113   1e-25   
gb|EEC67809.1|  hypothetical protein OsI_35378                          110   2e-25   
ref|XP_004965200.1|  PREDICTED: aspartic proteinase Asp1-like           112   3e-25   
ref|XP_002449123.1|  hypothetical protein SORBIDRAFT_05g005430          110   8e-25   
ref|XP_010265185.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     110   2e-24   
dbj|BAK05301.1|  predicted protein                                      108   2e-24   
gb|AAB96882.1|  nucellin                                                108   3e-24   
emb|CDY04326.1|  BnaC05g25880D                                          108   5e-24   
ref|XP_006393315.1|  hypothetical protein EUTSA_v10011346mg             108   1e-23   
gb|AAB97155.1|  EEA1                                                    106   1e-23   
gb|EAZ00454.1|  hypothetical protein OsI_22475                          107   2e-23   
ref|NP_001057353.1|  Os06g0268700                                       107   2e-23   
ref|XP_004971953.1|  PREDICTED: aspartic proteinase Asp1-like           105   3e-23   
gb|EMT01144.1|  Aspartic proteinase Asp1                                104   4e-23   
gb|EMT27436.1|  Aspartic proteinase Asp1                                103   1e-22   
ref|XP_006374352.1|  aspartyl protease family protein                   105   2e-22   
ref|XP_002893981.1|  hypothetical protein ARALYDRAFT_314121             101   4e-22   
dbj|BAJ86250.1|  predicted protein                                      103   6e-22   
gb|KJB39308.1|  hypothetical protein B456_007G006200                    102   9e-22   
gb|EMS61228.1|  Aspartic proteinase Asp1                                100   2e-21   
ref|NP_001048015.1|  Os02g0730700                                       101   2e-21   
gb|EEC73939.1|  hypothetical protein OsI_08807                          101   2e-21   
ref|XP_002449122.1|  hypothetical protein SORBIDRAFT_05g005410        99.8    3e-21   
gb|EMT28382.1|  Aspartic proteinase Asp1                              98.2    2e-20   
gb|KEH32831.1|  eukaryotic aspartyl protease family protein           95.9    7e-20   
ref|XP_004137470.1|  PREDICTED: aspartic proteinase Asp1-like         96.7    1e-19   
gb|ACB69715.1|  putative nucellin-like aspartic protease              94.4    1e-19   
ref|XP_008457584.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   95.9    2e-19   
ref|XP_004953813.1|  PREDICTED: aspartic proteinase Asp1-like         93.2    1e-18   
ref|XP_007152782.1|  hypothetical protein PHAVU_004G159200g           93.6    2e-18   
emb|CDY43703.1|  BnaA08g05170D                                        86.7    2e-18   
ref|XP_006588295.1|  PREDICTED: lysine-specific histone demethyla...  93.6    3e-18   
gb|ACR37122.1|  unknown                                               85.1    8e-18   
gb|AFW56223.1|  hypothetical protein ZEAMMB73_420944                  89.4    1e-17   
gb|KJB39310.1|  hypothetical protein B456_007G006200                  89.7    3e-17   
ref|XP_002449121.1|  hypothetical protein SORBIDRAFT_05g005400        87.8    3e-17   
gb|EMT29612.1|  Aspartic proteinase Asp1                              86.7    1e-16   
gb|EMT25131.1|  Aspartic proteinase Asp1                              84.0    2e-16   
gb|KDO80582.1|  hypothetical protein CISIN_1g014185mg                 82.8    1e-15   
gb|KDO37005.1|  hypothetical protein CISIN_1g019849mg                 79.0    3e-14   
gb|KDO41978.1|  hypothetical protein CISIN_1g008104mg                 79.0    1e-13   
gb|KEH27053.1|  eukaryotic aspartyl protease family protein           78.2    2e-13   
ref|XP_008457519.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   77.8    4e-13   
gb|EMT28907.1|  Aspartic proteinase Asp1                              74.3    2e-12   
gb|KCW48539.1|  hypothetical protein EUGRSUZ_K02213                   71.2    5e-11   
ref|XP_010265187.1|  PREDICTED: aspartic proteinase Asp1 isoform X3   70.5    9e-11   
ref|XP_008811543.1|  PREDICTED: uncharacterized protein LOC103722...  67.0    1e-10   
ref|XP_010105474.1|  Aspartic proteinase-like protein 2               66.6    2e-09   
ref|XP_007036501.1|  Eukaryotic aspartyl protease family protein,...  66.2    2e-09   
ref|XP_003600929.1|  Aspartic proteinase Asp1                         62.0    4e-09   
gb|KHN47013.1|  Aspartic proteinase Asp1                              62.0    7e-09   
gb|KIZ07939.1|  hypothetical protein MNEG_0012                        63.2    1e-08   
ref|XP_008811545.1|  PREDICTED: uncharacterized protein LOC103722...  60.1    2e-08   
ref|XP_010549260.1|  PREDICTED: aspartic proteinase-like protein 2    62.8    3e-08   
ref|XP_010087280.1|  Aspartic proteinase-like protein 2               61.6    7e-08   
ref|XP_002510127.1|  Aspartic proteinase nepenthesin-1 precursor,...  60.8    1e-07   
gb|KEH31519.1|  eukaryotic aspartyl protease family protein           60.8    1e-07   
gb|AES90651.2|  eukaryotic aspartyl protease family protein           60.8    1e-07   
ref|XP_003608454.1|  Aspartic proteinase nepenthesin-1                60.5    2e-07   
gb|KHN41554.1|  Aspartic proteinase-like protein 2                    60.5    2e-07   
ref|XP_009772172.1|  PREDICTED: aspartic proteinase-like protein 2    60.5    2e-07   
gb|KDP41653.1|  hypothetical protein JCGZ_16060                       60.5    2e-07   
gb|KHG05352.1|  hypothetical protein F383_31391                       60.5    2e-07   
ref|XP_006579920.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.5    2e-07   
gb|KHN44014.1|  Aspartic proteinase-like protein 2                    60.5    2e-07   
ref|XP_003550988.1|  PREDICTED: aspartic proteinase-like protein ...  60.5    2e-07   
gb|KHG05353.1|  hypothetical protein F383_31391                       60.5    2e-07   
ref|XP_002306494.2|  hypothetical protein POPTR_0005s18810g           60.1    2e-07   
ref|XP_009798809.1|  PREDICTED: aspartic proteinase-like protein 2    60.1    2e-07   
ref|XP_009593347.1|  PREDICTED: aspartic proteinase-like protein 2    60.1    2e-07   
ref|XP_006590642.1|  PREDICTED: aspartic proteinase-like protein ...  59.7    3e-07   
ref|XP_004509090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  59.7    3e-07   
ref|XP_003516613.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  59.7    3e-07   
ref|XP_010271615.1|  PREDICTED: aspartic proteinase-like protein ...  59.7    3e-07   
ref|XP_010327522.1|  PREDICTED: aspartic proteinase-like protein ...  59.3    4e-07   
ref|XP_009603173.1|  PREDICTED: aspartic proteinase-like protein ...  59.3    4e-07   
ref|XP_009603172.1|  PREDICTED: aspartic proteinase-like protein ...  59.3    4e-07   
gb|KHN36268.1|  Metal transporter Nramp3                              59.7    4e-07   
ref|XP_011016146.1|  PREDICTED: aspartic proteinase-like protein 2    59.3    4e-07   
ref|XP_009360296.1|  PREDICTED: aspartic proteinase CDR1-like         59.3    4e-07   
ref|XP_011015887.1|  PREDICTED: aspartic proteinase-like protein 2    59.3    4e-07   
gb|EYU43423.1|  hypothetical protein MIMGU_mgv1a0027552mg             58.9    5e-07   
gb|EYU37054.1|  hypothetical protein MIMGU_mgv1a003205mg              58.9    5e-07   
ref|XP_010070617.1|  PREDICTED: aspartic proteinase CDR1-like         58.9    5e-07   
ref|XP_009780676.1|  PREDICTED: aspartic proteinase-like protein ...  58.9    6e-07   
gb|KJB14598.1|  hypothetical protein B456_002G132900                  58.5    6e-07   
ref|XP_004248841.1|  PREDICTED: aspartic proteinase-like protein ...  58.9    6e-07   
gb|KJB14595.1|  hypothetical protein B456_002G132900                  58.5    6e-07   
ref|XP_010679567.1|  PREDICTED: aspartic proteinase nepenthesin-2...  58.5    7e-07   
ref|XP_009393844.1|  PREDICTED: aspartic proteinase nepenthesin-2...  58.5    7e-07   
gb|KJB14599.1|  hypothetical protein B456_002G132900                  58.5    7e-07   
ref|XP_004244902.1|  PREDICTED: aspartic proteinase-like protein 2    58.5    7e-07   
ref|XP_009627686.1|  PREDICTED: aspartic proteinase CDR1-like iso...  58.5    7e-07   
ref|XP_009627749.1|  PREDICTED: aspartic proteinase-like protein ...  58.5    7e-07   
ref|XP_009780671.1|  PREDICTED: aspartic proteinase-like protein ...  58.5    8e-07   
ref|XP_009780684.1|  PREDICTED: aspartic proteinase-like protein ...  58.2    8e-07   
ref|XP_001690254.1|  pepsin-type aspartyl protease                    58.2    8e-07   
ref|XP_006403297.1|  hypothetical protein EUTSA_v10003167mg           58.5    8e-07   
ref|XP_004511876.1|  PREDICTED: aspartic proteinase-like protein ...  58.2    9e-07   
ref|XP_006339969.1|  PREDICTED: aspartic proteinase-like protein ...  58.2    9e-07   
gb|KJB14596.1|  hypothetical protein B456_002G132900                  58.2    9e-07   
ref|XP_006339968.1|  PREDICTED: aspartic proteinase-like protein ...  58.2    1e-06   
ref|XP_010277145.1|  PREDICTED: aspartic proteinase-like protein ...  57.8    1e-06   
ref|XP_010442078.1|  PREDICTED: aspartic proteinase-like protein ...  57.8    1e-06   
ref|XP_004292749.1|  PREDICTED: aspartic proteinase-like protein ...  57.8    1e-06   
ref|XP_011458846.1|  PREDICTED: aspartic proteinase-like protein ...  57.8    1e-06   
ref|XP_010277146.1|  PREDICTED: aspartic proteinase-like protein ...  57.8    1e-06   
gb|KDO81580.1|  hypothetical protein CISIN_1g010556mg                 57.4    1e-06   
ref|XP_006433595.1|  hypothetical protein CICLE_v10000565mg           57.4    1e-06   
ref|XP_003562781.1|  PREDICTED: aspartic proteinase-like protein 2    57.4    2e-06   
ref|XP_010442077.1|  PREDICTED: aspartic proteinase-like protein ...  57.4    2e-06   
ref|XP_010494279.1|  PREDICTED: aspartic proteinase-like protein ...  57.4    2e-06   
ref|XP_010494278.1|  PREDICTED: aspartic proteinase-like protein ...  57.4    2e-06   
emb|CDY57356.1|  BnaC08g48640D                                        57.4    2e-06   
ref|XP_010442075.1|  PREDICTED: aspartic proteinase-like protein ...  57.4    2e-06   
ref|XP_010442076.1|  PREDICTED: aspartic proteinase-like protein ...  57.4    2e-06   
ref|XP_010494280.1|  PREDICTED: aspartic proteinase-like protein ...  57.4    2e-06   
gb|KDO81579.1|  hypothetical protein CISIN_1g010556mg                 57.0    2e-06   
dbj|BAK02500.1|  predicted protein                                    57.4    2e-06   
ref|XP_006472263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.0    2e-06   
gb|KDO81574.1|  hypothetical protein CISIN_1g010556mg                 57.0    2e-06   
ref|XP_004958189.1|  PREDICTED: aspartic proteinase-like protein ...  57.0    2e-06   
ref|XP_006433596.1|  hypothetical protein CICLE_v10000565mg           57.0    2e-06   
ref|XP_006374851.1|  hypothetical protein POPTR_0014s02040g           57.0    3e-06   
gb|KDO81575.1|  hypothetical protein CISIN_1g010556mg                 56.6    3e-06   
dbj|BAB08274.1|  unnamed protein product                              57.0    3e-06   
ref|NP_199124.3|  aspartyl protease family protein                    56.6    3e-06   
gb|KHG13615.1|  hypothetical protein F383_03676                       56.6    3e-06   
gb|KHG13614.1|  hypothetical protein F383_03676                       56.6    3e-06   
ref|XP_004289182.1|  PREDICTED: aspartic proteinase CDR1              56.6    3e-06   
ref|XP_010481907.1|  PREDICTED: aspartic proteinase-like protein ...  56.6    3e-06   
ref|XP_006361871.1|  PREDICTED: aspartic proteinase-like protein ...  56.6    3e-06   
ref|XP_010481906.1|  PREDICTED: aspartic proteinase-like protein ...  56.2    4e-06   
ref|XP_010481905.1|  PREDICTED: aspartic proteinase-like protein ...  56.2    4e-06   
ref|XP_006281624.1|  hypothetical protein CARUB_v10027752mg           56.2    4e-06   
ref|XP_007048531.1|  Aspartyl protease family protein isoform 2       55.8    4e-06   
gb|AES94605.2|  eukaryotic aspartyl protease family protein           56.2    4e-06   
ref|XP_004230171.1|  PREDICTED: aspartic proteinase-like protein 2    56.2    4e-06   
ref|XP_002865453.1|  predicted protein                                56.2    4e-06   
ref|XP_010503675.1|  PREDICTED: aspartic proteinase CDR1-like         56.2    4e-06   
ref|XP_007155866.1|  hypothetical protein PHAVU_003G238400g           56.2    4e-06   
ref|XP_003611646.1|  Aspartic proteinase-like protein                 56.2    5e-06   
gb|KDO81578.1|  hypothetical protein CISIN_1g010556mg                 55.8    5e-06   
ref|XP_007156750.1|  hypothetical protein PHAVU_002G014200g           56.2    5e-06   
ref|XP_009115686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.2    5e-06   
ref|XP_003611647.1|  Aspartic proteinase-like protein                 55.8    5e-06   
ref|XP_004141399.1|  PREDICTED: aspartic proteinase-like protein ...  56.2    5e-06   
ref|XP_010652753.1|  PREDICTED: aspartic proteinase nepenthesin-1...  56.2    5e-06   
ref|XP_004164029.1|  PREDICTED: aspartic proteinase-like protein ...  56.2    5e-06   
ref|XP_010426548.1|  PREDICTED: aspartic proteinase CDR1-like         55.8    5e-06   
ref|XP_002283258.1|  PREDICTED: aspartic proteinase CDR1              55.8    5e-06   
gb|EEC82371.1|  hypothetical protein OsI_26705                        55.8    5e-06   
gb|KHG08698.1|  hypothetical protein F383_11875                       55.8    6e-06   
gb|EEE67511.1|  hypothetical protein OsJ_24961                        55.8    6e-06   
ref|XP_001767804.1|  predicted protein                                55.5    6e-06   
gb|KHG08697.1|  hypothetical protein F383_11875                       55.8    6e-06   
ref|NP_001060161.1|  Os07g0592200                                     55.8    6e-06   
ref|XP_009354126.1|  PREDICTED: aspartic proteinase CDR1-like         55.8    6e-06   
ref|XP_006426021.1|  hypothetical protein CICLE_v10025144mg           55.8    6e-06   
ref|XP_009101813.1|  PREDICTED: aspartic proteinase-like protein 2    55.8    6e-06   
emb|CDY22367.1|  BnaA06g36890D                                        55.5    7e-06   
ref|NP_001168795.1|  uncharacterized protein LOC100382594 precursor   55.5    7e-06   
gb|KFK31741.1|  hypothetical protein AALP_AA6G152800                  55.5    7e-06   
ref|XP_010515369.1|  PREDICTED: aspartic proteinase CDR1-like iso...  55.5    8e-06   
ref|XP_010515370.1|  PREDICTED: aspartic proteinase CDR1-like iso...  55.5    8e-06   
ref|XP_011029041.1|  PREDICTED: aspartic proteinase-like protein 2    55.1    9e-06   
ref|XP_009395627.1|  PREDICTED: aspartic proteinase nepenthesin-1...  55.1    1e-05   
ref|XP_007018560.1|  Eukaryotic aspartyl protease family protein ...  55.1    1e-05   
ref|XP_011091936.1|  PREDICTED: aspartic proteinase-like protein ...  55.1    1e-05   
emb|CDP15549.1|  unnamed protein product                              55.1    1e-05   
ref|XP_006466523.1|  PREDICTED: aspartic proteinase-like protein ...  54.7    1e-05   
ref|XP_007018558.1|  Eukaryotic aspartyl protease family protein ...  54.7    1e-05   
gb|KDO79034.1|  hypothetical protein CISIN_1g047816mg                 54.7    1e-05   
ref|XP_010939091.1|  PREDICTED: aspartic proteinase-like protein ...  54.7    1e-05   
ref|XP_011091937.1|  PREDICTED: aspartic proteinase-like protein ...  54.7    1e-05   
ref|XP_002463116.1|  hypothetical protein SORBIDRAFT_02g038150        54.7    1e-05   
ref|XP_010939093.1|  PREDICTED: aspartic proteinase-like protein ...  54.3    2e-05   
ref|XP_006658761.1|  PREDICTED: aspartic proteinase-like protein ...  54.3    2e-05   
ref|XP_008220294.1|  PREDICTED: aspartic proteinase-like protein 2    54.3    2e-05   
ref|XP_006404068.1|  hypothetical protein EUTSA_v10010198mg           54.3    2e-05   
ref|XP_007018559.1|  Eukaryotic aspartyl protease family protein ...  53.9    2e-05   
gb|KJB58594.1|  hypothetical protein B456_009G217300                  53.9    2e-05   
gb|EPS62720.1|  hypothetical protein M569_12069                       53.9    3e-05   



>ref|XP_009631909.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=431

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK+TG KN+ VVFDSGSS+SY+NSQ Y+ F+  + KEL GKPLREA  D TLP 
Sbjct  266  GELIFGGKATGFKNLFVVFDSGSSFSYLNSQTYQGFISLLKKELNGKPLREAKDDYTLPL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF++I DVKKYFK+FA  F +GW+S+  FEI PESYLII  KGSVCLGVLNGTE
Sbjct  326  CWKGRRPFKTINDVKKYFKNFALSFPHGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTE  385

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  125
            AGL   N+IGD+SMQD+MVIYDNEK AIGW+ ANCDRPP  N
Sbjct  386  AGLQNVNLIGDISMQDKMVIYDNEKQAIGWSPANCDRPPKSN  427



>ref|XP_006346815.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=437

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK TG+KN+ VVFDSGSS+SY+N+  YE F+  + KEL GKPLRE   D TLP 
Sbjct  272  GELIFGGKGTGLKNLFVVFDSGSSFSYLNAHTYEGFISLLKKELNGKPLRETKDDYTLPL  331

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF++I DVKKYFK FA  F NGW+S+  FEI PESYLII  KGSVCLGVLNGTE
Sbjct  332  CWKGRRPFKTINDVKKYFKQFALSFGNGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTE  391

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   N+IGD+SMQD+MVIYDNEK AIGWT ANCDRPP
Sbjct  392  AGLQNVNLIGDISMQDKMVIYDNEKQAIGWTSANCDRPP  430



>ref|XP_009766881.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=433

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK+TG KN+ VVFDSGSS+SY+NSQ Y+ F+  + KEL GKPL+EA  D TLP 
Sbjct  268  GELIFGGKATGFKNLFVVFDSGSSFSYLNSQTYQGFISLLKKELNGKPLKEAKDDYTLPL  327

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF++I DVKKYFK+F   F +GW+S+  FEI PESYLII  KGSVCLGVLNGTE
Sbjct  328  CWKGRRPFKTINDVKKYFKNFVLSFPHGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTE  387

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  125
            AGL   N+IGD+SMQD+MVIYDNEK AIGW+ ANCDRPP  N
Sbjct  388  AGLQNVNLIGDISMQDKMVIYDNEKQAIGWSPANCDRPPKSN  429



>ref|XP_004240685.1| PREDICTED: aspartic proteinase Asp1 [Solanum lycopersicum]
Length=427

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK TG+KN+ VVFDSGSS+SY+N+  YE F+  + KEL GKPLRE   D TLP 
Sbjct  262  GELIFGGKGTGLKNLFVVFDSGSSFSYLNAHTYEGFISLLKKELNGKPLRETKDDYTLPL  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF++I D KKYFK FA  F NGW+S+  FEI PESYLII  KGSVCLGVLNGTE
Sbjct  322  CWKGRRPFKTINDAKKYFKQFALSFGNGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTE  381

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   N+IGD+SMQD+MVIYDNEK AIGW  ANCDRPP
Sbjct  382  AGLQNVNLIGDISMQDKMVIYDNEKQAIGWMSANCDRPP  420



>emb|CDP04854.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TFGGK  G+KN+ V+FDSGSSYSY+NSQ Y A +  + K+L+GKPL+EA  D TLP 
Sbjct  245  AELTFGGKGVGIKNLDVIFDSGSSYSYLNSQAYRAIISLIEKDLKGKPLKEAKDDRTLPE  304

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GR+PF+S+ DV+KYFK     F +G R RT FEI P++YLII  KG+ CLG+LNGTE
Sbjct  305  CWRGRKPFKSVHDVRKYFKPLGLSFHHGQRVRTQFEIPPDAYLIISSKGNACLGILNGTE  364

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   N+IGD+SMQD+MVIYDNEK AIGW+ ANC RPP  N   +
Sbjct  365  IGLQNVNLIGDISMQDKMVIYDNEKGAIGWSPANCSRPPKSNTFIM  410



>gb|KFK29973.1| hypothetical protein AALP_AA7G201200 [Arabis alpina]
Length=422

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK+TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  254  GELLFGGKTTGLKNLMTVFDSGSSYTYFNSKAYQAVTYMIKRELSGKPLKEARDDHTLPL  313

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI DVKKYFK  A  F  GWRS+TLF+I PE+YLII  KG+VCLG+LNGTE
Sbjct  314  CWQGRRPFMSIEDVKKYFKPLALSFKTGWRSKTLFQIPPEAYLIISMKGNVCLGILNGTE  373

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW +A+CD 
Sbjct  374  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWIQADCDE  410



>ref|XP_006412352.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
 dbj|BAJ34094.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53805.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
Length=424

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  254  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  313

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  314  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTE  373

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  374  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  410



>ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43434.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  377  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPADCDE  413



>emb|CDX68982.1| BnaC01g04710D [Brassica napus]
Length=430

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  +FDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  260  GELLFGGRTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYVLKRELSGKPLKEARDDHTLPL  319

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  320  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISRKGNVCLGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  380  IGLQNMNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  416



>ref|XP_009121783.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=427

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  +FDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISRKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  377  IGLQNMNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana]
Length=413

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  245  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  304

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  305  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTE  364

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  365  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCDE  401



>ref|NP_001190905.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAM64443.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE86234.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  377  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCDE  413



>emb|CDX75359.1| BnaA01g03430D [Brassica napus]
Length=429

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  +FDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  259  GELLFGGRTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF +I +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  319  CWQGRRPFMNIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISRKGNVCLGILNGTE  378

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  379  IGLQNMNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  415



>gb|KJB40494.1| hypothetical protein B456_007G066800 [Gossypium raimondii]
Length=426

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+KN+ V+FDSGSSY+Y+NSQ Y+A    + KEL G+ L+EA  D TLP 
Sbjct  259  AELHFGGKATGIKNLIVIFDSGSSYTYLNSQAYQALTLLLKKELSGRSLKEAPEDQTLPL  318

Query  430  CWKGRRPFRSIXDVKKYFK-SfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGT  254
            CWKGR+PFRS+ D KKYFK S A  FAN  R +T FE+ PE+YLII  KG+VCLG+LNGT
Sbjct  319  CWKGRKPFRSVHDAKKYFKTSLALAFANSGRRKTQFELHPEAYLIISNKGNVCLGILNGT  378

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            + GL   NVIGD+SMQDRMV+YDNEK  IGW+ ANCD  P
Sbjct  379  QVGLQNLNVIGDISMQDRMVVYDNEKQVIGWSPANCDHLP  418



>ref|XP_006282959.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
 gb|EOA15857.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
Length=425

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GK L+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKALKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  377  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPADCDE  413



>ref|XP_007048530.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92687.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+T VKN+ VVFDSGSSY+Y+NSQ Y+     + KEL G+ L+EA  D TLP 
Sbjct  256  AELQFGGKATSVKNLIVVFDSGSSYTYLNSQAYQTLTVLLKKELSGRSLKEAPEDQTLPL  315

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+++ DVKKYFK+ A  FA+  R++T FE+ PE+YLII  KG+VCLG+LNGT+
Sbjct  316  CWKGRKPFKNVRDVKKYFKTLALAFASSSRTKTQFELPPEAYLIISNKGNVCLGILNGTQ  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQDRMVIYDNEK  IGW  ANCD+ P
Sbjct  376  VGLQNLNVIGDISMQDRMVIYDNEKQVIGWAPANCDQLP  414



>ref|XP_011099684.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=422

 Score =   212 bits (539),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGKSTG KN+ V+FDSGSSY+Y +S  Y   L  + KELR   LREA  D TLPF
Sbjct  257  AELRFGGKSTGFKNLNVIFDSGSSYTYFSSHIYHTLLSLINKELRRTSLREATDDHTLPF  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S  DV+KYFK  +  F NGWR++  FEI PE YLII  KG+ CLG+LNGT+
Sbjct  317  CWKGKKPFKSTRDVRKYFKPLSLSFPNGWRAKAQFEIPPEGYLIISSKGNACLGILNGTD  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
             GL   N+IGD+SMQD+M+IYDNEK+ IGWT ANCD+ P  N V
Sbjct  377  VGLSNFNMIGDISMQDKMLIYDNEKHVIGWTPANCDQRPTSNSV  420



>ref|XP_010527074.1| PREDICTED: aspartic proteinase Asp1-like [Tarenaya hassleriana]
Length=420

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK+TG+KN+ VVFDSGSSY+Y NS+ Y+A  Y + +EL GKPL EA  D TLP 
Sbjct  252  GELLFGGKTTGLKNLLVVFDSGSSYTYFNSKAYQAVTYLLRRELSGKPLTEARDDHTLPL  311

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRR F SI +VKKYFK  +  F  GWRS++LFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  312  CWQGRRRFSSIGEVKKYFKPLSFSFKTGWRSKSLFEIPPEAYLIISMKGNVCLGILNGTE  371

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
             GL   N+IGDVSMQD+MVIYDNEK +IGW  ANC+
Sbjct  372  IGLQNLNLIGDVSMQDQMVIYDNEKQSIGWMPANCN  407



>ref|XP_010432554.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF +I +VKKYFK  A  F   WRS++LFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPFMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLIISMKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  377  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>gb|EYU20602.1| hypothetical protein MIMGU_mgv1a007047mg [Erythranthe guttata]
Length=422

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGKSTG KN+ V+FDSGSSY+Y NSQ Y   +  + KEL GK L+EA  D TLPF
Sbjct  258  AELRFGGKSTGFKNLNVIFDSGSSYTYFNSQIYHTLISLIKKELSGKSLKEASDDRTLPF  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF++  DV+KYFKS +  F NGWR++  F+I PE YLII  KG+ CLG+LNGT+
Sbjct  318  CWKGKKPFKTTRDVRKYFKSLSLSFVNGWRTKAQFDIPPEGYLIISSKGNACLGILNGTD  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD++++YDNEK  IGWT ANCD+ P
Sbjct  378  VGLSNFNMIGDISMQDKLLVYDNEKQVIGWTPANCDQIP  416



>ref|XP_010437756.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF +I +VKKYFK  A  F   WRS++LFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPFMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLIISMKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  377  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>dbj|BAD80835.1| nucellin-like protein [Daucus carota]
Length=426

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE    G+S+G+KN+ VVFDSGSSY+Y N+Q Y+  L  + K+L GKPL+EA  D TLP 
Sbjct  261  AELILNGRSSGLKNLLVVFDSGSSYTYFNTQTYQTLLSFIKKDLHGKPLKEAVEDDTLPV  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G++PF+SI D KKYFK  A  F +GW++++ FEI  ESYLII  KGSVCLG+LNGTE
Sbjct  321  CWRGKKPFKSIRDAKKYFKPLALSFGSGWKTKSQFEIQQESYLIISSKGSVCLGILNGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQ+++VIYDNEK  IGW  +NCDRPP
Sbjct  381  VGLQNYNIIGDISMQEKLVIYDNEKQVIGWQPSNCDRPP  419



>ref|XP_010447234.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  257  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRP  +I +VKKYFK  A  F   WRS++LFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  317  CWQGRRPLMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLIISMKGNVCLGILNGTE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  377  IGLQNLNLIGDISMQDQMIIYDNEKQSIGWFPADCDE  413



>gb|ABK95151.1| unknown [Populus trichocarpa]
Length=393

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GK+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA  D TLP 
Sbjct  228  AELTFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREALDDQTLPL  287

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK+FA  F N  +S+T  E  PE+YLII  KG+ CLG+LNGTE
Sbjct  288  CWKGRKPFKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNACLGILNGTE  347

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  348  VGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  386



>ref|XP_002310541.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
 gb|EEE90991.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
Length=430

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GK+TG KN+ V FDSG+SY+Y+NSQ Y+  +  + +EL  KPLREA  D TLP 
Sbjct  265  AELTFDGKTTGFKNLIVAFDSGASYTYLNSQVYQGLISLIKRELSTKPLREALDDQTLPI  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ DVKKYFK+FA  FAN  +S+T  E  PE+YLI+  KG+ CLGVLNGTE
Sbjct  325  CWKGRKPFKSVRDVKKYFKTFALSFANDGKSKTQLEFPPEAYLIVSSKGNACLGVLNGTE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  385  VGLNDLNVIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPKSRSIII  430



>ref|XP_006382886.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
 gb|ERP60683.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
Length=393

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GK+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA  D TLP 
Sbjct  228  AELTFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREALDDQTLPL  287

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK+FA  F N  +S+T  E  PE+YLII  KG+ CLG+LNGTE
Sbjct  288  CWKGRKPFKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNACLGILNGTE  347

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  348  VGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  386



>ref|XP_002307058.2| nucellin family protein [Populus trichocarpa]
 gb|EEE94054.2| nucellin family protein [Populus trichocarpa]
Length=394

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GK+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA  D TLP 
Sbjct  229  AELTFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREALDDQTLPL  288

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK+FA  F N  +S+T  E  PE+YLII  KG+ CLG+LNGTE
Sbjct  289  CWKGRKPFKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNACLGILNGTE  348

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  349  VGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  387



>gb|EPS67652.1| hypothetical protein M569_07122 [Genlisea aurea]
Length=401

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+STG KN+ VVFDSGSSY+Y  S  Y+A +  + K+L GKPL     D TLP 
Sbjct  235  AELRFGGRSTGFKNLNVVFDSGSSYTYFTSHIYQAVVSMITKDLNGKPLTAEPEDQTLPM  294

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PFR+  DVKKYFK+ A  F NGWRS+  F+++PE YL++  KG+ CLG+LNGT 
Sbjct  295  CWKGKKPFRTTRDVKKYFKTLAFAFPNGWRSKASFDVTPEGYLVVSSKGNACLGILNGTS  354

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   NVIGD+SMQD+MVIYDNEK  IGWT ANCD+
Sbjct  355  VGLENFNVIGDISMQDKMVIYDNEKQMIGWTAANCDQ  391



>ref|XP_006380399.1| nucellin family protein [Populus trichocarpa]
 gb|ERP58196.1| nucellin family protein [Populus trichocarpa]
Length=387

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GK+TG  N+ V FDSG+SY+Y+NSQ Y+  +  + +EL  KPLREA  D TLP 
Sbjct  222  AELTFDGKTTGFINLIVAFDSGASYTYLNSQAYQGLISLIKRELSTKPLREALDDQTLPI  281

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ DV KYFK+FA  FAN  +S+T  E  PE+YLI+  KG+ CLGVLNGTE
Sbjct  282  CWKGRKPFKSVHDVNKYFKTFALSFANDGKSKTQLEFPPEAYLIVSSKGNACLGVLNGTE  341

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  342  VGLNDLNVIGDISMQDRVVIYDNEKQLIGWAPRNCDRIPKSRSIII  387



>emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana]
 emb|CAB80066.1| nucellin-like protein [Arabidopsis thaliana]
Length=420

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 121/174 (70%), Gaps = 17/174 (10%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  235  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  294

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLII---------------  296
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII               
Sbjct  295  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISVWFSHTMLKGRFIK  354

Query  295  --XXKGSVCLGVLNGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
                KG+VCLG+LNGTE GL   N+IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  355  MLQMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCDE  408



>ref|XP_011031099.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
 ref|XP_011016209.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=432

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE +F GK+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPL+EA  D TLP 
Sbjct  264  AELSFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLKEALNDRTLPL  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK+FA  F N  +S+T  E  PE+YLII  KG+ CLG+LNGTE
Sbjct  324  CWKGRKPFKSIRDVKKYFKTFALSFKNERKSKTELEFPPEAYLIISSKGNACLGILNGTE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFIXT  107
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NC+R P      I +
Sbjct  384  VGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLPKSKSFIIRS  431



>gb|KDP24798.1| hypothetical protein JCGZ_25323 [Jatropha curcas]
Length=424

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            +E  F GKSTG++N+ V FDSGSSY+Y+NSQ Y   LYS+   L GKPL E   D TLP 
Sbjct  261  SELMFDGKSTGIQNLLVAFDSGSSYTYLNSQAYRGLLYSLRTALSGKPLSEV-PDQTLPV  319

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKKYFKSFA  FAN  R+RT FE  PE+YLII  KG+ CLG+LNGT+
Sbjct  320  CWKGKKPFKSLRDVKKYFKSFALGFANSGRARTHFEFPPEAYLIISSKGNACLGILNGTQ  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQDRM+IY+NEK  IGW  ANC+R P
Sbjct  380  IGLRDLNVIGDISMQDRMMIYNNEKQVIGWAPANCERLP  418



>ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
 emb|CBI21613.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GGK+T  KN+ V FDSGSSY+Y+NS  Y+A ++ V KEL  KP+REA  D TLP 
Sbjct  261  AELILGGKTTVFKNLLVTFDSGSSYTYLNSLAYQALVHLVRKELSEKPVREALDDQTLPL  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G+RPF+S+ DVKK+FK  A  F  G R++T ++I  ESYLII  KG+VCLG+LNGTE
Sbjct  321  CWRGKRPFKSVRDVKKFFKPLALSFPGGGRTKTQYDIPLESYLIISLKGNVCLGILNGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   N+IGD+SMQD+MV+YDNEKN IGW   NCDR P
Sbjct  381  AGLQDFNLIGDISMQDKMVVYDNEKNQIGWAPTNCDRLP  419



>ref|XP_002522918.1| nucellin, putative [Ricinus communis]
 gb|EEF39461.1| nucellin, putative [Ricinus communis]
Length=433

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GKSTG++N+ VVFDSGSSY+Y+N+Q Y+  ++S+ +EL  KP+ EA  D TLP 
Sbjct  266  AELIFDGKSTGIRNLLVVFDSGSSYTYLNAQAYQHLVFSLKRELSRKPISEALDDQTLPL  325

Query  430  CWKGRRPFRSIXDVKKYFK--SfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNG  257
            CWKG+RPF+SI DVKKYFK  +     ++G  S+T FE SPE+YLII  KG+ CLG+LNG
Sbjct  326  CWKGKRPFKSIRDVKKYFKPFALVFKTSSGRSSKTQFEFSPEAYLIISSKGNACLGILNG  385

Query  256  TEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            TE GL   NVIGDVSM DR+VIY+NEK  IGW  A+CDR P
Sbjct  386  TEVGLRDLNVIGDVSMLDRLVIYNNEKQMIGWAAASCDRLP  426



>ref|XP_010025734.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62453.1| hypothetical protein EUGRSUZ_H05088 [Eucalyptus grandis]
Length=436

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GK TG KNM +VFDSGSSY+Y +SQ Y+A    V KEL  KP  EA  DPTLP 
Sbjct  271  AELLYAGKPTGQKNMFLVFDSGSSYTYFSSQAYQALSSDVKKELSRKPFTEALDDPTLPL  330

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G++PF++I DV KYFK FA  F +G R++T FE+ PESYLII  KG+VC+GVLNGT+
Sbjct  331  CWRGKKPFKNIRDVTKYFKPFALSFNSGGRTKTQFEVLPESYLIISSKGNVCMGVLNGTQ  390

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+SMQD+MVIYDNE+  +GW   +C RPP
Sbjct  391  AGLQNMNVIGDISMQDKMVIYDNERQLLGWESKDCSRPP  429



>ref|XP_011022861.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Populus euphratica]
Length=429

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 120/166 (72%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GKSTG KN+ V FDSG+SY+Y+NSQ Y+  +  + +EL  K L EA  D TLP 
Sbjct  264  AELTFDGKSTGFKNLIVAFDSGASYTYLNSQAYQGVISLIKRELSTKSLSEALDDRTLPI  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ D+KKYFK+FA  F NG +S+T  E  PE+YLI+  KG+ CLG+LNGTE
Sbjct  324  CWKGRKPFKSVRDIKKYFKTFALSFMNGGKSKTQLEFPPEAYLIVSSKGNACLGILNGTE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
              L+  NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  384  VHLNDLNVIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPRSRSIII  429



>ref|XP_008227592.1| PREDICTED: aspartic proteinase Asp1 [Prunus mume]
Length=435

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GGKSTG +N+ +VFDSGSSY+Y+NSQ Y+     + +EL GKPL+EA  D TLP 
Sbjct  269  AELIVGGKSTGFRNLVMVFDSGSSYTYLNSQAYQFLTSWLKRELTGKPLKEALDDKTLPL  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PFR+I DVK YFK  A  FA+G +  T FE+ PE+YLII  KG+VCLG+LNG+E
Sbjct  329  CWKGRKPFRNIRDVKTYFKPLALRFASGRKDTTQFELPPEAYLIISSKGNVCLGILNGSE  388

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD+MVIYDNEK  IGW   NCD+ P
Sbjct  389  VGLQNSNIIGDISMQDKMVIYDNEKQMIGWGPGNCDQLP  427



>ref|XP_007211687.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
 gb|EMJ12886.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
Length=435

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GGKSTG +N+ +VFDSGSSY+Y+NSQ Y+     + +EL GKPL+EA  D TLP 
Sbjct  269  AELIVGGKSTGFRNLVMVFDSGSSYTYLNSQAYQFLTSWLKRELTGKPLKEALDDRTLPL  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PFR+I DVK YFK  A  FA+G +  T FE+ PE+YLII  KG+VCLG+LNG+E
Sbjct  329  CWKGRKPFRNIRDVKTYFKPLALRFASGRKDTTQFELPPEAYLIISSKGNVCLGILNGSE  388

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD+MVIYDNEK  IGW   NCD+ P
Sbjct  389  VGLQNSNIIGDISMQDKMVIYDNEKQMIGWGPGNCDKLP  427



>ref|XP_006464925.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=436

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+KN+ +VFDSGSSY+Y++   Y+     + +E+  K L+EA  D TLP 
Sbjct  272  AELLFGGKTTGLKNLPLVFDSGSSYTYLSHVAYQTLTSMMKREISAKSLKEAPEDRTLPL  331

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+RPF+++ DVKKYFK+ A  F +G ++RTLFE++PE+YLII  +G+VCLG+LNG E
Sbjct  332  CWKGKRPFKNVRDVKKYFKALALSFTDG-KTRTLFELTPEAYLIISNRGNVCLGILNGAE  390

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  391  VGLQDLNVIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  429



>gb|KGN62238.1| hypothetical protein Csa_2G338820 [Cucumis sativus]
Length=387

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 0/163 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA  D TLP 
Sbjct  222  GELIFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPL  281

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GR+P +S+ DV+KYFK  A  F++G RS+ +FEI  E Y+II   G+VCLG+LNGT+
Sbjct  282  CWRGRKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMIISSMGNVCLGILNGTD  341

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  122
             GL   N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  342  VGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  384



>ref|XP_006432088.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
 gb|ESR45328.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
Length=451

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+KN+ +VFDSGSSY+Y++   Y+     + +E+  K L+EA  D TLP 
Sbjct  287  AELLFGGKTTGLKNLPLVFDSGSSYTYLSHVAYQTLTSMMKREISAKSLKEAPEDRTLPL  346

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+RPF+++ DVKKYFK+ A  F +G ++RTLFE++PE+YLII  +G+VCLG+LNG E
Sbjct  347  CWKGKRPFKNVRDVKKYFKALALSFTDG-KTRTLFELTPEAYLIISNRGNVCLGILNGAE  405

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  406  VGLQDLNVIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  444



>ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Cucumis sativus]
Length=418

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 0/163 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA  D TLP 
Sbjct  253  GELIFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPL  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GR+P +S+ DV+KYFK  A  F++G RS+ +FEI  E Y+II   G+VCLG+LNGT+
Sbjct  313  CWRGRKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMIISSMGNVCLGILNGTD  372

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  122
             GL   N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  373  VGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  415



>gb|KDO52221.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
 gb|KDO52222.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
Length=436

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+KN+ VVFDSGSSY+Y++   Y+     + +EL  K L+EA  D TLP 
Sbjct  272  AELFFGGKTTGLKNLPVVFDSGSSYTYLSHVAYQTLTSMMKRELSAKSLKEAPEDRTLPL  331

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+RPF+++ DVKKYFKS A  F +G ++RTLFE++ E+YLII  +G+VCLG+LNG E
Sbjct  332  CWKGKRPFKNVRDVKKYFKSLALSFTDG-KTRTLFELTTEAYLIISNRGNVCLGILNGAE  390

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  391  VGLQDLNVIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  429



>ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=418

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 0/163 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA  D TLP 
Sbjct  253  GELIFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPL  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GR+P +S+ DV+KYFK  A  F++G RS+ +FEI  E Y+II   G+VCLG+LNGT+
Sbjct  313  CWRGRKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMIISSMGNVCLGILNGTD  372

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  122
             GL   N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  373  VGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  415



>ref|XP_010547875.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=425

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGGK+TG+KN+ V FDSGSSY+Y NS+ Y A    + +EL GKPL+EA  D TLP 
Sbjct  254  GELLFGGKTTGLKNLLVAFDSGSSYTYFNSKAYHAVTNLLKRELSGKPLKEARDDSTLPL  313

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF ++ + KKYF+  +  F  GWRS++L+EI PE+YLII  +G+VCLG+LNGTE
Sbjct  314  CWQGRRPFLNVDEAKKYFRPLSVSFKTGWRSKSLYEIPPEAYLIISTEGNVCLGILNGTE  373

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGW  161
             GL   N+IGD+SMQD+MVIYDNEK+AIGW
Sbjct  374  IGLENVNLIGDISMQDQMVIYDNEKHAIGW  403



>ref|XP_011022860.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=429

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE TF GK+TG KN+ + FDSG+SY+Y+NSQ Y+  +  +  EL  K L EA  D TLP 
Sbjct  264  AELTFDGKTTGFKNLIIAFDSGASYTYLNSQAYQGLISLIKGELSKKFLSEALDDHTLPI  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF S+ DVKKYFK+FA  F NG +S+T  E  PE+YLII  KG+ CLG+LNGTE
Sbjct  324  CWKGWKPFESVRDVKKYFKTFALSFMNGGKSKTQLEFPPEAYLIISSKGNACLGILNGTE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL+  NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  384  VGLNDLNVIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPRSRSIII  429



>ref|XP_008460824.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Cucumis melo]
Length=391

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA  D TLP 
Sbjct  226  GELMFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPL  285

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+ R+P +S+ DV+KYFK  A  F++G RS+ +FEI  E Y+II   G+VCLG+LNGT+
Sbjct  286  CWRERKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMIISSMGNVCLGILNGTD  345

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  122
             GL   N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  346  VGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  388



>ref|XP_009350136.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE    GKSTG  N+ +VFDSGSSY+Y++SQ Y+     + +EL GKPL+EA  D TLP 
Sbjct  263  AELMVDGKSTGFGNLHMVFDSGSSYTYLSSQVYQFLTSWLKRELTGKPLKEAPDDGTLPL  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK  A  F +G +    +E+ PE+YLI+  KG+VCLG+LNGTE
Sbjct  323  CWKGRKPFKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLILSSKGNVCLGILNGTE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  116
             GL   N+IGD+SMQD+MVIYDNEK  IGW   NCD  P P   F
Sbjct  383  VGLQDNNIIGDISMQDKMVIYDNEKQMIGWAPGNCDHLPKPRSSF  427



>emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera]
Length=424

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GGK+T  KN+ V FDSGSSY+Y+NS  Y+A ++ V KEL  KP+REA  D TLP 
Sbjct  261  AELILGGKTTVFKNLLVTFDSGSSYTYLNSLAYQALVHLVRKELSEKPVREALDDQTLPL  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G+RPF+S+ DV+K+FK  A  FA G R++T ++I  ESYLII   G+VCLG+LNGTE
Sbjct  321  CWRGKRPFKSVRDVRKFFKPLALSFAGGGRTKTQYDIPLESYLII--SGNVCLGILNGTE  378

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   N+IGD+SMQD+MV+YDNEKN IGW   NCDR P
Sbjct  379  AGLQDFNLIGDISMQDKMVVYDNEKNQIGWAPTNCDRLP  417



>ref|XP_008460823.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=429

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA  D TLP 
Sbjct  264  GELMFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPL  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+ R+P +S+ DV+KYFK  A  F++G RS+ +FEI  E Y+II   G+VCLG+LNGT+
Sbjct  324  CWRERKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMIISSMGNVCLGILNGTD  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  122
             GL   N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  384  VGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  426



>ref|XP_008460822.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=433

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA  D TLP 
Sbjct  268  GELMFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPL  327

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+ R+P +S+ DV+KYFK  A  F++G RS+ +FEI  E Y+II   G+VCLG+LNGT+
Sbjct  328  CWRERKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMIISSMGNVCLGILNGTD  387

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  122
             GL   N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  388  VGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  430



>ref|XP_006432093.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 ref|XP_006464929.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Citrus sinensis]
 gb|ESR45333.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=408

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA  D TLP 
Sbjct  244  AELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPL  303

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+++ DVKK F++ A  F +G ++RTLFE++PE+YLII  KG+VCLG+LNG E
Sbjct  304  CWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAE  362

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  363  VGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  401



>ref|XP_006464928.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=427

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA  D TLP 
Sbjct  263  AELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPL  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+++ DVKK F++ A  F +G ++RTLFE++PE+YLII  KG+VCLG+LNG E
Sbjct  323  CWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAE  381

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  382  VGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  420



>ref|XP_010111255.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXC30733.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=432

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+KN+  VFDSGSSY+Y+ SQ Y+   + + +EL  K LREA  D TLP 
Sbjct  266  AELRFDGKPTGLKNLLTVFDSGSSYTYLTSQAYQTLTFLIKRELPRKVLREATDDQTLPL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+RPF+ + DV+KYFK  A  F  G +++T +E+ PE+YLI+  KG+VCLG+LNG+E
Sbjct  326  CWKGKRPFKRVSDVRKYFKPLALDFTTGGKTKT-YELPPEAYLIVSSKGNVCLGILNGSE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD+MVIYDNEK  IGW  ANCD+ P
Sbjct  385  IGLQNSNIIGDISMQDKMVIYDNEKQMIGWASANCDKLP  423



>ref|XP_006432092.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 gb|ESR45332.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=453

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA  D TLP 
Sbjct  289  AELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPL  348

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+++ DVKK F++ A  F +G ++RTLFE++PE+YLII  KG+VCLG+LNG E
Sbjct  349  CWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAE  407

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  408  VGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  446



>ref|XP_006464927.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=459

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA  D TLP 
Sbjct  295  AELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPL  354

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+++ DVKK F++ A  F +G ++RTLFE++PE+YLII  KG+VCLG+LNG E
Sbjct  355  CWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAE  413

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  414  VGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  452



>ref|XP_008361087.1| PREDICTED: aspartic proteinase Asp1-like [Malus domestica]
Length=430

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE    GKSTG+ N+ +VFDSGSSY+Y++SQ Y+     + +EL GKPL+EA  D TLP 
Sbjct  263  AELMVDGKSTGIGNLRMVFDSGSSYTYLSSQVYQFLTSWLKRELTGKPLKEAPDDRTLPL  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK  A  F +G +    +E+ PE+YLI+   G+VCLG+LNGTE
Sbjct  323  CWKGRKPFKSIRDVKKYFKPLALRFNSGRKDTAQYELPPEAYLILSSMGNVCLGILNGTE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  116
             GL X N+IGD+SMQD+MVIYDNEK  IGW    CD  P P   F
Sbjct  383  VGLQXYNIIGDISMQDKMVIYDNEKQMIGWAPGKCDHLPKPRSSF  427



>gb|AFK47184.1| unknown [Lotus japonicus]
Length=245

 Score =   186 bits (472),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+  +  VFD+GSSY+Y NS  Y+A +  + KEL GKPL+EA  D TLP 
Sbjct  80   AELIFGGKKTGIGGLLPVFDTGSSYTYFNSNAYQAVISWLKKELAGKPLKEAPDDQTLPL  139

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPFRS+ +V+KYFKS A  F +  R+ T FEI PE+YLI+   G+VCLG+L+G+E
Sbjct  140  CWHGKRPFRSVYEVRKYFKSMALSFTSSGRTNTQFEIPPEAYLIVSNMGNVCLGILDGSE  199

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM D+++++DNEK  IGW  A+C+R P    V I
Sbjct  200  VGMGDLNLIGDISMLDKVMVFDNEKRLIGWAPADCNRVPNSRHVSI  245



>ref|XP_007159874.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
 gb|ESW31868.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
Length=431

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ TGV ++  VFD+GSSYSY NS+ Y+A L  + K+L GKPL+ A  D TLP 
Sbjct  266  AELVFGGRKTGVGSLTAVFDTGSSYSYFNSRAYQALLSWLKKDLTGKPLKAAPDDQTLPL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW GRRPF+SI +V++YFK  A  F NG R +  FEI+PE+YLII   G+VCLG+LNG+E
Sbjct  326  CWHGRRPFKSIREVRRYFKPVALTFNNGGRVKAQFEIAPEAYLIISNLGNVCLGILNGSE  385

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD++++++NEKN IGW  A C R P
Sbjct  386  IGLEELNLIGDISMQDKVMVFENEKNLIGWGPAECSRVP  424



>ref|XP_009355861.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE    GKSTG  N+ +VFDSGSSY+Y++SQ Y+     + +EL  KPL+EA  D TLP 
Sbjct  263  AELMVDGKSTGFGNLHMVFDSGSSYTYLSSQVYQFLTSWLKRELTEKPLKEAPDDGTLPL  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK  A  F +G +    +E+ PE+YLI+  KG+VCLG+LNGTE
Sbjct  323  CWKGRKPFKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLILSSKGNVCLGILNGTE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD+MVIYDNEK  IGW   NCD  P
Sbjct  383  VGLQDNNIIGDISMQDKMVIYDNEKQMIGWAPGNCDHLP  421



>ref|XP_010674354.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674355.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  +G ++TGV+N+ V+FDSGSSY+Y  S+ Y   +  + ++L    L++A  D TLP 
Sbjct  228  AELVYGRRTTGVENLLVIFDSGSSYTYFASEAYHTLVSLLTRDLHRTSLKDATDDDTLPV  287

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+SI DVKKYFK  A  F +G R  + ++I PE+YLII  KG+VCLG+LNGTE
Sbjct  288  CWKGRRPFKSIRDVKKYFKPLALSFGDGGRYASHYDIPPENYLIISMKGNVCLGILNGTE  347

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   N+IGD+SMQD+M++YDNEK  IGW  ANC++ P    V +
Sbjct  348  VGLQNYNIIGDISMQDKMIVYDNEKTMIGWGSANCEKIPKGKAVAL  393



>ref|XP_009355862.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=428

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE    GKSTG  N+ +VFDSGS+Y+Y++SQ Y+     + +EL  KPL+EA  D TLP 
Sbjct  261  AELMVDGKSTGFGNLHMVFDSGSTYTYLSSQVYQFLTSWLKRELTEKPLKEAPDDGTLPL  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+SI DVKKYFK  A  F +G +    +E+ PE+YLI+  KG+VCLG+LNGTE
Sbjct  321  CWKGRKPFKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLILSSKGNVCLGILNGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SMQD+MVIYDNEK  IGW   NCD  P
Sbjct  381  VGLQDNNIIGDISMQDKMVIYDNEKQMIGWAPGNCDHLP  419



>ref|XP_010674353.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  +G ++TGV+N+ V+FDSGSSY+Y  S+ Y   +  + ++L    L++A  D TLP 
Sbjct  272  AELVYGRRTTGVENLLVIFDSGSSYTYFASEAYHTLVSLLTRDLHRTSLKDATDDDTLPV  331

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+SI DVKKYFK  A  F +G R  + ++I PE+YLII  KG+VCLG+LNGTE
Sbjct  332  CWKGRRPFKSIRDVKKYFKPLALSFGDGGRYASHYDIPPENYLIISMKGNVCLGILNGTE  391

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   N+IGD+SMQD+M++YDNEK  IGW  ANC++ P    V +
Sbjct  392  VGLQNYNIIGDISMQDKMIVYDNEKTMIGWGSANCEKIPKGKAVAL  437



>ref|XP_010463205.1| PREDICTED: aspartic proteinase Asp1-like, partial [Camelina sativa]
Length=241

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+ G+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+G PL++A  D TLP 
Sbjct  82   AELLFNGKAAGLKGLKLIFDTGSSYTYFNSKTYQTLVKLIENDLKGTPLKDAKEDKTLPV  141

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YFK+    F NG R  T  +I PESYLII   G+VCLG+LNG+E
Sbjct  142  CWKGAKPFKSVLDVKTYFKTLTINFTNG-RKNTQLQIPPESYLIISNTGNVCLGLLNGSE  200

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  M+IYDNEK  +GW  A+C++ P
Sbjct  201  VGLQDSNVIGDISMQGLMMIYDNEKQQLGWVTADCNKLP  239



>ref|XP_003532363.2| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN16936.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ TGV ++  VFD+GSSY+Y NS  Y+A L  + KEL GKPL+ A  D TLP 
Sbjct  266  AELVFGGRKTGVGSLTAVFDTGSSYTYFNSHAYQALLSWLKKELSGKPLKVAPDDQTLPL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPF S+ +V+KYFK  A  F NG R++  FEI PE+YLII   G+VCLG+LNG+E
Sbjct  326  CWHGKRPFTSLREVRKYFKPVALGFTNGGRTKAQFEILPEAYLIISNLGNVCLGILNGSE  385

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   N+IGD+SMQD++++++NEK  IGW  A+C R P    V I
Sbjct  386  VGLEELNLIGDISMQDKVMVFENEKQLIGWGPADCSRIPKSGDVSI  431



>ref|XP_009420564.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   +G +S GV  M VVFD+GS+++Y   QPY+AFL +V  +L  KPL+E   DPTLP 
Sbjct  269  ANLYWGTRSLGVNQMEVVFDTGSTFTYFGFQPYQAFLSAVKSDLSKKPLKEEFDDPTLPV  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ DVKKYFK+ A  F NG  +R L E+ PE+YLII   G+ CLG+LNGTE
Sbjct  329  CWKGPKAFKSVKDVKKYFKTLALNFVNG--NRALLEVPPENYLIITKHGNACLGILNGTE  386

Query  250  AGLHX-XNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  128
            AGL+   N+IGD+SMQDRMV+YDNE+  IGW +  CDR P P
Sbjct  387  AGLNKDLNIIGDISMQDRMVVYDNERQHIGWVQIGCDRLPKP  428



>gb|AES72936.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=445

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 116/166 (70%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GGK TG  N+  VFD+GSSY+Y NS  Y+A +  + KEL GKP++EA  D TLP 
Sbjct  280  AELVLGGKRTGFGNLLAVFDAGSSYTYFNSNAYQALISWLTKELAGKPIKEAPEDQTLPL  339

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPFRS+ +VKKYFK  A  F    RS+  FEI PE+YLII   G+VCLG+L+G+E
Sbjct  340  CWYGKRPFRSVYEVKKYFKPIALSFPGSRRSKAQFEIPPEAYLIISNMGNVCLGILDGSE  399

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM D+++++DNEK  IGWT A+C+R P    V I
Sbjct  400  VGVEDLNLIGDISMLDKVMVFDNEKQLIGWTAADCNRVPKSKDVSI  445



>gb|KHN31194.1| Aspartic proteinase Asp1 [Glycine soja]
Length=317

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 116/166 (70%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK +GV N+  VFD+GSSY+Y NS  Y+  +  + KE  GKPL+EA  D TLP 
Sbjct  152  AELLFGGKKSGVGNLHAVFDTGSSYTYFNSYAYQVLISWLKKESGGKPLKEAHDDQTLPL  211

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPFRSI +V+KYFK     F +  RS+  FE+ PE+YLI+   G+VCLG+LNG+E
Sbjct  212  CWRGRRPFRSIYEVRKYFKPIVLSFTSNGRSKAQFEMLPEAYLIVSNMGNVCLGILNGSE  271

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM ++++++DN+K  IGW  A+CD+ P    V I
Sbjct  272  VGMGDLNLIGDISMLNKVMVFDNDKQLIGWAPADCDQVPKSRDVSI  317



>ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AET04824.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=435

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ TGV ++ ++FD+GSSY+Y NSQ Y+A +  + KEL  KP++ A  D TLP 
Sbjct  270  AELVFGGRKTGVGSLNIIFDTGSSYTYFNSQAYQAMISLLNKELHRKPIKAAPDDQTLPM  329

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPFRSI +VKKYFK     F NG R +  FEI PE+YLII   G+VCLG+LNG E
Sbjct  330  CWHGKRPFRSINEVKKYFKPLTLSFTNGGRVKPQFEIPPEAYLIISNMGNVCLGILNGPE  389

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM D+++++DNEK  IGW  A+C+  P
Sbjct  390  VGLGELNLIGDISMLDKVMVFDNEKQLIGWGPADCNSVP  428



>ref|XP_009393816.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   +G +S GVK   VVFD+GS+Y+Y   QPY+AFL +V  +L   PL+E   DP+L  
Sbjct  254  ANLQWGTRSLGVKQKEVVFDTGSTYTYFGFQPYQAFLSAVKSDLSKTPLKEVSDDPSLSV  313

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G++PF+S+ DVK+YFK+ A  F N    RTL E+ PE+YLII   G+ CLG+L+GTE
Sbjct  314  CWRGQKPFKSVNDVKQYFKTLALSFVNA--KRTLLEVPPENYLIITQHGNACLGILDGTE  371

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+S+QD  V+YDNE+  IGW RA CDRPP
Sbjct  372  VGLGNLNVIGDISLQDLTVVYDNERQQIGWVRAACDRPP  410



>ref|XP_007137749.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
 gb|ESW09743.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
Length=438

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TGV N+  +FD+GSSY+Y NS  Y+  +  + KE  GKPL+EA  D TLP 
Sbjct  273  AELIFGGKRTGVGNLHAIFDTGSSYTYFNSNAYQTLISLLRKESGGKPLKEAHGDQTLPL  332

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPF+SI +V+KYFK     F++  RS+  FEI PE YLII   G+VCLG+LNG+E
Sbjct  333  CWHGKRPFKSIYEVRKYFKPITLSFSSNGRSKAQFEIPPEGYLIISNMGNVCLGILNGSE  392

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM ++++++DN+K  IGWT A+CDR P    V I
Sbjct  393  VGMGDLNLIGDISMLNKVMVFDNDKQLIGWTPADCDRVPKSRDVSI  438



>gb|KHN20145.1| Aspartic proteinase Asp1 [Glycine soja]
Length=452

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 115/160 (72%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V ++L+GK L+ A  DP+LP 
Sbjct  263  AELVFNGKATAVKGLELIFDSGSSYTYFNSQAYQAVVDLVTQDLKGKQLKRATDDPSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWKG + F+S+ DVKKYFK  A  F    +++ L   + PE+YLII   G+VCLG+L+GT
Sbjct  323  CWKGAKSFKSLSDVKKYFKPLALSFT---KTKILQMHLPPEAYLIITKHGNVCLGILDGT  379

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E GL   N+IGD+S+QD+MVIYDNEK  IGW  +NCDR P
Sbjct  380  EVGLENLNIIGDISLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>gb|AAG51657.1|AC010704_1 nucellin-like protein; 27671-25467 [Arabidopsis thaliana]
Length=427

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 115/165 (70%), Gaps = 1/165 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +   D +LP 
Sbjct  261  AELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPV  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++P +S+ +VKKYFK+    F N  ++  LF++ PESYLII  KG VCLG+LNGTE
Sbjct  321  CWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVCLGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  116
             GL   N+IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct  380  IGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF  424



>ref|NP_177872.3| aspartyl protease [Arabidopsis thaliana]
 gb|AEE35983.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=432

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 115/165 (70%), Gaps = 1/165 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +   D +LP 
Sbjct  266  AELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPV  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++P +S+ +VKKYFK+    F N  ++  LF++ PESYLII  KG VCLG+LNGTE
Sbjct  326  CWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVCLGILNGTE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  116
             GL   N+IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct  385  IGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF  429



>ref|XP_010532199.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=414

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GKSTG K + ++FDSGSSY+Y NS+ Y+  +  +  +L+GKPL++A  D TLP 
Sbjct  255  AELLFNGKSTGEKGLDLIFDSGSSYTYFNSKTYQTIVNLITNDLKGKPLKDAKEDRTLPI  314

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D K +FK+      +GW  +T F+I PESYLI+   G+VCLG+LNG+E
Sbjct  315  CWKGAKPFKSVLDAKSFFKT-LTISFSGWIRKTQFQIQPESYLIVTT-GNVCLGILNGSE  372

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+ MQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  373  VGLQNANVIGDIFMQGTMVIYDNEKQQLGWVSADCDKHP  411



>ref|XP_006596210.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Glycine 
max]
Length=452

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 115/160 (72%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V ++L+GK L+ A  DP+LP 
Sbjct  263  AELVFNGKATVVKGLELIFDSGSSYTYFNSQAYQAVVDLVTQDLKGKQLKRATDDPSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWKG + F+S+ DVKKYFK  A  F    +++ L   + PE+YLII   G+VCLG+L+GT
Sbjct  323  CWKGAKSFKSLSDVKKYFKPLALSFT---KTKILQMHLPPEAYLIITKHGNVCLGILDGT  379

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E GL   N+IGD+S+QD+MVIYDNEK  IGW  +NCDR P
Sbjct  380  EVGLENLNIIGDISLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>ref|XP_010243511.1| PREDICTED: aspartic proteinase Asp1 [Nelumbo nucifera]
Length=460

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG+ TGVK +  VFDSGSSY+Y NS+ Y+ F+  V K+L GKPL+EA  D TLP 
Sbjct  270  AQLIFGGQHTGVKGLMTVFDSGSSYTYFNSKFYQTFISLVRKDLTGKPLKEARDDQTLPI  329

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI DVK++FK     F+NG  +R   EI PESYLII   G+ CLG+LNGTE
Sbjct  330  CWKGTKPFKSIRDVKEHFKPLTLSFSNGKNAR--LEILPESYLIISSHGNACLGILNGTE  387

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD  ++D++VIYDNEK  IGW    C+R P
Sbjct  388  IGLQDINIIGDTLLRDKIVIYDNEKRQIGWIATYCNRLP  426



>ref|XP_010479040.1| PREDICTED: aspartic proteinase Asp1 [Camelina sativa]
Length=410

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL++A  D TLP 
Sbjct  251  AEILFNGKPTGLKGLKLIFDTGSSYTYFNSKTYQTIVKLIETDLKATPLKDAKEDKTLPI  310

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YFK+    F NG R  T  +I PESYLII   G+VCLG+LNG+E
Sbjct  311  CWKGAKPFKSVLDVKTYFKTLTINFTNG-RKNTQLQIPPESYLIISNTGNVCLGLLNGSE  369

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  MVIYDNEK  +GW  A+C++ P
Sbjct  370  VGLQDSNVIGDISMQGLMVIYDNEKQQLGWVTADCNKLP  408



>ref|NP_850981.1| aspartyl protease [Arabidopsis thaliana]
 gb|AAL32740.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AAN65112.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE35984.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=466

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 1/162 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +   D +LP 
Sbjct  266  AELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPV  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++P +S+ +VKKYFK+    F N  ++  LF++ PESYLII  KG VCLG+LNGTE
Sbjct  326  CWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVCLGILNGTE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  125
             GL   N+IGD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct  385  IGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPNVN  426



>gb|KHN20610.1| Aspartic proteinase Asp1 [Glycine soja]
Length=454

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V K+L+GK L+ A  DP+LP 
Sbjct  263  AELVFNGKATAVKGLELIFDSGSSYTYFNSQAYQAVVDLVTKDLKGKQLKRATDDPSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F S+ DVKKYFK  A  F      +    + PESYLII   G+VCLG+L+GTE
Sbjct  323  CWKGAKSFESLSDVKKYFKPLALSFKKIMNLQ--MHLPPESYLIITKHGNVCLGILDGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+++QD+MVIYDNEK  IGW  +NCDR P
Sbjct  381  VGLENLNIIGDITLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>ref|XP_006472808.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=418

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGKSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L+GKPL +   +  LP 
Sbjct  260  AELLFGGKSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDLKGKPLEDTAEEKALPV  319

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI DVK YFK     F           I PE+YLI+   G+VCLG+LNGTE
Sbjct  320  CWKGTKPFKSIQDVKDYFKPLLLSFTK--TKNVHLHIPPEAYLIVTEHGNVCLGILNGTE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  378  VGLENFNLVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_003524315.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN17403.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ TGV ++  VFD+GSSY+Y NS  Y+A L  + KEL GKPL+ A  D TL  
Sbjct  266  AELVFGGRKTGVGSLTAVFDTGSSYTYFNSHAYQALLSWLNKELSGKPLKVAPDDQTLSL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPF S+ +V+KYFK  A  F NG R +  FEI PE+YLII   G+VCLG+LNG E
Sbjct  326  CWHGKRPFTSLREVRKYFKPVALSFTNGGRVKAQFEIPPEAYLIISNLGNVCLGILNGFE  385

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   N++GD+SMQD++++++NEK  IGW  A+C R P    V I
Sbjct  386  VGLEELNLVGDISMQDKVMVFENEKQLIGWGPADCSRVPKSGDVSI  431



>ref|XP_003522473.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=440

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 116/166 (70%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK +GV N+  VFD+GSSY+Y NS  Y+  +  + KE  GKPL+EA  D TLP 
Sbjct  275  AELLFGGKKSGVGNLHAVFDTGSSYTYFNSYAYQVLISWLKKESGGKPLKEAHDDQTLPL  334

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPFRSI +V+KYFK     F +  RS+  FE+ PE+YLI+   G+VCLG+LNG+E
Sbjct  335  CWRGRRPFRSIYEVRKYFKPIVLSFTSNGRSKAQFEMLPEAYLIVSNMGNVCLGILNGSE  394

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM ++++++DN+K  IGW  A+CD+ P    V I
Sbjct  395  VGMGDLNLIGDISMLNKVMVFDNDKQLIGWAPADCDQVPKSRDVSI  440



>ref|XP_003528065.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN09648.1| Aspartic proteinase Asp1 [Glycine soja]
Length=438

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK +G+ ++  VFD+GSSY+Y N   Y+A +  + KE  GKPL+EA  D TLP 
Sbjct  273  AELLFGGKKSGIGSLHAVFDTGSSYTYFNPYAYQALISWLGKESGGKPLKEAHDDQTLPL  332

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPFRSI +V+KYFK     F +  RS+  FE+ PE+YLII   G+VCLG+LNG+E
Sbjct  333  CWRGRRPFRSIYEVRKYFKPIVLSFTSNGRSKAQFEMPPEAYLIISNMGNVCLGILNGSE  392

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM ++++++DN+K  IGWT A+CD+ P    V I
Sbjct  393  VGMGDLNLIGDISMLNKVMVFDNDKQLIGWTPADCDQVPKSRDVSI  438



>ref|XP_006393742.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
 gb|ESQ31028.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
Length=411

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  EL+GKPL++A  D TLP 
Sbjct  252  AELLFNGKPTGLKGLKIIFDTGSSYTYFNSKTYQTIVNLIGNELKGKPLKDAKEDKTLPI  311

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +P +S+ +VK  FK+    F N  R  T  +I PESYLII   G+VCLG+LNG+E
Sbjct  312  CWKGAKPLKSVLEVKNLFKTLTINFMNS-RRNTQLQIPPESYLIISKTGNVCLGILNGSE  370

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  MVIYDNEK  IGW  A+CD+ P
Sbjct  371  IGLQDSNVIGDISMQGIMVIYDNEKQQIGWVSADCDKLP  409



>ref|XP_006472807.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=458

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGKSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L+GKPL +   +  LP 
Sbjct  260  AELLFGGKSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDLKGKPLEDTAEEKALPV  319

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI DVK YFK     F           I PE+YLI+   G+VCLG+LNGTE
Sbjct  320  CWKGTKPFKSIQDVKDYFKPLLLSFTK--TKNVHLHIPPEAYLIVTEHGNVCLGILNGTE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  378  VGLENFNLVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_004502990.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=434

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG  N+  VFD+GSSY+Y NS  Y+A +  + KEL GKP++EA  D TLP 
Sbjct  269  AELIFGGKRTGFGNLFAVFDTGSSYTYFNSDAYQALVSWLKKELAGKPIKEAPEDQTLPM  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPFRS+ +V+KYFK  A  F +  R +  FEI PE+YLII   G+VCLG+LNG+E
Sbjct  329  CWYGKRPFRSVYEVRKYFKPIAFSFPSSGRMKAQFEIPPEAYLIISNMGNVCLGILNGSE  388

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             G+   N+IGD+SM D+++I+DN+K  IGW   +C+R P
Sbjct  389  VGMGDLNLIGDISMLDKVMIFDNDKQLIGWAPTDCNRVP  427



>ref|XP_002889144.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65403.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +   D +LP 
Sbjct  267  AELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPV  326

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSR-TLFEISPESYLIIXXKGSVCLGVLNGT  254
            CWKG++P +S+ +VKKYFK+    F  G++    LF++ PESYLII  KG+VCLG+LNGT
Sbjct  327  CWKGKKPLKSLDEVKKYFKTITLRF--GYQKNGQLFQVPPESYLIITEKGNVCLGILNGT  384

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  125
            E GL   N++GD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct  385  EVGLDSYNIVGDISFQGIMVIYDNEKQRIGWISSDCDKIPNVN  427



>ref|XP_009404862.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  +G +S G K + VV D+GS+++Y  S PY+AFL +V  +L   PL E   D  LP 
Sbjct  274  AKLYWGTQSLGAKQIEVVLDTGSTFTYFESHPYQAFLSAVKSDLSKTPLIEEFDDSALPV  333

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKKYFK+ A  F  G   R L E+SPE+YLII   G+ CLG+LNG+E
Sbjct  334  CWKGQKPFKSVSDVKKYFKTLALDFVKG--KRALLELSPENYLIITKHGNACLGILNGSE  391

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+QD MV+YDNEK  IGW RA C+R P
Sbjct  392  AGLRNLNVIGDISLQDHMVVYDNEKQHIGWVRAACNRLP  430



>ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=440

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 114/166 (69%), Gaps = 5/166 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GGK TG  N+  VFD+GSSY+Y NS  Y+     + KEL GKP++EA  D TLP 
Sbjct  280  AELVLGGKRTGFGNLLAVFDAGSSYTYFNSNAYQ-----LTKELAGKPIKEAPEDQTLPL  334

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPFRS+ +VKKYFK  A  F    RS+  FEI PE+YLII   G+VCLG+L+G+E
Sbjct  335  CWYGKRPFRSVYEVKKYFKPIALSFPGSRRSKAQFEIPPEAYLIISNMGNVCLGILDGSE  394

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             G+   N+IGD+SM D+++++DNEK  IGWT A+C+R P    V I
Sbjct  395  VGVEDLNLIGDISMLDKVMVFDNEKQLIGWTAADCNRVPKSKDVSI  440



>ref|XP_004977228.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Setaria 
italica]
Length=390

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E   DP+LP 
Sbjct  199  ASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKEV-SDPSLPL  256

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    FANG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  257  CWKGKKPFKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNACLGILNGSE  314

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  315  VGLKDLNILGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  358



>ref|XP_006434233.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
 gb|ESR47473.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
Length=459

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGKSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L+GKPL +   +  LP 
Sbjct  260  AELLFGGKSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDLKGKPLEDTAEEKALPV  319

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI DV+ YFK     F           I PE+YLI+   G+VCLG+LNGTE
Sbjct  320  CWKGTKPFKSIQDVEDYFKPLLLSFTK--TKNVHLHIPPEAYLIVTEHGNVCLGILNGTE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  378  VGLENFNLVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_008466731.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=437

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A  D +LP 
Sbjct  253  AEVYFGGKATGIKDLTLVFDSGSSYTYFNSQAYNSILALVRNNLRGKPLEDAPEDKSLPV  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG RPF+S+ DVKKYF   A  F    +++   +++PE+YLII   G+VC G+LNGTE
Sbjct  313  CWKGPRPFKSLHDVKKYFNPLALRFTKTKKAQ--IQLAPEAYLIITKYGNVCFGILNGTE  370

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  371  VGLGNLNIIGDISLKDKMVIYDNERRQIGWFPTNCNK  407



>ref|XP_004503902.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=437

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ +G  N+ ++FD+GSSY+Y NSQ Y+  +  + KEL  KP++ A  D TLP 
Sbjct  272  AELVFGGRKSGAGNLNIIFDTGSSYTYFNSQAYQVLISLLSKELNRKPIKAAPDDQTLPI  331

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G++PF++I +VKKYFK  A  F  G R +  FEI PE+YLII   G+VCLG+LNG E
Sbjct  332  CWHGKKPFKNINEVKKYFKPLALSFTKGGRVKPQFEIPPEAYLIISNMGNVCLGILNGFE  391

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SM ++++++DNEK  IGW  A+C+R P
Sbjct  392  VGLGELNVIGDISMLEKVMVFDNEKQLIGWGAADCNRDP  430



>ref|XP_011458802.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458803.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TGVK++ +VFDSGSSY+Y NS+ YEA +  +  +L+GKPL++A  D +LP 
Sbjct  257  AELVFNGKPTGVKSLNLVFDSGSSYTYFNSKAYEALVKLLRNDLKGKPLKDAPDDKSLPI  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV+ YFK  A  F N        +ISPE+YLI+   G+VCLG+LNG+E
Sbjct  317  CWKGSKPFKSVRDVQNYFKPLALSFTNA--KNVQLQISPEAYLIVSHHGNVCLGILNGSE  374

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+++ D+++IYDNE   IGW  ANC+R P
Sbjct  375  VGLGSMNVIGDITLLDKVLIYDNENQRIGWGPANCNRLP  413



>gb|KCW62450.1| hypothetical protein EUGRSUZ_H05085 [Eucalyptus grandis]
Length=238

 Score =   173 bits (439),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 112/163 (69%), Gaps = 4/163 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG +N+ ++FDSGS+++Y +S+ Y+A    V +ELR K   EA  D TLP 
Sbjct  69   AELLFAGKPTGQENLLLLFDSGSTFTYFSSKAYQALSSRVKEELRRKDFAEAVDDDTLPL  128

Query  430  CWKGRRPFRSIXDVKKYFK----SfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVL  263
            CWKG++PF++I DV KYFK    SFA  F +G R++  FE+ PESY II  KG+VC+GVL
Sbjct  129  CWKGQKPFKNIGDVTKYFKPFALSFALSFNSGGRAKNQFEVPPESYFIISDKGNVCMGVL  188

Query  262  NGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            NGTE G    NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  189  NGTEVGFQNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  231



>emb|CDX88370.1| BnaC06g38140D [Brassica napus]
Length=460

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK +  VFDSGSSY+Y N++ Y+A L  V K+L+GK L+++  D +LP 
Sbjct  261  AEILFDDKATGVKGVSFVFDSGSSYTYFNAEAYQAVLELVRKDLKGKALKDSKEDKSLPV  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK +R  +S+ DVKKYFK+ +  F    ++  +F+I PESYLII  KG+VCLG+LNGTE
Sbjct  321  CWKDKRALKSVHDVKKYFKTISLRFGGSQKNGQVFQIPPESYLIITEKGNVCLGILNGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  381  IGLENYNIIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  419



>ref|XP_007203973.1| hypothetical protein PRUPE_ppa025075mg [Prunus persica]
 gb|EMJ05172.1| hypothetical protein PRUPE_ppa025075mg [Prunus persica]
Length=377

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V  +L+GKPL++A  D +LP 
Sbjct  211  AELVFDGKATSVKGLNMIFDSGSSYTYFNSQAYQAIVTLVRNDLKGKPLKDATEDQSLPI  270

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+ + D K YFK  A  F N    +   ++SPE+YLI+   G+VCLG+LNGTE
Sbjct  271  CWKGRKPFKFVRDAKNYFKPLALSFTNAKNVQP--QLSPETYLIVTKHGNVCLGILNGTE  328

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   N+IGD++++D+M+IYDNE   IGW   NC+  P    V I
Sbjct  329  VGLGNLNIIGDITLRDKMLIYDNENRQIGWAPVNCNMLPKSRTVAI  374



>ref|XP_004290889.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TGVK++ +VFDSGSSY+Y NS+ YEA +  +  +L+GKPL++A  D +LP 
Sbjct  257  AELVFNGKPTGVKSLNLVFDSGSSYTYFNSKAYEALVKLLRNDLKGKPLKDAPDDKSLPI  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV+ YFK  A  F N        +ISPE+YLI+   G+VCLG+LNG+E
Sbjct  317  CWKGSKPFKSVRDVQNYFKPLALSFTNA--KNVQLQISPEAYLIVSHHGNVCLGILNGSE  374

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+++ D+++IYDNE   IGW  ANC+R P
Sbjct  375  VGLGSMNVIGDITLLDKVLIYDNENQRIGWGPANCNRLP  413



>ref|XP_004977226.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Setaria 
italica]
Length=451

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E   DP+LP 
Sbjct  260  ASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKEV-SDPSLPL  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    FANG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  318  CWKGKKPFKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNACLGILNGSE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  376  VGLKDLNILGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  419



>ref|XP_008219614.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Prunus mume]
Length=420

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E   D +LP 
Sbjct  262  AELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETSEDKSLPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ D K +FK  A  F N        ++SPE YLI+   G+VCLG+LNG+E
Sbjct  322  CWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCLGILNGSE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  380  VGLGNLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_004977227.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Setaria 
italica]
Length=422

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E   DP+LP 
Sbjct  260  ASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKEV-SDPSLPL  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    FANG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  318  CWKGKKPFKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNACLGILNGSE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  376  VGLKDLNILGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|XP_006663866.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=360

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+S GV+ M VVFDSGSS++Y  +QPY+A L + +K+   K L+E   D +LP 
Sbjct  199  ASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVAAIKDDLSKNLKEV-PDHSLPL  256

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    F+NG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  257  CWKGKKPFKSVLDVKKEFKSVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSE  314

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  315  VGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  353



>ref|XP_010238658.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=451

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+S GV+ M VV DSGSS++Y  +QPY+A + ++  +L  K L+E   DP+LP 
Sbjct  260  ASLYFGGRSLGVRPMEVVLDSGSSFTYFGAQPYQALVTALKSDLS-KTLKEV-FDPSLPL  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    F+NG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  318  CWKGKKPFKSVLDVKKEFKSLVLSFSNG--KKALMEIPPENYLIVTKFGNACLGILNGSE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  376  IGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIPNENTI  419



>ref|XP_008219613.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Prunus mume]
Length=451

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E   D +LP 
Sbjct  262  AELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETSEDKSLPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ D K +FK  A  F N        ++SPE YLI+   G+VCLG+LNG+E
Sbjct  322  CWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCLGILNGSE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  380  VGLGNLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_007223384.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24583.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=420

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E   D +LP 
Sbjct  262  AELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETNEDKSLPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ D K +FK  A  F N        ++SPE YLI+   G+VC G+LNG+E
Sbjct  322  CWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCFGILNGSE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  380  VGLENLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>emb|CDX87518.1| BnaA07g33550D [Brassica napus]
Length=461

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK +  VFDSGSSY+Y N++ Y+A L  V K+L+GK L+++  D +LP 
Sbjct  262  AELLFDEKATGVKGVNFVFDSGSSYTYFNAEAYQAVLELVRKDLKGKALKDSKEDKSLPV  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK +R  +S+ DVKKYFK+ +  F    ++  +F+I PESYLII  KG+VCLG+LNGTE
Sbjct  322  CWKDKRGLKSVHDVKKYFKTISLRFGGSQKNGQVFQIPPESYLIITEKGNVCLGILNGTE  381

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  382  IGLENYNIIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  420



>emb|CDY41786.1| BnaC02g13700D [Brassica napus]
Length=452

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK +  +FDSGSSY+Y N++ Y+  L  + K+L+GKPL++   D +LP 
Sbjct  261  AELLFNDKTTGVKGINFIFDSGSSYTYFNAEAYQTILDLIRKDLKGKPLKDTKEDKSLPV  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK  +P +S+ DVKKYFK+    F +  ++  LF+I PESYLII  KG+VCLG+LNGTE
Sbjct  321  CWKDMKPLKSVHDVKKYFKTITLRFGS-QKNGQLFQIPPESYLIITEKGNVCLGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  380  IGLENYNIIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  418



>ref|XP_007223385.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24584.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=451

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E   D +LP 
Sbjct  262  AELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETNEDKSLPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ D K +FK  A  F N        ++SPE YLI+   G+VC G+LNG+E
Sbjct  322  CWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCFGILNGSE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  380  VGLENLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_004171754.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=437

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A  D +LP 
Sbjct  253  AEVYFGGKATGIKDLTLVFDSGSSYTYFNSQAYNSILALVKNNLRGKPLEDAPEDKSLPV  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG RPF+S+ DVKKYF   A  F     ++   ++ PE+YLII   G+VC G+LNGTE
Sbjct  313  CWKGTRPFKSLRDVKKYFNLLALRFTKTKNAQ--IQLPPENYLIITKYGNVCFGILNGTE  370

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  371  VGLGDLNIIGDISLKDKMVIYDNERRRIGWFPTNCNK  407



>ref|XP_010095410.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB60102.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=458

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK  G+K + V+FDSGSSY+Y NS  YEA +  V K L GKPL++   D +LP 
Sbjct  263  AELYFGGKPAGIKGLEVIFDSGSSYTYFNSPAYEAVVNLVKKSLNGKPLKDTAEDKSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ D KK+F   A  F N        ++ PE+YLI+   GSVCLG+LNGT+
Sbjct  323  CWKGNKAFKSVQDAKKFFTPLALSFTN--FKHVQLQLLPEAYLIVTKLGSVCLGILNGTQ  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGDVS+Q++MVIYDNEK  IGW   NCDR P
Sbjct  381  VGLENLNIIGDVSLQEKMVIYDNEKKQIGWGPVNCDRLP  419



>gb|EMS63812.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=441

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+S GV+ M VV DSGSS++Y +SQPY++ + ++  +L  K L+E   DP+LP 
Sbjct  280  ASLYFGGRSLGVRPMEVVLDSGSSFTYFSSQPYQSLVTALKGDLS-KALKEV-SDPSLPL  337

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    FANG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  338  CWKGKKPFKSVLDVKKEFKSLVLNFANG--KKALMEIPPENYLIVTKYGNACLGILNGSE  395

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  396  IGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  434



>gb|KHN47012.1| Aspartic proteinase Asp1 [Glycine soja]
Length=395

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F GK+T VK + + FDSGSSY+Y NS  ++A +  +  +++GKPL  A  DP+LP 
Sbjct  237  ADMFFNGKATSVKGLELTFDSGSSYTYFNSLAHKALVDLITNDIKGKPLSRATEDPSLPI  296

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV   FK     F     S  LF++ PE+YLI+   G+VCLG+L+GTE
Sbjct  297  CWKGPKPFKSLHDVTSNFKPLVLSFTKSKNS--LFQVPPEAYLIVTKHGNVCLGILDGTE  354

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  355  IGLGNTNIIGDISLQDKLVIYDNEKQQIGWASANCDR  391



>ref|XP_010930726.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 110/160 (69%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A    G +S G K + VV DSGSSY+Y   QPY+ FL ++ ++L  +PL E   D +LP 
Sbjct  271  ASLVLGSQSLGSK-LPVVLDSGSSYTYFGFQPYQDFLSAIKRDLSRQPLTETSDDKSLPL  329

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV KYFK     F NG ++R   EI PE+YLI+  KG+ CLG+LNGTE
Sbjct  330  CWKGPKPFKSVLDVIKYFKPLILSFGNGRKAR--MEIPPENYLIVTKKGNACLGILNGTE  387

Query  250  AGLHXX-NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GLH   NVIGD+S+QD +VIYDNEK  IGW RANCDR P
Sbjct  388  VGLHQELNVIGDISLQDLVVIYDNEKQQIGWGRANCDRLP  427



>ref|XP_010027413.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=435

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 4/163 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K TG KN+ +VFDSGS+Y+Y +S+ Y A   SV +ELR K   EA  D TLP 
Sbjct  266  AELLFARKPTGQKNLLLVFDSGSTYTYFSSKAYRALSLSVDEELRRKHFTEAVDDRTLPL  325

Query  430  CWKGRRPFRSIXDVKKYFK----SfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVL  263
            CWKGR+PF++I DV KYFK    SFA  F +G R++  FE+ PESYLII  KG+VC+GVL
Sbjct  326  CWKGRKPFKNIGDVTKYFKPFALSFALSFNSGGRAQNQFEVPPESYLIISDKGNVCMGVL  385

Query  262  NGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            NGTE G    NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  386  NGTEVGFQNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  428



>ref|XP_010063407.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Eucalyptus grandis]
 ref|XP_010063408.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Eucalyptus grandis]
 gb|KCW70627.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
 gb|KCW70628.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=418

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 109/159 (69%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  +  K TGVK + VVFDSGSSY+Y+NS+ Y+A L  V  +L+GKPL++A  D +LP 
Sbjct  261  AELLYNDKPTGVKGLKVVFDSGSSYTYLNSKAYQAVLNQVRADLKGKPLKDAVEDKSLPI  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ +VK +FK       N  +     ++ PE+YLI+   G+ CLG+LNG E
Sbjct  321  CWKGAKPFKSVHEVKNHFKP---LQLNFGKGNAQLQLLPEAYLIVTKHGNACLGILNGGE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
              L   N+IGD+SMQD+MV+YDNEK  IGW  A+CDR P
Sbjct  378  VRLGELNLIGDISMQDKMVVYDNEKKQIGWVTADCDRLP  416



>ref|XP_003523438.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=407

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F GK+T VK + + FDSGSSY+Y NS  ++A +  +  +++GKPL  A  DP+LP 
Sbjct  249  ADMFFNGKATSVKGLELTFDSGSSYTYFNSLAHKALVDLITNDIKGKPLSRATEDPSLPI  308

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV   FK     F     S  LF++ PE+YLI+   G+VCLG+L+GTE
Sbjct  309  CWKGPKPFKSLHDVTSNFKPLVLSFTKSKNS--LFQVPPEAYLIVTKHGNVCLGILDGTE  366

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  367  IGLGNTNIIGDISLQDKLVIYDNEKQRIGWASANCDR  403



>ref|XP_007019123.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY16348.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=463

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 110/160 (69%), Gaps = 5/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K++ +VFDSGSSY+Y   + YEA L  V + L GKPL     D  LP 
Sbjct  265  AELLFGGKPTGIKDLKIVFDSGSSYTYFCLRVYEAVLDLVRRGLTGKPLNTV-HDQALPI  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWKG +PF+++ DVK YF +    F N   +R +  ++ PE+YLI+   G+ CLG+LNGT
Sbjct  324  CWKGSKPFKTVHDVKHYFSTLTLSFTN---TRNIQLQLPPEAYLIVTEHGNACLGILNGT  380

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            EAGL   N+IGD+S+QD+MV+YDNEK  IGW  ANCDR P
Sbjct  381  EAGLDDFNIIGDISLQDKMVVYDNEKQQIGWVSANCDRLP  420



>ref|XP_004149806.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN47712.1| hypothetical protein Csa_6G383000 [Cucumis sativus]
Length=437

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 110/157 (70%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A  D +LP 
Sbjct  253  AEVYFSGKATGIKDLTLVFDSGSSYTYFNSQAYNSILALVKNNLRGKPLEDAPEDKSLPV  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG RPF+S+ DVKKYF   A  F     ++   ++ PE+YLII   G+VC G+LNGTE
Sbjct  313  CWKGTRPFKSLRDVKKYFNPLALRFTKTKNAQ--IQLPPENYLIITKYGNVCFGILNGTE  370

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  371  VGLGDLNIIGDISLKDKMVIYDNERRRIGWFPTNCNK  407



>ref|XP_010063406.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Eucalyptus grandis]
 gb|KCW70626.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=438

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 109/159 (69%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  +  K TGVK + VVFDSGSSY+Y+NS+ Y+A L  V  +L+GKPL++A  D +LP 
Sbjct  261  AELLYNDKPTGVKGLKVVFDSGSSYTYLNSKAYQAVLNQVRADLKGKPLKDAVEDKSLPI  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ +VK +FK       N  +     ++ PE+YLI+   G+ CLG+LNG E
Sbjct  321  CWKGAKPFKSVHEVKNHFKP---LQLNFGKGNAQLQLLPEAYLIVTKHGNACLGILNGGE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
              L   N+IGD+SMQD+MV+YDNEK  IGW  A+CDR P
Sbjct  378  VRLGELNLIGDISMQDKMVVYDNEKKQIGWVTADCDRLP  416



>ref|XP_004142705.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161182.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54551.1| hypothetical protein Csa_4G361850 [Cucumis sativus]
Length=410

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 110/159 (69%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG   G++ + + FDSGSSY+Y NSQ Y A L  +   L+G+PLR+A  D TLP 
Sbjct  253  AEVYFGGNPVGIRGLILTFDSGSSYTYFNSQVYGAVLNLLRNGLKGQPLRDAPEDKTLPI  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ DV+ +FK  A  F N   S+  F+I PE+YLII   G+VCLG+LNG++
Sbjct  313  CWKGSKAFKSVADVRNFFKPLALSFGN---SKVQFQIPPEAYLIISNLGNVCLGILNGSQ  369

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM D+M++YDNE+  IGW  ANC +PP
Sbjct  370  VGLGNVNLIGDISMLDKMMVYDNERQQIGWAPANCSKPP  408



>emb|CDY10133.1| BnaC05g03760D [Brassica napus]
Length=427

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 109/159 (69%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GK TG+  + ++FDSGS+Y+Y NS+ Y+A +  +  +L+GKPL++   D TL  
Sbjct  269  AELLYNGKPTGLSGLKLIFDSGSTYTYFNSKTYQAIVNLIGNDLKGKPLKDVKEDKTLAI  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG  P +S+ + K  FK+    F NG R+ +  +I PESYLI+   G+VCLG+LNG+E
Sbjct  329  CWKGATPLKSVLEAKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLGILNGSE  387

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GLH  NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  388  VGLHDSNVIGDISMQGTMVIYDNEKQQLGWVSADCDKLP  426



>ref|XP_010416691.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=457

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL++   D +LP 
Sbjct  261  AELLFNAKTTGVKGIDVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLKDT-EDKSLPV  319

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++P +S+ +VKKYFK+    F N  ++  LF++  ESYLII  KG+VCLG+LNGTE
Sbjct  320  CWKGKKPMKSLDEVKKYFKTITLRFGN-QKNGQLFQVPSESYLIITEKGNVCLGILNGTE  378

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  379  VGLDSYNIIGDIFFQGIMVIYDNEQHRIGWISTDCDKTP  417



>gb|EMT17342.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=148

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = -1

Query  568  MXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRPFRSIXDV  389
            M VV DSGSS++Y ++QPY+A + ++  +L  K L+E   DP+LP CWKG++PF+S+ DV
Sbjct  1    MEVVLDSGSSFTYFSAQPYQALVTALKGDL-SKTLKEVS-DPSLPLCWKGKKPFKSVLDV  58

Query  388  KKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXXNVIGDVSM  209
            KK FKS    FANG   + L EI PE+YLI+   G+ CLG+LNG+E GL   N++GD++M
Sbjct  59   KKEFKSLVLNFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEIGLKDLNIVGDITM  116

Query  208  QDRMVIYDNEKNAIGWTRANCDRPP  134
            QD+MVIYDNE+  IGW RA CDR P
Sbjct  117  QDQMVIYDNERGQIGWIRAPCDRIP  141



>ref|XP_006302228.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
 gb|EOA35126.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
Length=465

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 111/162 (69%), Gaps = 1/162 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + +VFDSGSSY+Y N++ Y+A L  + K+L GK L++   D +LP 
Sbjct  265  AELLFNDKTTGVKGINLVFDSGSSYTYFNAEAYQAILDLIRKDLNGKLLKDTKEDKSLPV  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++  +SI +VKKYFK     F N  ++  LFE+ PESYLII  KG+VCLG+LNGTE
Sbjct  325  CWKGKKALKSIDEVKKYFKKITLRFGN-QKNGQLFEVPPESYLIITQKGNVCLGILNGTE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  125
             GL   N+IGD+  Q  +VIYDNEK  IGW   +CD+ P  N
Sbjct  384  VGLDSYNIIGDIFFQGILVIYDNEKQRIGWIPTDCDKLPKVN  425



>ref|XP_004498348.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=444

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK T VK + ++FDSGSSY+Y NSQ Y   L  V+ +L+GK L+ A  D +LP 
Sbjct  257  AELLFNGKPTAVKGLELIFDSGSSYTYFNSQAYNVVLDLVINDLKGKQLKRATEDASLPI  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ DVK YFK  A  F     S  L  I PE YLI+   G+VCLG+L+GTE
Sbjct  317  CWKGAKSFKSVSDVKNYFKPLALRFKKVKNSHML--IPPEGYLIVTKHGNVCLGILDGTE  374

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD+S+QD+MVIYDNE+  IGW  +NCDR P
Sbjct  375  IGLGYLNILGDISLQDKMVIYDNERQQIGWISSNCDRIP  413



>ref|XP_010930728.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 5/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A    G +S G K + VV DSGSSY+Y   QPY+ F++++ K+L  + L+E   D  LP 
Sbjct  267  ASLVLGSQSLGSK-LLVVLDSGSSYTYFGFQPYKDFVFAIKKDL-SRQLKETFDDSLLPL  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF+S+ DV KYFK     F NG ++R   EI PE YLI+  KG+ CLG+LNGTE
Sbjct  325  CWKGRKPFKSVLDVNKYFKPLVLSFGNGRKAR--MEIPPEKYLIVTKKGNACLGILNGTE  382

Query  250  AGLH-XXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGLH   N+IGD+S+QD +VIYDNEK  IGW RANCDR P
Sbjct  383  AGLHRDLNLIGDISLQDLVVIYDNEKQQIGWGRANCDRVP  422



>ref|XP_003523437.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN47011.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F  K+T VK + ++FDSGSSY+Y NSQ ++A +  +  +LRGKPL  A  DP+LP 
Sbjct  263  ADLFFDRKTTSVKGLELIFDSGSSYTYFNSQAHKALVNLIANDLRGKPLSRATGDPSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV   FK     F     S    ++ PE+YLI+   G+VCLG+L+GTE
Sbjct  323  CWKGPKPFKSLHDVTSNFKPLLLSFTKSKNSP--LQLPPEAYLIVTKHGNVCLGILDGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  381  IGLGNTNIIGDISLQDKLVIYDNEKQQIGWASANCDR  417



>ref|XP_010428825.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK +  VFDSGSSY+Y N++ Y+A L  + K+L GKPL++   D +LP 
Sbjct  266  AELLFNAKTTGVKGINFVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLKDT-EDQSLPV  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++P +S+ +VKKYFK+    F N  ++  L ++ PESYLII  KG+VCLG+LNGTE
Sbjct  325  CWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLLQVPPESYLIITEKGNVCLGILNGTE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  384  VGLDSYNIIGDIFFQGIMVIYDNEQHRIGWISTDCDKIP  422



>ref|XP_008444185.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=411

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG   G++ + + FDSGSSY+Y NSQ Y A L  +   L+G+PLR+A  D TLP 
Sbjct  253  AEVYFGGNPVGIRGLILTFDSGSSYTYFNSQVYGAVLNLLRNGLKGQPLRDAPEDKTLPM  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ D + +FK  A  F N    +  F+I PE+YLII   G+VCLG+LNG++
Sbjct  313  CWKGSKAFKSVADARNFFKPLALSFGN--SKKVQFQIPPEAYLIISNLGNVCLGILNGSQ  370

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM D+M++YDNE+  IGW  ANC RPP
Sbjct  371  VGLGNVNLIGDISMLDKMMVYDNERQQIGWAPANCSRPP  409



>ref|XP_009123049.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=411

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GK TG+  + ++FDSGS+Y+Y N + Y+A +  +  +L+GKP+++   D TL  
Sbjct  253  AELLYNGKPTGLNGLKLIFDSGSTYTYFNRKTYQAIVNLIGNDLKGKPVKDVKDDKTLAI  312

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +P +S+ +VK  FK+    F NG R+ +  +I PESYLI+   G+VCLG+LNG+E
Sbjct  313  CWKGAKPLKSVLEVKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLGILNGSE  371

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  372  AGLQDSNVIGDISMQGAMVIYDNEKQQLGWVSADCDKLP  410



>gb|EEC68949.1| hypothetical protein OsI_37668 [Oryza sativa Indica Group]
Length=421

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E   D +LP 
Sbjct  260  ANLYFGGRPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEV-PDHSLPL  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FK+    F+NG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  318  CWKGKKPFKSVLDVKKEFKTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  376  VGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|NP_567922.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AEE86233.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=401

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
             E  FGG++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA  D TLP 
Sbjct  254  GELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPL  313

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+GRRPF SI +VKKYFK  A  F  GWRS+TLFEI PE+YLII  KG+VCLG+LNGTE
Sbjct  314  CWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTE  373

Query  250  AGLHXXNVIG  221
             GL   N+IG
Sbjct  374  IGLQNLNLIG  383



>ref|XP_008781591.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=461

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A    G +S G K + VV DSGSSY+Y   QPY  F+ ++ K+L  +PL++A  D +LP 
Sbjct  273  ASLLLGTQSLGSK-LQVVLDSGSSYTYFGFQPYRDFISAIKKDLSRQPLKDAPDDKSLPL  331

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG R FRS+ DVKKYFK     F NG ++    EI PE+YLI+  KG+ CLG+LNGTE
Sbjct  332  CWKGPRSFRSVLDVKKYFKPLVLSFGNGRKAT--MEIPPENYLIVSKKGNACLGILNGTE  389

Query  250  AGL-HXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL H  NVIGD+S+QD +VIYDNE+  IGW +ANCDR P
Sbjct  390  AGLPHDLNVIGDISLQDLVVIYDNERRQIGWGQANCDRVP  429



>gb|EYU31770.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=410

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++T +K + +VFDSGS+Y+Y  S+ Y A +  +  +L GK L+EA  D +LP 
Sbjct  252  ADLQFGGQATNIKGLPIVFDSGSTYTYFTSKAYNALVSLIKGDLNGKQLKEAVEDKSLPV  311

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI D   YFK  A  F N    +  F+I PE YL++  +G+VCLG+LNG +
Sbjct  312  CWKGAKPFKSIRDATTYFKPLALSFTNAKNVQ--FQIRPEYYLVVTGQGNVCLGILNGGD  369

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQD++VIYDNEK  +GW  ANC+R P
Sbjct  370  VGLEDINVIGDISMQDKLVIYDNEKQQVGWAPANCNRLP  408



>ref|XP_010471942.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK +  VFDSGSSY+Y N++ Y+  L  + K+L GKPL++   D  LP 
Sbjct  267  AELLFNAKTTGVKGINFVFDSGSSYTYFNAEAYQTILDLIRKDLNGKPLKDT-EDKNLPV  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++P +S+ +VKKYFK+    F N  ++  LF++ PESYLII  KG++CLG+LNGTE
Sbjct  326  CWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGNICLGILNGTE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  385  VGLDSYNIIGDIFFQGIMVIYDNEQHRIGWISTDCDKIP  423



>gb|ABA96612.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
Length=451

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E   D +LP 
Sbjct  260  ANLYFGGRPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEV-PDHSLPL  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK F++    F+NG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  318  CWKGKKPFKSVLDVKKEFRTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  376  VGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  419



>ref|XP_011069472.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=408

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++T VK + +VFDSGS+Y+Y +SQ Y+  +  +  +L GK L++A  D +LP 
Sbjct  250  ADLQFGGQATNVKGLPIVFDSGSTYTYFSSQAYKGLVSLIKGDLNGKQLKDAVEDRSLPV  309

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI DV  YFK     F N        ++ PESYLI+   G+VCLG+L+G E
Sbjct  310  CWKGAKPFKSIRDVVNYFKPLVLNFTNA--KNIHLQLRPESYLIVTEHGNVCLGILDGGE  367

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+S+QDR+VIYDNE+  IGW  ANCDR P
Sbjct  368  VGLGNINVIGDISLQDRLVIYDNERQQIGWAPANCDRLP  406



>emb|CDY12535.1| BnaC06g00610D [Brassica napus]
Length=393

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  +  K TG+  + ++FDSGSSY+Y NS+ Y+A +  +  +L+GKPL++   D TL  
Sbjct  235  AELLYNRKPTGLNGLKLIFDSGSSYTYFNSKTYQAIVNLIGNDLKGKPLKDVKEDKTLAI  294

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +P +S+ +VK  FK+    F NG R  +  +I PESYLI+   G+VCLG+LNG+E
Sbjct  295  CWKGAKPLKSVLEVKNLFKTLTINFKNG-RKNSQLQIPPESYLIVSKTGNVCLGILNGSE  353

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  354  VGLQDSNVIGDISMQGTMVIYDNEKQQLGWVSADCDKLP  392



>ref|XP_010025732.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=436

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 112/163 (69%), Gaps = 4/163 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG +N+ ++FDSGS+++Y +S+ Y+A    V +ELR K   EA  D TLP 
Sbjct  267  AELLFAGKPTGQENLLLLFDSGSTFTYFSSKAYQALSSRVKEELRRKDFAEAVDDDTLPL  326

Query  430  CWKGRRPFRSIXDVKKYFK----SfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVL  263
            CWKG++PF++I DV KYFK    SFA  F +G R++  FE+ PESY II  KG+VC+GVL
Sbjct  327  CWKGQKPFKNIGDVTKYFKPFALSFALSFNSGGRAKNQFEVPPESYFIISDKGNVCMGVL  386

Query  262  NGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            NGTE G    NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  387  NGTEVGFQNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  429



>ref|NP_001066301.1| Os12g0177500 [Oryza sativa Japonica Group]
 gb|ABA96613.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29320.1| Os12g0177500 [Oryza sativa Japonica Group]
 dbj|BAG89196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FGG+  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E   D +LP 
Sbjct  260  ANLYFGGRPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEV-PDHSLPL  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK F++    F+NG   + L EI PE+YLI+   G+ CLG+LNG+E
Sbjct  318  CWKGKKPFKSVLDVKKEFRTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  376  VGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|XP_010521265.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010521266.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Tarenaya hassleriana]
Length=418

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS  VK + +VFDSGSSY+Y N + Y+A L  + K+L GKPL E   D +L  
Sbjct  259  AELLYNGKSISVKGLNLVFDSGSSYTYFNKKAYQAILDLINKDLDGKPLTETKEDKSLSV  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +P +S+ DV KYFK+    F  G  ++  F+I P SYLII   G+VCLG+LNGTE
Sbjct  319  CWKGVKPVKSVLDVAKYFKTLTLQFGTGKNAQP-FQIPPVSYLIITKYGNVCLGILNGTE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GLH  N+IGD   Q  MVIYDNEK+ +GW  ANCDR P
Sbjct  378  VGLHGYNIIGDNFFQGMMVIYDNEKHRVGWVPANCDRLP  416



>ref|XP_002888605.1| hypothetical protein ARALYDRAFT_475850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64864.1| hypothetical protein ARALYDRAFT_475850 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A  D TLP 
Sbjct  251  AELLFNGKPTGLKGLKLIFDTGSSYTYFNSKTYQTIVNLIGNDLKVSPLKVAKEDKTLPI  310

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ +VK +FK+    F N  R  T  +I PESYLII   G+ CLG+LNG+E
Sbjct  311  CWKGAKPFKSVLEVKNFFKTITINFTNA-RRNTQLQIPPESYLIISKTGNACLGLLNGSE  369

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  ++IYDNEK  +GW  +NC++ P
Sbjct  370  VGLQNSNVIGDISMQGLLIIYDNEKQQLGWVSSNCNKLP  408



>gb|EYU31771.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=442

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++T +K + +VFDSGS+Y+Y  S+ Y A +  +  +L GK L+EA  D +LP 
Sbjct  252  ADLQFGGQATNIKGLPIVFDSGSTYTYFTSKAYNALVSLIKGDLNGKQLKEAVEDKSLPV  311

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI D   YFK  A  F N       F+I PE YL++  +G+VCLG+LNG +
Sbjct  312  CWKGAKPFKSIRDATTYFKPLALSFTNA--KNVQFQIRPEYYLVVTGQGNVCLGILNGGD  369

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQD++VIYDNEK  +GW  ANC+R P
Sbjct  370  VGLEDINVIGDISMQDKLVIYDNEKQQVGWAPANCNRLP  408



>emb|CDP10935.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRG-KPLREAGXDPTLP  434
            A+  FGG+++GVK   +VFDSGS+Y+Y NSQ Y A +  + K++ G K L++A  D +LP
Sbjct  260  ADLFFGGQASGVKGQSIVFDSGSTYNYFNSQAYNAVVSLLKKDINGRKQLQDAVDDKSLP  319

Query  433  FCWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGT  254
             CWK  +PF+SI DVK YFK  A  F +    +  F++ PE+YLI+  +G+ CLG+LNGT
Sbjct  320  ICWKAPKPFKSILDVKSYFKPLALVFTSAKNVQ--FQLQPEAYLIVTKQGNACLGILNGT  377

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E G+   NVIGD+S+QD++VIYDNEK  IGW  ANC+R P
Sbjct  378  EVGIGKFNVIGDISLQDKLVIYDNEKQQIGWASANCNRLP  417



>ref|XP_011003438.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=425

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L GKPL++A  +  L  
Sbjct  267  AELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSTLNLVRKDLAGKPLKDAPEEKELAV  326

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK  +P +SI D+K YFK     F N    +   +++PE YLII   G+VCLG+LNG+E
Sbjct  327  CWKTAKPIKSILDIKSYFKPLTISFMNAKNVQ--LQLAPEDYLIITKDGNVCLGILNGSE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
              L   N IGD+ MQDR+VIYDNEK  IGW  ANCDR P
Sbjct  385  QHLGNFNAIGDIFMQDRVVIYDNEKQQIGWFPANCDRLP  423



>emb|CDY14973.1| BnaA10g08830D [Brassica napus]
Length=410

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (69%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GK+TG+  + ++FDSGS+Y+Y N + Y+A +  +   L+GKP+++   D TL  
Sbjct  252  AELLYNGKATGLNGLKLIFDSGSTYTYFNRKTYQAIVNLIGNNLKGKPVKDVKDDKTLAI  311

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +P +S+ +VK  FK+    F NG R+ +  +I PESYLI+   G+VCLG+LNG+E
Sbjct  312  CWKGAKPLKSVLEVKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLGILNGSE  370

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  371  VGLQDSNVIGDISMQGVMVIYDNEKQQLGWVSADCDKLP  409



>ref|XP_011069464.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=440

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++T VK + +VFDSGS+Y+Y +SQ Y+  +  +  +L GK L++A  D +LP 
Sbjct  250  ADLQFGGQATNVKGLPIVFDSGSTYTYFSSQAYKGLVSLIKGDLNGKQLKDAVEDRSLPV  309

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI DV  YFK     F N        ++ PESYLI+   G+VCLG+L+G E
Sbjct  310  CWKGAKPFKSIRDVVNYFKPLVLNFTNA--KNIHLQLRPESYLIVTEHGNVCLGILDGGE  367

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+S+QDR+VIYDNE+  IGW  ANCDR P
Sbjct  368  VGLGNINVIGDISLQDRLVIYDNERQQIGWAPANCDRLP  406



>gb|KFK42141.1| hypothetical protein AALP_AA2G216700 [Arabis alpina]
Length=461

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+ GVK++ +VFDSGSSY+Y N++ Y+  L  + K+L GKPL +   D +LP 
Sbjct  263  AELLFDGKTAGVKDINLVFDSGSSYTYFNAEAYQVILNLISKDLNGKPLVDK-EDKSLPV  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK ++P +S+ DVKKYFK+    F +  ++  LF++ PESYLII  KG+VCLG+LNGTE
Sbjct  322  CWKDKKPLKSLDDVKKYFKTITLRFGS-QKNGQLFQVPPESYLIITEKGNVCLGILNGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+  Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  381  IGLDGYNIIGDIFFQGIMVIYDNEKQRIGWIPSDCDKLP  419



>gb|KEH40514.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=415

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK T +K + ++FDSGSSY+Y NS+ Y+  +  V  +L+G  L+ A  DP+LP 
Sbjct  257  AELLFNGKPTTIKGLDLIFDSGSSYTYFNSKAYQTIVDQVTNDLKGNQLKRATEDPSLPI  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+++ DVK YFK  A  F     S+ L  I PE YLI+   G+VCLG+L+GTE
Sbjct  317  CWKGSKSFKTVSDVKNYFKPLALRFKKVKNSQML--IPPEGYLIVTKHGNVCLGILDGTE  374

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S+QD+MVIYDNE+  IGW   +CDR P
Sbjct  375  VGLGDLNIIGDISLQDKMVIYDNERQQIGWISYDCDRIP  413



>ref|XP_010521264.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Tarenaya hassleriana]
Length=453

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS  VK + +VFDSGSSY+Y N + Y+A L  + K+L GKPL E   D +L  
Sbjct  259  AELLYNGKSISVKGLNLVFDSGSSYTYFNKKAYQAILDLINKDLDGKPLTETKEDKSLSV  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +P +S+ DV KYFK+    F  G  ++  F+I P SYLII   G+VCLG+LNGTE
Sbjct  319  CWKGVKPVKSVLDVAKYFKTLTLQFGTGKNAQP-FQIPPVSYLIITKYGNVCLGILNGTE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GLH  N+IGD   Q  MVIYDNEK+ +GW  ANCDR P
Sbjct  378  VGLHGYNIIGDNFFQGMMVIYDNEKHRVGWVPANCDRLP  416



>ref|XP_010025731.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62451.1| hypothetical protein EUGRSUZ_H05086 [Eucalyptus grandis]
Length=435

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 4/162 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELR---GKPLREAGXDPT  440
            AE  F GK TG KN+ +VFDS S+Y+Y +S+ Y A    V  EL    GKP  E   DP 
Sbjct  268  AELLFAGKPTGQKNLLLVFDSASTYTYFSSEAYRALSLRVTNELEKLSGKPFTEI-RDPE  326

Query  439  LPFCWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLN  260
            LP CWKGR+ F++I +V+KYFK FA  F +G R++T FE+ PESYLII   G+VC+GVLN
Sbjct  327  LPLCWKGRQSFKNIREVRKYFKPFALTFNSGKRTKTQFEVPPESYLIISKMGNVCMGVLN  386

Query  259  GTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            GT+  L   NVIGD+SMQD+MVIYDN  + +GW   +C + P
Sbjct  387  GTQEKLGDTNVIGDISMQDKMVIYDNANHCLGWASEDCSQLP  428



>gb|KEH40515.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=441

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK T +K + ++FDSGSSY+Y NS+ Y+  +  V  +L+G  L+ A  DP+LP 
Sbjct  257  AELLFNGKPTTIKGLDLIFDSGSSYTYFNSKAYQTIVDQVTNDLKGNQLKRATEDPSLPI  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+++ DVK YFK  A  F     S+ L  I PE YLI+   G+VCLG+L+GTE
Sbjct  317  CWKGSKSFKTVSDVKNYFKPLALRFKKVKNSQML--IPPEGYLIVTKHGNVCLGILDGTE  374

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S+QD+MVIYDNE+  IGW   +CDR P
Sbjct  375  VGLGDLNIIGDISLQDKMVIYDNERQQIGWISYDCDRIP  413



>ref|XP_010268980.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
 ref|XP_010268981.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
Length=457

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE   GG STGV+ +  VFDSGSSY+Y+N++ Y A + S+  +L  KPL+E   D TLP 
Sbjct  270  AELLLGGHSTGVEGLKTVFDSGSSYTYLNNRAYHALISSMKGDLARKPLKEV-PDETLPV  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+SI D+KKYFK     F+NG     L EI PESYLII   G+ CLG+LNG E
Sbjct  329  CWKGPKPFKSISDIKKYFKPLVLRFSNG--KNALMEIQPESYLIISPYGNACLGILNGAE  386

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD  ++D+M+IYDNEK  +GW   +C+R P
Sbjct  387  VGLRDSNLIGDTFLRDKMLIYDNEKQQLGWMPTDCNRIP  425



>ref|XP_009106403.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=457

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK +  VFDSGSSY+Y N++ Y A L  V K+L+GK L++   D +LP 
Sbjct  262  AELLFDEKATGVKGVNFVFDSGSSYTYFNAEAYRAVLDLVRKDLKGKALKDTKEDKSLPV  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK +R  +S+ DVKKYFK+ +  F    +    F+I PESYLII  KG+VCLG+LNGTE
Sbjct  322  CWKDKRALKSVHDVKKYFKTISLRFGGSQK----FQIPPESYLIITEKGNVCLGILNGTE  377

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S Q  M+IYDNEK  IGW  ++CD+ P
Sbjct  378  IGLENYNIIGDISFQGIMMIYDNEKQRIGWIPSDCDKLP  416



>ref|XP_002306645.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
 gb|EEE93641.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
Length=424

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L GKPL++A  +  L  
Sbjct  267  AELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLAGKPLKDA-PEKELAV  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK  +P +SI D+K YFK     F N    +   +++PE YLII   G+VCLG+LNG+E
Sbjct  326  CWKTAKPIKSILDIKSYFKPLTISFMNAKNVQ--LQLAPEDYLIITKDGNVCLGILNGSE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
              L   NVIGD+ MQDR+VIYDNEK  IGW  ANCDR P
Sbjct  384  QQLGNFNVIGDIFMQDRVVIYDNEKQQIGWFPANCDRLP  422



>ref|XP_006390086.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
 gb|ESQ27372.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
Length=468

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K+TGVK + +VFDSGSSY+Y N++ Y+A L  + K+++GK L +A  D +LP 
Sbjct  268  AELLFNDKTTGVKGINLVFDSGSSYTYFNAEAYKAILDLIRKDVKGKALMDAKEDKSLPV  327

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK ++P +S+ DVKKYFK+    F +  +S  LF + PESYLII   G+VCLG+LNGTE
Sbjct  328  CWKDKKPLKSVHDVKKYFKTITLRFGS-QKSGQLFHVPPESYLIITENGNVCLGILNGTE  386

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+  Q  MVIYDNEK  IGW  ++C++ P
Sbjct  387  IGLENYNIIGDIFFQGIMVIYDNEKQRIGWIPSDCNKLP  425



>ref|NP_175079.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50556.1|AC074228_11 nucellin, putative [Arabidopsis thaliana]
 gb|AEE32023.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=405

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A  D TLP 
Sbjct  246  ADLLFNGKPTGLKGLKLIFDTGSSYTYFNSKAYQTIINLIGNDLKVSPLKVAKEDKTLPI  305

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ +VK +FK+    F NG R+  L+ ++PE YLI+   G+VCLG+LNG+E
Sbjct  306  CWKGAKPFKSVLEVKNFFKTITINFTNGRRNTQLY-LAPELYLIVSKTGNVCLGLLNGSE  364

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  M+IYDNEK  +GW  ++C++ P
Sbjct  365  VGLQNSNVIGDISMQGLMMIYDNEKQQLGWVSSDCNKLP  403



>ref|XP_011468243.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+TG++N+ +VFDSGSSY+Y+NSQ Y      + +EL GKPL+E   D TLP 
Sbjct  262  AELIFDGKTTGMRNLHLVFDSGSSYTYLNSQAYHFLTLWLKRELNGKPLKETSDDRTLPL  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF++I +VKKYFK  A  FA G +    FE+SPE+YLII  KG+VCLG+L+GTE
Sbjct  322  CWKGRKPFKNIREVKKYFKPIALRFAIGRKDAAQFELSPEAYLIISSKGNVCLGILDGTE  381

Query  250  AGLHXXNVIGDVSMQDRMV  194
             GL   N+IGD+SMQD+M+
Sbjct  382  VGLQNSNIIGDISMQDKMI  400



>ref|XP_003526637.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN21715.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F  K T VK + ++FDSGSSY+Y NS+ ++A +  V  +LRGKPL  A  D +LP 
Sbjct  263  ADLFFDRKPTSVKGLQLIFDSGSSYTYFNSKAHKALVNLVTNDLRGKPLSRATEDSSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G +PF+S+ DV   FK     F     S  L ++ PE+YLI+   G+VCLG+L+GTE
Sbjct  323  CWRGPKPFKSLHDVTSNFKPLLLSFTKSKNS--LLQLPPEAYLIVTKHGNVCLGILDGTE  380

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             GL   N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  381  IGLGNTNIIGDISLQDKLVIYDNEKQQIGWASANCDR  417



>ref|XP_006303534.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
 gb|EOA36432.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
Length=406

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +++  PL+ A  D TLP 
Sbjct  247  AELLFNAKPTGLKGLKLIFDTGSSYTYFNSKTYQTVVKLIENDVKSTPLKVAKDDKTLPI  306

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ +VK  FK+    F NG R  T  +I PESYLI+   G VCLG+LNG+E
Sbjct  307  CWKGPKPFKSVLEVKNLFKTLTINFTNG-RKNTQLQIPPESYLIVSKTGHVCLGLLNGSE  365

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQ  M+IYDNEK  +GW  ++C + P
Sbjct  366  VGLQDSNVIGDISMQGLMMIYDNEKQQLGWVASDCKKLP  404



>gb|KJB29193.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=266

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +   D  LP 
Sbjct  108  AELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-KDKALPI  166

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D + YF +FA  F     S    ++ PE+YLI+  +G+VCLG+LNG E
Sbjct  167  CWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAE  224

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
            AGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  225  AGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  261



>ref|XP_007019119.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16344.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=408

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TGVK + V+FDSG++Y+Y++S+ Y+  L  + K+L GK LR+   D  LP 
Sbjct  252  AELLFGGKPTGVKGLNVIFDSGATYTYLSSKVYQTVLNLIRKDLTGKQLRDV-KDNALPI  310

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV+ YF +    FA    ++ +  + PE+YLI+  +G+VCLG+L+GTE
Sbjct  311  CWKGAKPFKSVRDVRNYFNTLVLSFAGANNNKLV--LPPEAYLIVTERGNVCLGILSGTE  368

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+QD++VIYDNE   IGW  A+C R P
Sbjct  369  AGLGITNVIGDISLQDKLVIYDNENQRIGWASADCTRKP  407



>ref|XP_007137426.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
 gb|ESW09420.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
Length=416

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F GK T VK + +VFDSGSSY+Y NS+ + A +  +  +++GK L  A  DP+LP 
Sbjct  258  ADLLFDGKPTSVKGLELVFDSGSSYTYFNSRAHRALVDLITNDIKGKSLTRATADPSLPI  317

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV + FK     F     S+   ++ PE+YLI+   G+VCLG+L+GTE
Sbjct  318  CWKGPKPFKSLHDVTRNFKPLVLSFTKSKNSQ--LQVPPEAYLIVTKHGNVCLGILDGTE  375

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  137
             G+   N+IGD+S+QD++VIYDNEK  IGW  A CD P
Sbjct  376  VGMGNINIIGDISLQDKIVIYDNEKQQIGWASAKCDGP  413



>ref|XP_004240544.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=418

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++TG+K++ ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A  D +LP 
Sbjct  259  ADLLFGGQATGMKSLPIILDSGSTFTYFNSEAYKTLLSSIKKNIDAKQLTDAVNDKSLPV  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D  +YFK     F          +++PE+YLI   KG+VCLG+LNG+E
Sbjct  319  CWKGSKPFKSLKDATRYFKPLTLSFTKA--KNIQLQLTPEAYLIHTNKGNVCLGILNGSE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  131
             GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P+
Sbjct  377  VGLGAVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLPS  416



>ref|XP_004240543.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++TG+K++ ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A  D +LP 
Sbjct  259  ADLLFGGQATGMKSLPIILDSGSTFTYFNSEAYKTLLSSIKKNIDAKQLTDAVNDKSLPV  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D  +YFK     F          +++PE+YLI   KG+VCLG+LNG+E
Sbjct  319  CWKGSKPFKSLKDATRYFKPLTLSFTKA--KNIQLQLTPEAYLIHTNKGNVCLGILNGSE  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  131
             GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P+
Sbjct  377  VGLGAVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLPS  416



>ref|XP_011027496.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
 ref|XP_011014192.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
Length=425

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 109/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A  +  L  
Sbjct  267  AELLFGGKPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEEKALAV  326

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWK  +P +SI D+K +FK       N  +++ +  +++PE YLII   G+VCLG+LNG 
Sbjct  327  CWKTAKPIKSILDIKSFFKP---LTINFIKAKNVQLQLAPEDYLIITKDGNVCLGILNGG  383

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E GL   NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  384  EQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  423



>gb|KDP32842.1| hypothetical protein JCGZ_12134 [Jatropha curcas]
Length=478

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TGVK    +FDSGSSYSY N+Q Y+  L  + K+L GK L++A  +  L  
Sbjct  271  AELLFGGKPTGVKGQRFIFDSGSSYSYFNAQLYKNMLNLIRKDLSGKQLKDAPEEKALSI  330

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+++ D K YFK  A  F          ++ PE YLI+   G+VCLG+LNG+E
Sbjct  331  CWKGIKPFKTVSDAKSYFKPLALSFTAA--KNVQLQLQPEDYLIVTNGGNVCLGILNGSE  388

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  113
             GL   NVIGD+  QD++VIYDN+K+ IGW  ANCDR P  +  FI
Sbjct  389  VGLGNLNVIGDIFFQDKLVIYDNDKHQIGWVPANCDRLPNVDRDFI  434



>ref|XP_002441914.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
 gb|EES15752.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
Length=429

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 111/159 (70%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FG +S  VK   VVFDSGSS++Y  +QPY+A + ++  +L  + L+E   DP+LP 
Sbjct  267  ASLYFGDQSLRVKLTEVVFDSGSSFTYFAAQPYQALVTALKGDLS-RTLKEV-SDPSLPL  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++PF+S+ DVKK FKS    F NG  ++   EI P++YLI+   G+ CLG+LNG+E
Sbjct  325  CWKGKKPFKSVLDVKKEFKSLVLNFGNG--NKAFMEIPPQNYLIVTKYGNACLGILNGSE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   +++GD++MQD+MVIYDNEK  IGW RA CDR P
Sbjct  383  VGLKDLSILGDITMQDQMVIYDNEKGQIGWIRAPCDRIP  421



>ref|XP_010322933.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=424

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++TG+K++ ++FDSGS+++Y +S+ Y+ FL S+ K +  K L +A  D +LP 
Sbjct  232  AELLFDGQATGIKSLPIIFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDATDDKSLPV  291

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G +PF+S+ D   YFK F   F      +  F++ PE+YLI+   G+VCLG+LNGTE
Sbjct  292  CWSGSKPFKSVNDATIYFKPFTLSFMKAKNVK--FQLLPEAYLIVTEHGNVCLGILNGTE  349

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S+ D+MVIYDNEK  IGW  ANC++ P
Sbjct  350  VGLENHNLIGDISLLDKMVIYDNEKKQIGWHPANCNKFP  388



>ref|XP_004242040.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=441

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++TG+K++ ++FDSGS+++Y +S+ Y+ FL S+ K +  K L +A  D +LP 
Sbjct  249  AELLFDGQATGIKSLPIIFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDATDDKSLPV  308

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G +PF+S+ D   YFK F   F      +  F++ PE+YLI+   G+VCLG+LNGTE
Sbjct  309  CWSGSKPFKSVNDATIYFKPFTLSFMKAKNVK--FQLLPEAYLIVTEHGNVCLGILNGTE  366

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S+ D+MVIYDNEK  IGW  ANC++ P
Sbjct  367  VGLENHNLIGDISLLDKMVIYDNEKKQIGWHPANCNKFP  405



>ref|XP_011027495.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
 ref|XP_011014191.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
Length=463

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 109/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A  +  L  
Sbjct  267  AELLFGGKPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEEKALAV  326

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWK  +P +SI D+K +FK       N  +++ +  +++PE YLII   G+VCLG+LNG 
Sbjct  327  CWKTAKPIKSILDIKSFFKP---LTINFIKAKNVQLQLAPEDYLIITKDGNVCLGILNGG  383

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E GL   NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  384  EQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  423



>ref|XP_002302227.1| nucellin family protein [Populus trichocarpa]
 gb|EEE81500.1| nucellin family protein [Populus trichocarpa]
Length=422

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L G PL++A  +  L  
Sbjct  264  AELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLSGMPLKDAPEEKALAV  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWK  +P +SI D+K +FK       N  +++ +  +++PE YLII   G+VCLG+LNG 
Sbjct  324  CWKTAKPIKSILDIKSFFKP---LTINFIKAKNVQLQLAPEDYLIITKDGNVCLGILNGG  380

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E GL   NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  381  EQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  420



>gb|KJB29183.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
 gb|KJB29185.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=294

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP 
Sbjct  95   AEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPI  153

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YF +    F +    +   E+ PE+YLI+   G+ C G+LNGTE
Sbjct  154  CWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNACFGILNGTE  211

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  212  AGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  250



>gb|KJB29192.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
 gb|KJB29194.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=332

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +   D  LP 
Sbjct  174  AELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-KDKALPI  232

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D + YF +FA  F     S    ++ PE+YLI+  +G+VCLG+LNG E
Sbjct  233  CWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAE  290

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
            AGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  291  AGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  327



>ref|XP_010025733.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62452.1| hypothetical protein EUGRSUZ_H05087 [Eucalyptus grandis]
Length=434

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 105/159 (66%), Gaps = 1/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG KN+ ++FDSGS+Y+Y +S+ YEA    V  EL GKP  E   DP LP 
Sbjct  270  AELFFAGKPTGQKNLKLLFDSGSTYTYFSSKAYEALSSRVKNELIGKPFTEI-RDPDLPL  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWK R+ F+ I DV KYFK FA  F  G  + + FE+ PESYLI    G+VC+GVLNGT+
Sbjct  329  CWKCRKSFKDIRDVTKYFKPFALTFNRGESTESQFEVPPESYLIRSVMGNVCMGVLNGTQ  388

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   N+IGD SM D+MVIYDN  + +GW   +C + P
Sbjct  389  AGLKDRNLIGDTSMLDKMVIYDNANHFLGWASEDCSQLP  427



>ref|XP_006386369.1| hypothetical protein POPTR_0002s08190g [Populus trichocarpa]
 gb|ERP64166.1| hypothetical protein POPTR_0002s08190g [Populus trichocarpa]
Length=460

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L G PL++A  +  L  
Sbjct  264  AELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLSGMPLKDAPEEKALAV  323

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWK  +P +SI D+K +FK       N  +++ +  +++PE YLII   G+VCLG+LNG 
Sbjct  324  CWKTAKPIKSILDIKSFFKP---LTINFIKAKNVQLQLAPEDYLIITKDGNVCLGILNGG  380

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            E GL   NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  381  EQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  420



>gb|KJB29184.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=305

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP 
Sbjct  106  AEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPI  164

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YF +    F +        E+ PE+YLI+   G+ C G+LNGTE
Sbjct  165  CWKGTKPFKSVHDVKNYFSTLTLKFKD--TQNIQLELQPEAYLIVTEDGNACFGILNGTE  222

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  223  AGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  261



>ref|NP_001131929.1| uncharacterized protein LOC100193320 precursor [Zea mays]
 gb|ACF80557.1| unknown [Zea mays]
Length=424

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 110/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP 
Sbjct  259  ASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+ PF+S+ DV+K FKS    FA+G   +TL EI PE+YLI+   G+ CLG+LNG+E
Sbjct  317  CWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSE  374

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  375  IGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  413



>ref|XP_006355805.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006355806.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Solanum 
tuberosum]
Length=363

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 106/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++TG+K + ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A  D +LP 
Sbjct  204  ADLLFGGQATGIKGLPIILDSGSTFTYFNSKAYKTLLSSIKKNIDAKQLTDAVNDKSLPV  263

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D   YFK     F      +   +++PE+YLI   KG+VCLG+LNG+ 
Sbjct  264  CWKGSKPFKSLKDATMYFKPLTLSFTKAKNIQ--LQLTPEAYLIYTDKGNVCLGILNGSV  321

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  322  VGLGDVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLP  360



>ref|NP_001152116.1| aspartic proteinase Asp1 precursor [Zea mays]
 gb|ACG45850.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=432

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 110/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP 
Sbjct  267  ASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPL  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+ PF+S+ DV+K FKS    FA+G   +TL EI PE+YLI+   G+ CLG+LNG+E
Sbjct  325  CWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  383  IGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  421



>gb|ACR34528.1| unknown [Zea mays]
 gb|AFW56222.1| aspartic proteinase Asp1 [Zea mays]
Length=433

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 110/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP 
Sbjct  268  ASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+ PF+S+ DV+K FKS    FA+G   +TL EI PE+YLI+   G+ CLG+LNG+E
Sbjct  326  CWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  384  IGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  422



>gb|KJB29189.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=407

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +   D  LP 
Sbjct  249  AELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-KDKALPI  307

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D + YF +FA  F     S    ++ PE+YLI+  +G+VCLG+LNG E
Sbjct  308  CWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAE  365

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
            AGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  366  AGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  402



>ref|XP_008661408.1| PREDICTED: uncharacterized protein LOC100193320 isoform X1 [Zea 
mays]
Length=471

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 110/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP 
Sbjct  268  ASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPL  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG+ PF+S+ DV+K FKS    FA+G   +TL EI PE+YLI+   G+ CLG+LNG+E
Sbjct  326  CWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  384  IGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  422



>gb|KJB29190.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=428

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +   D  LP 
Sbjct  270  AELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-KDKALPI  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D + YF +FA  F     S    ++ PE+YLI+  +G+VCLG+LNG E
Sbjct  329  CWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAE  386

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
            AGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  387  AGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  423



>ref|XP_006355804.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Solanum 
tuberosum]
Length=418

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++TG+K + ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A  D +LP 
Sbjct  259  ADLLFGGQATGIKGLPIILDSGSTFTYFNSKAYKTLLSSIKKNIDAKQLTDAVNDKSLPV  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D   YFK     F          +++PE+YLI   KG+VCLG+LNG+ 
Sbjct  319  CWKGSKPFKSLKDATMYFKPLTLSFTKA--KNIQLQLTPEAYLIYTDKGNVCLGILNGSV  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  377  VGLGDVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLP  415



>ref|XP_006365534.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=441

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++TGVK + +VFDSGS+++Y +S+ Y+ FL S+ K +  K L +A  D +LP 
Sbjct  249  AELLFDGQATGVKGLPIVFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDATNDKSLPV  308

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G +PF+S  D   YFK F   F         F++ PE+YLI+   G+VCLG+LNGTE
Sbjct  309  CWSGSKPFKSANDATIYFKPFTLSFMKA--KNVEFQLLPEAYLILTEHGNVCLGILNGTE  366

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S+ D+MV+YDNEK  IGW  ANC + P
Sbjct  367  VGLGNHNLIGDISLLDKMVVYDNEKKQIGWLPANCKKLP  405



>ref|XP_009611015.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
 ref|XP_009611017.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=417

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G++TG+K + ++FDSGS+YSY NS  Y+  + S+ K++  K L EA  D +LP 
Sbjct  261  ADLLFSGQATGIKGIPIIFDSGSTYSYFNSDAYKILVSSIKKDINTKQLTEAVDDKSLPV  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+SI D K YFK     F          ++SPE+YL+    G++CLG+L+G+E
Sbjct  321  CWKGSKSFKSIHDAKSYFKPLTLSFTKA--KNVQLQLSPEAYLVRTEHGNICLGILDGSE  378

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  379  VGLGNYNIIGDISMVDKMVIYDNEKQQIGWVPANCNKLP  417



>ref|XP_002520345.1| nucellin, putative [Ricinus communis]
 gb|EEF42131.1| nucellin, putative [Ricinus communis]
Length=424

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  +GGK TG K    +FDSGSSY+Y N+Q Y++ L  + KEL GKPLR+A  +  L  
Sbjct  266  AELLYGGKPTGTKAEEFIFDSGSSYTYFNAQVYQSTLNLIRKELSGKPLRDAPEEKALAI  325

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ +VK YFK FA  F      +   +I PE YLI+   G+VCLG+LNG+E
Sbjct  326  CWKGTKRFKSVNEVKSYFKPFALSFTKAKSVQ--LQIPPEDYLIVTNDGNVCLGILNGSE  383

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD   QD++VIYD++K+ IGW  ANCDR P
Sbjct  384  VGLGNFNVIGDNLFQDKLVIYDSDKHQIGWIPANCDRLP  422



>ref|XP_006355850.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=400

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 107/160 (67%), Gaps = 2/160 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  FGG++TG+K + ++ DSG++++Y NS+ Y+  L  + K +  K L +A  D +LP 
Sbjct  211  ADVLFGGQATGIKGIPIILDSGTTFTYFNSEAYKTLLSLIKKNIDTKQLTDAVDDKSLPV  270

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D   YFK     F      +   ++ PE+YLI+  KG VCLG+LNG+E
Sbjct  271  CWKGSKPFKSLKDATMYFKPLTLSFTKAKNIQ--LQLLPEAYLILTDKGHVCLGILNGSE  328

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  131
            AG+   N+IGD+SM D++VIYDNEK  IGW  ANC++ P+
Sbjct  329  AGIGDVNLIGDISMLDKLVIYDNEKQQIGWAPANCNKLPS  368



>gb|KJB29187.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=418

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP 
Sbjct  263  AEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YF +    F +    +   E+ PE+YLI+   G+ C G+LNGTE
Sbjct  322  CWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNACFGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  380  AGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>gb|AES87275.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=424

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F GK T  K + ++FDSGSSY+Y + + Y      V  +L+GKPLR    DP+LP CWKG
Sbjct  271  FNGKPTPAKGLQIIFDSGSSYTYFSPRVYTIVANMVNNDLKGKPLRRETKDPSLPICWKG  330

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGTEAGL  242
             +PF+S+ +V  YFK     F    +S+ L F++ P +YLII   G+VCLG+LNG EAGL
Sbjct  331  VKPFKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVAYLIITKFGNVCLGILNGNEAGL  387

Query  241  HXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
               NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  388  GNRNVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  423



>gb|KJB29182.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=460

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP 
Sbjct  263  AEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YF +    F +    +   E+ PE+YLI+   G+ C G+LNGTE
Sbjct  322  CWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNACFGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  380  AGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>gb|KJB29181.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=462

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP 
Sbjct  263  AEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DVK YF +    F +    +   E+ PE+YLI+   G+ C G+LNGTE
Sbjct  322  CWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNACFGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            AGL   NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  380  AGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>gb|KHG10363.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10554.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10792.1| Asparticase Asp1 [Gossypium arboreum]
Length=426

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K + V+FD+GS+Y+Y+N + YE  L  + K L GK L +   D  LP 
Sbjct  270  AELLFSGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKNLSGKQLHDV-KDKALPI  328

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ D + YF +FA  F     S    ++ PE+YLI+  +G+VCLG+LNG E
Sbjct  329  CWKGTKPFKSVRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAE  386

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
            AGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  387  AGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  423



>ref|XP_004142630.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161165.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54552.1| hypothetical protein Csa_4G361860 [Cucumis sativus]
Length=413

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++ G+  + + FDSGSSY+Y NSQ Y A    +  +L+G PL+ A  D TL  
Sbjct  251  AEVYFNGRAVGIGGLTLTFDSGSSYTYFNSQVYRAIEKLLKNDLKGNPLKLASDDKTLEL  310

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF S+ DV+ +FK  A  F N       F+I PE+YLII   G+VCLG+L+G++
Sbjct  311  CWKGPKPFESVVDVRNFFKPLAMSFKN--SKNVQFQIPPEAYLIISEFGNVCLGILDGSK  368

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             G+   N+IGD+SM +++V+YDNE+  IGW  +NC+R P
Sbjct  369  EGMGNVNIIGDISMLNKIVVYDNERERIGWASSNCNRSP  407



>ref|XP_009596730.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana tomentosiformis]
Length=455

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++TGVK   ++FDSGS++SY+NS+ Y+  + S+ K +  K L +A  D +LP 
Sbjct  262  AELFFDGQATGVKGFPLIFDSGSTFSYLNSEAYDILVSSIKKNINAKQLTDAVDDTSLPV  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G + F+++ D   YFK     F          ++ PE+YLI+   G+VCLG+LNGTE
Sbjct  322  CWNGSKSFKTVNDATSYFKPLTLSFMKA--KNVELQLQPEAYLILTEHGNVCLGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+S+ D+MVIYDNEK  +GW  ANC+R P
Sbjct  380  VGLGNYNVIGDISLLDKMVIYDNEKQRVGWLPANCNRLP  418



>ref|XP_004502513.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 104/161 (65%), Gaps = 3/161 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G  T VKN+ ++FDSGSSY+Y N + Y A +  V  +++GK L +A  DP+LP 
Sbjct  260  ADILFNGMPTSVKNIQLIFDSGSSYTYFNPEVYNAVVTLVNNDVKGK-LSDAFDDPSLPL  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG  PF+S+ DV+ YFK     F+N   S   F + P +YLII   G+VCLG+L G++
Sbjct  319  CWKGAEPFKSLSDVETYFKPLDLSFSNSMDSP--FHLPPSAYLIITEHGNVCLGILEGSQ  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  128
              L   NVIGD+S+QD++VIYDNE   IGW   +C+  P P
Sbjct  377  VDLGDLNVIGDISLQDKVVIYDNENKQIGWASTDCNTHPHP  417



>ref|XP_009758779.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana sylvestris]
Length=455

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++TGVK   V+FDSGS++SY +S+ Y+  + S+ K +  K L +A  D +LP 
Sbjct  262  AELFFDGQATGVKGFPVIFDSGSTFSYFSSEAYDILVSSIKKNINAKQLTDAVDDKSLPV  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G + F+S+ D   YFK     F          ++ PE+YLI+   G+VCLG+LNGTE
Sbjct  322  CWNGSKSFKSVNDATSYFKPLTLSFMKA--KNVELQLQPEAYLILTEHGNVCLGILNGTE  379

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+S+ D+MVIYDNEK  +GW  ANC+R P
Sbjct  380  VGLGNYNVIGDISLLDKMVIYDNEKQQVGWLPANCNRLP  418



>ref|XP_011074834.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=403

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 5/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+   GG++  +K + +VFDSGS+YSY +SQ Y   +  +   L G  L++A  D +LP 
Sbjct  247  ADLWLGGQAANIKGLQIVFDSGSTYSYFSSQAYNYLVSLMRDNLNGNQLKDAVEDRSLPI  306

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG  PF+SI D   YFK     F N       F++ PE+YLI+   G+VCLG+L+G E
Sbjct  307  CWKGAEPFKSIRDAVGYFKPLVLSFKN-----VEFQVQPEAYLIVTVHGNVCLGILDGGE  361

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD+SMQD+MVIYDNE+  IGW  +NC+  P
Sbjct  362  VGLGNLNVIGDISMQDKMVIYDNERQQIGWAPSNCNSHP  400



>emb|CBI18999.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G+++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E   D +LP 
Sbjct  234  ADLLFNGQNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETA-DESLPV  291

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G +PF+SI +VK YFK FA  F     ++   ++ PESYLII   G+ CLG+LNG+E
Sbjct  292  CWRGAKPFKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGILNGSE  349

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  350  VGLGDSNVIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  388



>ref|XP_009802241.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802242.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802243.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802244.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=417

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G++TG+K + ++FDSGS+YSY NS+ Y+  + S+ K++  K L +A  D +LP 
Sbjct  261  ADLLFSGQATGIKGIPIIFDSGSTYSYFNSEAYKILVSSIKKDVNTKQLTDAVDDKSLPV  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+SI D K +FK     F          ++ PE+YL+    G++CLG+L+GT+
Sbjct  321  CWKGSKSFKSIHDAKSFFKPLTLSFTKA--KNVQLQLPPEAYLVRTEHGNICLGILDGTD  378

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             G+   N+IGDVSM D+MVIYDNEK  IGW  ANC++ P
Sbjct  379  VGIGNYNIIGDVSMVDKMVIYDNEKQQIGWVPANCNKLP  417



>ref|XP_010664194.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Vitis vinifera]
Length=423

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G+++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E   D +LP 
Sbjct  267  ADLLFNGQNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETA-DESLPV  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G +PF+SI +VK YFK FA  F     ++   ++ PESYLII   G+ CLG+LNG+E
Sbjct  325  CWRGAKPFKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGILNGSE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  383  VGLGDSNVIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  421



>ref|XP_002285867.2| PREDICTED: aspartic proteinase Asp1 isoform X1 [Vitis vinifera]
Length=453

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 8/176 (5%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G+++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E   D +LP 
Sbjct  267  ADLLFNGQNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETA-DESLPV  324

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G +PF+SI +VK YFK FA  F     ++   ++ PESYLII   G+ CLG+LNG+E
Sbjct  325  CWRGAKPFKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGILNGSE  382

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP----NVVFIXTNLGF  95
             GL   NVIGD++ QD+MVIYDNE+  IGW   +C++ P      N+ F   +LG 
Sbjct  383  VGLGDSNVIGDIAFQDKMVIYDNERQQIGWVPKDCNKLPKVDRDYNIGFSPADLGM  438



>ref|XP_003605080.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AES87277.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=425

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 103/156 (66%), Gaps = 5/156 (3%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F GK T  K + ++FDSGSSY+Y +S  Y      V  +L+GKPL     DP+LP CWKG
Sbjct  272  FNGKPTPAKGLQIIFDSGSSYTYFSSPVYTIVANMVNNDLKGKPLSRV-KDPSLPICWKG  330

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGTEAGL  242
             +PF+S+ +V  YFK     F    +S+ L F++ P +YLII   G+VCLG+LNG EAGL
Sbjct  331  VKPFKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVAYLIITKYGNVCLGILNGNEAGL  387

Query  241  HXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
               NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  388  GNRNVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  423



>ref|XP_004502512.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+  F G  T VKN+ ++FDSGSSY+Y NS+ Y A +  V  +++GK L +A  DP+LP 
Sbjct  260  ADILFNGMPTSVKNIQLIFDSGSSYTYFNSEAYNAVVALVKNDVKGK-LSDASDDPSLPI  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGT  254
            CWKG  PF+S+ DV  YFK     F+   +S  L F + P +YLII   G+VCLG+L+G+
Sbjct  319  CWKGAEPFKSLSDVDTYFKPLDLSFS---KSNDLYFHLPPSAYLIITEHGNVCLGILDGS  375

Query  253  EAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  128
            +  L   NVIGD+ +QD++VIYDNE   +GW  A+C+  P P
Sbjct  376  QVDLGDLNVIGDIFLQDKVVIYDNENKRVGWASADCNTHPHP  417



>gb|EPS72688.1| hypothetical protein M569_02067 [Genlisea aurea]
Length=404

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A+   GGK+T ++ + +VFDSGS+Y+Y +S+ Y + +  +   +  K L++A  D TLP 
Sbjct  246  ADILLGGKATTIRGLPIVFDSGSTYTYFSSRAYGSLVSLMKANIDSKQLKDAPEDRTLPV  305

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV   FK     F         F++ P+SYLI+   G+VCLG+LNG E
Sbjct  306  CWKGGKPFKSVNDVATLFKPLTLSFTK--VKNVQFQLPPQSYLIVTEHGNVCLGILNGGE  363

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+S+ D++V+YDNEK+ IGW  ANCDR P
Sbjct  364  VGLGNINLIGDISLVDKLVVYDNEKHRIGWAAANCDRLP  402



>ref|XP_008444184.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=414

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F G++ G+ ++ + FDSGSSY+Y NSQ Y A    +  +L+G+PL+ A  D TL  
Sbjct  252  AEVYFNGRAVGIGSLTLTFDSGSSYTYFNSQVYRAIEKLLKNDLKGQPLKLASDDKTLEL  311

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F S+ DV+ +FK  A  F N    +  F+I PE+YLII   G+ CLG+L+GT+
Sbjct  312  CWKGPKAFESVIDVRNFFKPLAMSFKNSKNVQ--FQIPPEAYLIISKFGNACLGILDGTK  369

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   N+IGD+SM +++V+YDNE+  IGW   NC+R P
Sbjct  370  EGLGNINLIGDISMLNKIVVYDNERKQIGWASENCNRLP  408



>ref|XP_011468246.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+TG++N+ +VFDSGSSY+Y+NSQ Y      + +EL GKPL+E   D TLP 
Sbjct  262  AELIFDGKTTGMRNLHLVFDSGSSYTYLNSQAYHFLTLWLKRELNGKPLKETSDDRTLPL  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PF++I +VKKYFK  A  FA G +    FE+SPE+YLII  KG+VCLG+L+GTE
Sbjct  322  CWKGRKPFKNIREVKKYFKPIALRFAIGRKDAAQFELSPEAYLIISSKGNVCLGILDGTE  381

Query  250  AGLHXXNVIGD  218
             GL   N+IGD
Sbjct  382  VGLQNSNIIGD  392



>gb|KDO52229.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=380

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA  D TLP 
Sbjct  246  AELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPL  305

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+++ DVKK F++ A  F +G ++RTLFE++PE+YLII  KG+VCLG+LNG E
Sbjct  306  CWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAE  364

Query  250  AGLHXXNVIGDV  215
             GL   NVIG +
Sbjct  365  VGLQDLNVIGGI  376



>ref|XP_007019121.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY16346.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=470

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 107/159 (67%), Gaps = 3/159 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ TG K + V+FD+G++Y+Y++S+ Y+  L  + K+L GK LR+   D  LP 
Sbjct  314  AELLFGGEPTGAKGLYVIFDTGATYTYLSSEVYQTLLNLIRKDLAGKQLRDV-KDYALPI  372

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG +PF+S+ DV+ YF +    F     ++ +  + PE+Y+I+  +G+VCLG+LNGTE
Sbjct  373  CWKGAKPFKSVRDVRNYFNTLVLSFTGANNNKLV--LPPEAYIIVTERGNVCLGILNGTE  430

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
             GL   NVIG +S+QD++VIYDNE   IGW  A+  R P
Sbjct  431  VGLGITNVIGAISLQDKLVIYDNENQRIGWASADGTRKP  469



>gb|KDO52225.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=397

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA  D TLP 
Sbjct  263  AELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPL  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGRRPF+++ DVKK F++ A  F +G ++RTLFE++PE+YLII  KG+VCLG+LNG E
Sbjct  323  CWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAE  381

Query  250  AGLHXXNVIGDV  215
             GL   NVIG +
Sbjct  382  VGLQDLNVIGGI  393



>gb|AAM76716.1| nucellin-like aspartic protease [Zea mays]
Length=357

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 105/156 (67%), Gaps = 11/156 (7%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---KPLREAGXDPTLPFC  428
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   DPTLP C
Sbjct  200  FDRRSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQV-SDPTLPLC  254

Query  427  WKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEA  248
            WKG++ F+S+ DVK  FKS    FA+        EI PE+YLI+   G+VCLG+L+GT A
Sbjct  255  WKGQKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVTKNGNVCLGILDGTAA  312

Query  247  GLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             L   NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  313  KLSF-NVIGDITMQDQMVIYDNEKSQLGWARGACTR  347



>gb|AAY23266.1| Similar to nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 gb|ABA91763.1| Aspartic proteinase Asp1 precursor, putative [Oryza sativa Japonica 
Group]
Length=307

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 103/164 (63%), Gaps = 8/164 (5%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   F   S G+  M VVFDSGS+Y+Y  +QPY+A +Y++   L    L +   DP+LP 
Sbjct  148  ATLYFDRHSLGMNPMDVVFDSGSTYTYFTAQPYQATVYAIKGGLSSTSLEQV-SDPSLPL  206

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++ F S+ DVKK FKS    F N      + EI PE+YLI+   G+VCLG+L+G  
Sbjct  207  CWKGQKAFESVFDVKKEFKSLQLNFGN----NAVMEIPPENYLIVTEYGNVCLGILHGCR  262

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
                  N+IGD++MQD+MVIYDNE+  +GW R +C R P  +V+
Sbjct  263  LNF---NIIGDITMQDQMVIYDNEREQLGWIRGSCGRSPTKSVM  303



>ref|XP_008669793.1| PREDICTED: aspartic proteinase Asp1 [Zea mays]
 gb|ACL53484.1| unknown [Zea mays]
 gb|ACL54629.1| unknown [Zea mays]
 tpg|DAA38945.1| TPA: nucellin-like aspartic protease [Zea mays]
Length=415

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 105/156 (67%), Gaps = 11/156 (7%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---KPLREAGXDPTLPFC  428
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   DPTLP C
Sbjct  258  FDRRSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQV-SDPTLPLC  312

Query  427  WKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEA  248
            WKG++ F+S+ DVK  FKS    FA+        EI PE+YLI+   G+VCLG+L+GT A
Sbjct  313  WKGQKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVTKNGNVCLGILDGTAA  370

Query  247  GLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             L   NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  371  KLSF-NVIGDITMQDQMVIYDNEKSQLGWARGACTR  405



>gb|ACG42043.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=415

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 105/156 (67%), Gaps = 11/156 (7%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---KPLREAGXDPTLPFC  428
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   DPTLP C
Sbjct  258  FDRRSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQV-SDPTLPLC  312

Query  427  WKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEA  248
            WKG++ F+S+ DVK  FKS    F++        EI PE+YLI+   G+VCLG+L+GT A
Sbjct  313  WKGQKAFKSVFDVKNEFKSMFLSFSSA--KNAAMEIPPENYLIVTKNGNVCLGILDGTAA  370

Query  247  GLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             L   NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  371  KLSF-NVIGDITMQDQMVIYDNEKSQLGWARGACTR  405



>ref|XP_010680865.1| PREDICTED: aspartic proteinase Asp1-like [Beta vulgaris subsp. 
vulgaris]
Length=437

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 103/162 (64%), Gaps = 3/162 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F  ++     +  V D+GS+Y+Y +SQ YEA L  + K +  K L+    D TLP 
Sbjct  255  AELVFNERNVVKGGLSFVLDTGSTYTYFSSQVYEAALSMINKNIDSKQLKTVPEDKTLPV  314

Query  430  CWKGRRPFRSIXDVKKYFKSfa---xxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLN  260
            CWKG +PF+S+ DVKK FK  A      ++  R  T+ E+ PE+YLII   G+VCLG+L+
Sbjct  315  CWKGSKPFKSMNDVKKLFKPLALRFSVKSSFLRKNTVMEMGPETYLIINKSGNVCLGILD  374

Query  259  GTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            G EAGL   N++GD+S+ ++++ YDN K+ IGW  ANCDR P
Sbjct  375  GAEAGLENLNILGDISLLNKVITYDNVKDQIGWATANCDRLP  416



>gb|KEH20924.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=410

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGG+ TGV ++ ++FD+GSSY+Y NSQ Y+A +  + KEL  KP++ A  D TLP 
Sbjct  270  AELVFGGRKTGVGSLNIIFDTGSSYTYFNSQAYQAMISLLNKELHRKPIKAAPDDQTLPM  329

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW G+RPFRSI +VKKYFK     F NG R +  FEI PE+YLII   G+VCLG+LNG E
Sbjct  330  CWHGKRPFRSINEVKKYFKPLTLSFTNGGRVKPQFEIPPEAYLIISNMGNVCLGILNGPE  389

Query  250  AGLHXXNVIG  221
             GL   N+IG
Sbjct  390  VGLGELNLIG  399



>gb|KDO80581.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=254

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 106/156 (68%), Gaps = 3/156 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A  D TLP 
Sbjct  93   AELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPI  152

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G  PF+++  V +YFK  A  F N  R+     + PE+YL+I  + +VCLG+LNG+E
Sbjct  153  CWRG--PFKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCLGILNGSE  209

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
            A +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  210  AEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  245



>ref|XP_006662787.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=422

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 7/159 (4%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   F  +S G+  M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   DP+LP 
Sbjct  263  ATLYFDRRSLGITPMEVVFDSGSTYTYFSAQPYQAIV-SAIKGGLSKSLKQV-TDPSLPL  320

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++ F+S+ DVKK FKS               EI PE+YL++   G+VCLG+L+G+ 
Sbjct  321  CWKGQKAFKSVFDVKKDFKSLQLIIGK----NAAMEIPPENYLVVTKNGNVCLGILDGSA  376

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            A L   N+IGD++MQD+MVIYDNE+  +GW R +C R P
Sbjct  377  AKLKF-NIIGDITMQDQMVIYDNERAQLGWIRGSCSRSP  414



>gb|EEC67807.1| hypothetical protein OsI_35373 [Oryza sativa Indica Group]
Length=418

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   F  +S   K M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   DP+LP 
Sbjct  259  ATLYFDRRSLSTKPMEVVFDSGSTYTYFSAQPYQATI-SAIKGSLSKSLKQVS-DPSLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++ F+S+ DVKK FKS        +    + EI PE+YLI+   G+VCLG+L+G+ 
Sbjct  317  CWKGQKAFKSVSDVKKDFKSLQFI----FGKNAVMEIPPENYLIVTKNGNVCLGILDGSA  372

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            A L   ++IGD++MQD+MVIYDNEK  +GW R +C R P
Sbjct  373  AKLSF-SIIGDITMQDQMVIYDNEKAQLGWIRGSCSRSP  410



>ref|XP_003605078.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=418

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 10/156 (6%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F GK T  K + ++FDSGSSY+Y + + Y      V  +L+GKPLR    DP+LP CWKG
Sbjct  271  FNGKPTPAKGLQIIFDSGSSYTYFSPRVYTIVANMVNNDLKGKPLRRETKDPSLPICWKG  330

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTL-FEISPESYLIIXXKGSVCLGVLNGTEAGL  242
             +PF+S+ +V  YFK     F    +S+ L F++ P  +      G+VCLG+LNG EAGL
Sbjct  331  VKPFKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVKF------GNVCLGILNGNEAGL  381

Query  241  HXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
               NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  382  GNRNVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  417



>ref|NP_001065913.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|AAY23257.1| nucellin-like aspartic protease [Oryza sativa Japonica Group]
 gb|ABA91814.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27758.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|EEE51770.1| hypothetical protein OsJ_33210 [Oryza sativa Japonica Group]
Length=418

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   F  +S   K M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   DP+LP 
Sbjct  259  ATLYFDRRSLSTKPMEVVFDSGSTYTYFSAQPYQATI-SAIKGSLSKSLKQVS-DPSLPL  316

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++ F+S+ DVKK FKS        +    + +I PE+YLII   G+VCLG+L+G+ 
Sbjct  317  CWKGQKAFKSVSDVKKDFKSLQFI----FGKNAVMDIPPENYLIITKNGNVCLGILDGSA  372

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            A L   ++IGD++MQD+MVIYDNEK  +GW R +C R P
Sbjct  373  AKLSF-SIIGDITMQDQMVIYDNEKAQLGWIRGSCSRSP  410



>ref|XP_006472803.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=429

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A  D TLP 
Sbjct  268  AELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPI  327

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G  PF+++  V +YFK  A  F N  R+    ++ PE+YL+I  + +VCLG+LNG+E
Sbjct  328  CWRG--PFKALGQVTEYFKPLALSFTN-RRNSVRLDVPPEAYLVISGRKNVCLGILNGSE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
            A +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  385  AEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  420



>ref|XP_006472802.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=431

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A  D TLP 
Sbjct  270  AELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPI  329

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G  PF+++  V +YFK  A  F N  R+    ++ PE+YL+I  + +VCLG+LNG+E
Sbjct  330  CWRG--PFKALGQVTEYFKPLALSFTNR-RNSVRLDVPPEAYLVISGRKNVCLGILNGSE  386

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
            A +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  387  AEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  422



>gb|KDO80580.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=378

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 106/156 (68%), Gaps = 3/156 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A  D TLP 
Sbjct  217  AELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPI  276

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G  PF+++  V +YFK  A  F N  R+     + PE+YL+I  + +VCLG+LNG+E
Sbjct  277  CWRG--PFKALGQVTEYFKPLALSFTNR-RNSVRLVVPPEAYLVISGRKNVCLGILNGSE  333

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
            A +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  334  AEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  369



>gb|KDO80579.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=429

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 106/156 (68%), Gaps = 3/156 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A  D TLP 
Sbjct  268  AELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPI  327

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CW+G  PF+++  V +YFK  A  F N  R+     + PE+YL+I  + +VCLG+LNG+E
Sbjct  328  CWRG--PFKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCLGILNGSE  384

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
            A +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  385  AEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  420



>ref|XP_003577760.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=413

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 103/153 (67%), Gaps = 7/153 (5%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L++   DP+LP CWKG
Sbjct  258  FDRRSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLQQVS-DPSLPLCWKG  315

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLH  239
            ++ F+S+ DVK  FKS        +   ++ EI PE+YLI+   G+ CLG+L+G+ A L 
Sbjct  316  QKVFKSVSDVKNDFKSLFLS----FVKNSVLEIPPENYLIVTKNGNACLGILDGSAAKL-  370

Query  238  XXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
              N+IGD++MQD+++IYDNE+  +GW R +C R
Sbjct  371  TFNIIGDITMQDQLIIYDNERGQLGWIRGSCSR  403



>gb|EEE51772.1| hypothetical protein OsJ_33215 [Oryza sativa Japonica Group]
Length=775

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 99/156 (63%), Gaps = 8/156 (5%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   F   S G+  M VVFDSGS+Y+Y  +QPY+A +Y++   L    L +   DP+LP 
Sbjct  143  ATLYFDRHSLGMNPMDVVFDSGSTYTYFTAQPYQATVYAIKGGLSSTSLEQV-SDPSLPL  201

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG++ F S+ DVKK FKS    F N      + EI PE+YLI+   G+VCLG+L+G  
Sbjct  202  CWKGQKAFESVFDVKKEFKSLQLNFGN----NAVMEIPPENYLIVTEYGNVCLGILHGCR  257

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  143
                  N+IGD++MQD+MVIYDNE+  +GW R +CD
Sbjct  258  LNF---NIIGDITMQDQMVIYDNEREQLGWIRGSCD  290


 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 6/157 (4%)
 Frame = -1

Query  589  KSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRG--KPLREAG-XDPTLPFCWKG  419
            K+     M V+FDSG++Y+Y  +QPY+A L  V   L    K L E    D  L  CWKG
Sbjct  610  KAISAAPMAVIFDSGATYTYFAAQPYQATLSVVKSTLNSECKFLTEVTEKDRALTVCWKG  669

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEA--G  245
            +    +I +VKK F+S +  FA+G +  TL EI PE YLII  +G VCLG+L+G++    
Sbjct  670  KDKIVTIDEVKKCFRSLSLEFADGDKKATL-EIPPEHYLIISQEGHVCLGILDGSKEHLS  728

Query  244  LHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            L   N+IG ++M D+MVIYD+E++ +GW    CDR P
Sbjct  729  LAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDRIP  765



>gb|EMS62785.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=412

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 102/153 (67%), Gaps = 7/153 (5%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L+E   D +LP CWKG
Sbjct  257  FDRRSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLKEV-SDVSLPLCWKG  314

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLH  239
            ++ F+S+ +VK  FKS        +   ++ EI PE+YLI+   G+VCLG+L+GT A   
Sbjct  315  QKVFKSVSEVKNDFKSLFLS----FGKNSVMEIPPENYLIVTKYGNVCLGILDGTAAK-Q  369

Query  238  XXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
              N+IGD++MQD+M+IYDNEK  +GW R +C R
Sbjct  370  TFNIIGDITMQDQMIIYDNEKGQLGWIRGSCSR  402



>gb|EMT29613.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=412

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 102/153 (67%), Gaps = 7/153 (5%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L+E   D +LP CWKG
Sbjct  257  FDRRSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLKEV-SDVSLPLCWKG  314

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLH  239
            ++ F+S+ +VK  FKS        +   ++ EI PE+YLI+   G+VCLG+L+GT A   
Sbjct  315  QKVFKSVSEVKNDFKSLFL----NFGKNSVMEIPPENYLIVTKYGNVCLGILDGTAAK-Q  369

Query  238  XXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
              N+IGD++MQD+M+IYDNEK  +GW R +C R
Sbjct  370  TFNIIGDITMQDQMIIYDNEKGQLGWIRGSCSR  402



>ref|XP_006856698.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
 gb|ERN18165.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
Length=406

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDP--TL  437
            A   FG      +   V+FDSG+S++Y  S  Y+A +  + K+L    L+E    P  TL
Sbjct  201  ANILFGRDVLSDRYFDVIFDSGTSFTYFTSLAYQALISRLRKDLAKTSLKELPIGPHSTL  260

Query  436  PFCWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNG  257
            P CW+G + F+S+ ++K YFK     F NG R+R  FEISPE +LII  +G+VCLG+LNG
Sbjct  261  PLCWRGTKAFKSLSEIKGYFKPLVMNFKNGKRAR--FEISPEGFLIITSQGNVCLGILNG  318

Query  256  TEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
            +E GL    +IGD+S+   +V+YDNE + IGW   NC+R P
Sbjct  319  SEVGLLDHILIGDISLHGYLVVYDNENHQIGWVPQNCNRLP  359



>ref|XP_004978884.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=419

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 11/156 (7%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---KPLREAGXDPTLPFC  428
            F  +S G+K M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   D  LP C
Sbjct  262  FDKRSLGLKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQVPGD-ELPLC  316

Query  427  WKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEA  248
            WKG++ F+S+ DVKK FKS    FA G     + EI PE+YLI+   G+VCLG+L+ T A
Sbjct  317  WKGQKAFKSVFDVKKEFKSLHLSFATG--KNAVMEIPPENYLIVTKIGNVCLGILDATVA  374

Query  247  GLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
             L   ++IGD++M D+MVIYDNEK  +GW R  C R
Sbjct  375  KL-SFSIIGDITMLDQMVIYDNEKAQLGWVRGPCSR  409



>gb|KHG06665.1| Asparticase Asp1 [Gossypium arboreum]
Length=383

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 91/159 (57%), Gaps = 42/159 (26%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  FGGK+TG+KN+ V+FDSGSSY+Y+NSQ Y+A    + KEL G+ L+EA  D TLP 
Sbjct  259  AELHFGGKATGIKNLIVIFDSGSSYTYLNSQAYQALTLLLKKELSGRSLKEAPEDQTLPL  318

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKGR+PFRS+ D KKYFK+                             S+ L   N   
Sbjct  319  CWKGRKPFRSVHDAKKYFKT-----------------------------SLALAFAN---  346

Query  250  AGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  134
                      ++SMQDRMV+YDNEK  IGW+ ANCD  P
Sbjct  347  ----------NISMQDRMVVYDNEKQVIGWSPANCDHLP  375



>gb|KHG10362.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10553.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10791.1| Asparticase Asp1 [Gossypium arboreum]
Length=490

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 102/187 (55%), Gaps = 31/187 (17%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V + L  K L +   D  LP 
Sbjct  263  AEVLFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLNLVRESLTEKTL-DTVQDKALPI  321

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXK------------  287
            CWKG +PF+S+ DVK YF +    F +    +   E+ PE+YLI+               
Sbjct  322  CWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTVSRSLVLQQNDING  379

Query  286  ----------------GSVCLGVLNGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTR  155
                            G+ C G+LNGTEAGL   NVIGD+S+  +MV+YDNE+  IGW  
Sbjct  380  HGYNNISNMLFRSQEDGNACFGILNGTEAGLGDLNVIGDISLIGKMVVYDNEEQRIGWIS  439

Query  154  ANCDRPP  134
            A+C+R P
Sbjct  440  ADCNRLP  446



>dbj|BAJ99780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 102/151 (68%), Gaps = 7/151 (5%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F  +S G+K M VVFDSGS+Y+Y  ++PY+A + S +K    K L+E   D +LP CWKG
Sbjct  275  FDRRSLGMKPMEVVFDSGSTYAYFAAEPYQATV-SALKAGLSKSLKEVS-DVSLPLCWKG  332

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLH  239
            ++ F+S+ +VK  FKS        +   ++ EI PE+YLI+   G+VCLG+L+GT A L 
Sbjct  333  QKVFKSVSEVKNDFKSLFL----SFGKNSVMEIPPENYLIVTKYGNVCLGILDGTTAKLK  388

Query  238  XXNVIGDVSMQDRMVIYDNEKNAIGWTRANC  146
              N+IGD++MQD+M+IYDNEK  +GW R +C
Sbjct  389  F-NIIGDITMQDQMIIYDNEKGQLGWIRGSC  418



>gb|EMT12274.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=430

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 103/154 (67%), Gaps = 14/154 (9%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEA-----FLYSVVKELRG---KPLREAGXDP  443
            F  +S GVK M VVFDSGS+Y+Y  +QPY+A     +L     +L+    K L++   DP
Sbjct  282  FDKRSLGVKPMEVVFDSGSTYTYFAAQPYQATVSAVYLNHTTFQLQAGLSKSLKQVS-DP  340

Query  442  TLPFCWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVL  263
            +LP CWKG++ F+S+ DVKK F S        +   T+ EI+PE+YLI+   G+VCLG+L
Sbjct  341  SLPLCWKGQKVFKSVSDVKKDFMSLFL----SFAKNTVMEIAPENYLIVTKNGNVCLGIL  396

Query  262  NGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGW  161
            +G+ A L+  N+IGD++MQD++V+YDNEK  IGW
Sbjct  397  DGSAAKLNF-NIIGDITMQDQLVVYDNEKGRIGW  429



>ref|XP_002511959.1| protein with unknown function [Ricinus communis]
 gb|EEF50628.1| protein with unknown function [Ricinus communis]
Length=583

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 102/156 (65%), Gaps = 4/156 (3%)
 Frame = -1

Query  601  TFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWK  422
            + GG+   V+   +VFDSGSSY+Y   + Y   + S+ K++ G+ L +   DPTLPFCW+
Sbjct  420  SLGGQERRVRR--IVFDSGSSYTYFTKEAYSELVASL-KQVSGEALIQDTSDPTLPFCWR  476

Query  421  GRRPFRSIXDVKKYFKSfaxxfANGW-RSRTLFEISPESYLIIXXKGSVCLGVLNGTEAG  245
             + P RS+ DVK+YFK+    F + W    T F I PE YLII  KG+VCLG+L+G++  
Sbjct  477  AKFPIRSVIDVKQYFKTLTLQFGSKWWIISTKFRIPPEGYLIISNKGNVCLGILDGSDVH  536

Query  244  LHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  137
                 ++GD+S++ +++IYDN  N IGWT+++C +P
Sbjct  537  DGSSIILGDISLRGQLIIYDNVNNKIGWTQSDCIKP  572



>ref|XP_001783556.1| predicted protein [Physcomitrella patens]
 gb|EDQ51645.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 3/144 (2%)
 Frame = -1

Query  559  VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRPFRSIXDVKKY  380
            +FDSG+S++Y+    Y A L +VV++ +   L     D TLPFCW+G  PF S+ DV  Y
Sbjct  255  MFDSGTSFTYLVPNAYTAVLSAVVRQAQRSGLERIKTDTTLPFCWRGPSPFESVADVSAY  314

Query  379  FKSfaxxfANG--WRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXXNVIGDVSMQ  206
            FK+    F     W S  L E+SPE YLI+  +G+VCLGVL+ + A L   N++GD+SM+
Sbjct  315  FKTVTLDFGGSTWWSSGKLLELSPEGYLIVSTQGNVCLGVLDASVASLEVTNILGDISMR  374

Query  205  DRMVIYDNEKNAIGWTRANC-DRP  137
              +V+YDN +  IGW R NC +RP
Sbjct  375  GYLVVYDNMREQIGWVRRNCYNRP  398



>ref|XP_001766321.1| predicted protein [Physcomitrella patens]
 gb|EDQ68953.1| predicted protein, partial [Physcomitrella patens]
Length=381

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 2/145 (1%)
 Frame = -1

Query  562  VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRPFRSIXDVKK  383
            V+FDSG+S++Y+  + Y A L ++  ++    L     D TLPFCW+G  PF S+ DV++
Sbjct  237  VMFDSGTSFTYLVPEAYNAVLSAMEMQVEKSGLVRIKTDNTLPFCWRGPSPFESVADVQR  296

Query  382  YFKSfaxx--fANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXXNVIGDVSM  209
            YFK+        N + +  + E+SPE YLI+  +G+VCLG+L+ + A L   N+IGDVSM
Sbjct  297  YFKTVTLDFGKRNWYSASRVLELSPEGYLIVSTQGNVCLGILDASGASLEVTNIIGDVSM  356

Query  208  QDRMVIYDNEKNAIGWTRANCDRPP  134
            +  +V+YDN +N IGW R NC   P
Sbjct  357  RGYLVVYDNARNQIGWVRRNCHNRP  381



>ref|XP_008807681.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=420

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 93/154 (60%), Gaps = 4/154 (3%)
 Frame = -1

Query  598  FGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKG  419
            F G      N+ V+ DSG++Y+Y   QPY  F+ ++   +  +PL  A  D  LP+CW+G
Sbjct  260  FWGNQPLGSNLMVLLDSGTTYTYFGLQPYNNFISTLNGHVSKQPLTRAYDDHWLPYCWRG  319

Query  418  RRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLH  239
             RPF SI D + YFK     FA+G  S    +I P +YLII    + CLG+LNGTE GL 
Sbjct  320  PRPFSSIADAQGYFKQLELRFADGAAS---MKIPPANYLIISEHHNACLGILNGTEEGLQ  376

Query  238  XX-NVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  140
               N+IGD+SM D +VIYDN+K  IGW  A+C R
Sbjct  377  SNINLIGDISMLDLLVIYDNDKQRIGWASADCSR  410



>gb|ABR18371.1| unknown [Picea sitchensis]
Length=446

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 7/160 (4%)
 Frame = -1

Query  610  AEXTFGGK-----STGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXD  446
            A+  FG K       G K   ++FDSGS+Y+Y  +Q Y AFL  V + L GK L +   D
Sbjct  283  AQMNFGNKPLDKDGDGKKLGGIIFDSGSTYTYFTNQAYGAFLSVVKENLSGKQLEQDSSD  342

Query  445  PTLPFCWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGV  266
              L  CW+ +  FRS+ +   YFK     F +    +   EI PE YL++  KG+VCLG+
Sbjct  343  SFLSLCWRRKEGFRSVAEAAAYFKPLTLKFRSTKTKQ--MEIFPEGYLVVNKKGNVCLGI  400

Query  265  LNGTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANC  146
            LNGT  G+   NV+GD+S Q ++V+YDNEKN IGW R++C
Sbjct  401  LNGTAIGIVDTNVLGDISFQGQLVVYDNEKNQIGWARSDC  440



>gb|EMT05967.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=306

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = -1

Query  559  VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRPFRSIXDVKKY  380
            VFDSGS+YSY++   YE  + +V   L+   L++   DP L  CW+  +P +S+ DVK  
Sbjct  156  VFDSGSAYSYVHKDTYELLIQAVDVTLQDSTLQKVPDDPELTQCWRYNQPIQSVDDVKHE  215

Query  379  FKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXXNVIGDVSMQDR  200
            F+     F +G  S+   +I PE+Y+++  +G+VCLG+ NG+E G+   N+IGD++MQ+ 
Sbjct  216  FEPLELTFTHG-ASQVTLDIPPENYIVVTERGNVCLGIHNGSEHGMGELNIIGDITMQNH  274

Query  199  MVIYDNEKNAIGWTRANCDRPPA  131
            +V+YDNE+  IGW RA+CD  P 
Sbjct  275  LVVYDNERARIGWVRASCDIMPG  297



>ref|XP_001782061.1| predicted protein [Physcomitrella patens]
 gb|EDQ53125.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 96/153 (63%), Gaps = 6/153 (4%)
 Frame = -1

Query  562  VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRPFRSIXDVKK  383
            V+FDSG+S++Y+  Q Y + L +V K+     L     D TLP+CW+G  PF+SI DV +
Sbjct  266  VMFDSGTSFTYLVPQAYASVLSAVTKQ---SGLLRVKSDTTLPYCWRGPSPFQSITDVHQ  322

Query  382  YFKSfaxx--fANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXXNVIGDVSM  209
            YFK+        N + + +  ++SP+ YLI+  +G+VCLG+L+ + A L   N+IGDVSM
Sbjct  323  YFKTLTLDFGGRNWFATDSTLDLSPQGYLIVSTQGNVCLGILDASGASLEVTNIIGDVSM  382

Query  208  QDRMVIYDNEKNAIGWTRANC-DRPPAPNVVFI  113
            +  +V+YDN ++ IGW R NC  RP   +  F+
Sbjct  383  RGYLVVYDNVRDRIGWIRRNCHSRPTKTSSQFV  415



>gb|EMS52520.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=431

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 99/167 (59%), Gaps = 10/167 (6%)
 Frame = -1

Query  598  FGGKSTGVKNMX-----VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLP  434
            +GG+   V+        V+FDSGSSY+Y   + Y + + S+  E           D TLP
Sbjct  255  YGGQELNVREQAGKLTQVIFDSGSSYTYFPHEIYTSLIASL--EAVSPGFVHDKSDQTLP  312

Query  433  FCWKGRRPFRSIXDVKKYFKSfaxxfANGWR--SRTLFEISPESYLIIXXKGSVCLGVLN  260
            FC K   P RS+ DVK+ FK     F+  W    RT F ISPE+YLII  KG+VCLGVL+
Sbjct  313  FCMKPNFPVRSVDDVKQLFKPLLLHFSKAWLVIPRT-FAISPENYLIISDKGNVCLGVLD  371

Query  259  GTEAGLHXXNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  119
            GTE G     VIGDVS++ ++V YDN++N IGW +++C RP   ++V
Sbjct  372  GTEIGHSSTIVIGDVSLRGKLVAYDNDENQIGWAQSDCSRPQKASMV  418



>ref|XP_006485774.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=577

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -1

Query  580  GVKNMXV---VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRP  410
            G +N  V   +FD+GSSY+Y   Q Y   + S+ KE+    L     DPTLP CW+ + P
Sbjct  416  GARNSRVGWALFDTGSSYTYFTKQAYSELIASL-KEVSSNGLVLDASDPTLPVCWRAKFP  474

Query  409  FRSIXDVKKYFKSfaxxfANGWR-SRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXX  233
             RSI DVK+YFK+    F + W+   T F ISPE YL+I  KG++CLG+L+G+E      
Sbjct  475  IRSIVDVKQYFKTLTLHFGSKWQIVSTKFHISPEGYLVISKKGNICLGILDGSEVHNGST  534

Query  232  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  137
             ++GD+S++ ++V+YDN    IGW +++C  P
Sbjct  535  IILGDISLRGQLVVYDNVNKRIGWAKSHCMNP  566



>gb|KDO41977.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=577

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -1

Query  580  GVKNMXV---VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRP  410
            G +N  V   +FD+GSSY+Y   Q Y   + S+ KE+    L     DPTLP CW+ + P
Sbjct  416  GARNSQVGWALFDTGSSYTYFTKQAYSELIASL-KEVSSDGLVLDASDPTLPVCWRAKFP  474

Query  409  FRSIXDVKKYFKSfaxxfANGWR-SRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXX  233
             RSI DVK++FK+    F + W+   T F ISPE YL+I  KG++CLG+L+G+E      
Sbjct  475  IRSIVDVKQFFKTLTLHFGSKWQIVSTKFHISPEGYLVISKKGNICLGILDGSEVHNGST  534

Query  232  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  137
             ++GD+S++ ++V+YDN    IGW +++C  P
Sbjct  535  IILGDISLRGQLVVYDNVNKRIGWAKSHCMNP  566



>ref|XP_006440945.1| hypothetical protein CICLE_v10019473mg [Citrus clementina]
 gb|ESR54185.1| hypothetical protein CICLE_v10019473mg [Citrus clementina]
Length=577

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -1

Query  580  GVKNMXV---VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPFCWKGRRP  410
            G +N  V   +FD+GSSY+Y   Q Y   + S+ KE+    L     DPTLP CW+ + P
Sbjct  416  GARNSQVGWALFDTGSSYTYFTKQAYSELIASL-KEVSSDGLVLDASDPTLPVCWRAKFP  474

Query  409  FRSIXDVKKYFKSfaxxfANGWR-SRTLFEISPESYLIIXXKGSVCLGVLNGTEAGLHXX  233
             RSI DVK++FK+    F + W+   T F ISPE YL+I  KG++CLG+L+G+E      
Sbjct  475  IRSIVDVKQFFKTLTLHFGSKWQIVSTKFRISPEGYLVISKKGNICLGILDGSEVHNGST  534

Query  232  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  137
             ++GD+S++ ++V+YDN    IGW +++C  P
Sbjct  535  IILGDISLRGQLVVYDNVNKRIGWAKSHCMNP  566



>ref|XP_010912540.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=413

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 100/158 (63%), Gaps = 9/158 (6%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            A   +G +S G  +  V+ DSG+ ++Y   QPY  F+ ++  ++  +PL+    D  LP+
Sbjct  253  ASLLWGTRSLG-SSRSVLLDSGTPFTYFALQPYNNFISALTNKVSKQPLKRV-KDSKLPY  310

Query  430  CWKGRRPFRSIXDVKKYFK-SfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGT  254
            CW G +PF+S+ DVK+Y + S    F NG  S T   I PE+YLII  KG+ CLG+ NG+
Sbjct  311  CWTGPKPFKSMSDVKQYLETSLELRFDNGGASMT---IPPENYLIISNKGNACLGIFNGS  367

Query  253  EAGLHXXNV-IGDVSMQDRMVIYDNEKNAIGWTRANCD  143
            EAGL+   + IGD+SM DR+VIYDN+K  IGW   +CD
Sbjct  368  EAGLNRDVILIGDISMLDRLVIYDNDKRRIGW--GSCD  403



>ref|XP_007161478.1| hypothetical protein PHAVU_001G072500g [Phaseolus vulgaris]
 gb|ESW33472.1| hypothetical protein PHAVU_001G072500g [Phaseolus vulgaris]
Length=433

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = -1

Query  610  AEXTFGGKSTGVKNMXVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGXDPTLPF  431
            AE  F GK+T VK + ++FDSGSSY+Y NS  Y+A +  V  +L+GK L  A  D +LP 
Sbjct  263  AELLFNGKTTKVKGLELIFDSGSSYTYFNSLAYQAVVNLVTDDLKGKQLTRATEDSSLPI  322

Query  430  CWKGRRPFRSIXDVKKYFKSfaxxfANGWRSRTLFEISPESYLIIXXKGSVCLGVLNGTE  251
            CWKG + F+S+ D+KKYFK  A  F          ++ PE+YLII   G+VCLG+L+GTE
Sbjct  323  CWKGPKSFKSLSDIKKYFKPLAFSFTK--TKNVQMQLPPEAYLIITKHGNVCLGILDGTE  380

Query  250  AGLHXXNVIG  221
             GL   N+IG
Sbjct  381  VGLESLNIIG  390



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230