BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035K11

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006422413.1|  hypothetical protein CICLE_v10028440mg             284   1e-89   Citrus clementina [clementine]
ref|XP_006486585.1|  PREDICTED: aminoacylase-1-like isoform X1          281   2e-88   Citrus sinensis [apfelsine]
ref|XP_002283140.2|  PREDICTED: aminoacylase-1 isoform X1               280   8e-88   Vitis vinifera
emb|CDP14501.1|  unnamed protein product                                275   5e-86   Coffea canephora [robusta coffee]
ref|XP_008235828.1|  PREDICTED: aminoacylase-1 isoform X1               274   7e-86   Prunus mume [ume]
ref|XP_009340791.1|  PREDICTED: aminoacylase-1-like isoform X1          272   3e-85   Pyrus x bretschneideri [bai li]
ref|XP_003589773.1|  Aminoacylase-1                                     265   4e-85   
ref|XP_006422412.1|  hypothetical protein CICLE_v10028440mg             272   4e-85   Citrus clementina [clementine]
ref|XP_009620561.1|  PREDICTED: aminoacylase-1                          271   7e-85   Nicotiana tomentosiformis
ref|XP_011040830.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     271   1e-84   Populus euphratica
ref|XP_006384867.1|  aminoacylase family protein                        270   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_009796337.1|  PREDICTED: aminoacylase-1                          270   3e-84   Nicotiana sylvestris
ref|XP_011092916.1|  PREDICTED: aminoacylase-1 isoform X1               270   4e-84   
emb|CBI37723.3|  unnamed protein product                                268   5e-84   Vitis vinifera
ref|XP_004290084.1|  PREDICTED: aminoacylase-1 isoform X1               269   5e-84   Fragaria vesca subsp. vesca
ref|XP_006486586.1|  PREDICTED: aminoacylase-1-like isoform X2          269   6e-84   Citrus sinensis [apfelsine]
ref|XP_006364339.1|  PREDICTED: aminoacylase-1-like                     269   6e-84   Solanum tuberosum [potatoes]
gb|EYU40489.1|  hypothetical protein MIMGU_mgv1a005945mg                268   2e-83   Erythranthe guttata [common monkey flower]
ref|XP_004231104.1|  PREDICTED: aminoacylase-1                          268   2e-83   
dbj|BAO98754.1|  putative aminoacylase                                  268   3e-83   Nicotiana benthamiana
ref|XP_010645690.1|  PREDICTED: aminoacylase-1 isoform X2               268   3e-83   Vitis vinifera
gb|ACU20502.1|  unknown                                                 259   3e-83   Glycine max [soybeans]
dbj|BAQ00430.1|  putative aminoacylase                                  267   5e-83   Nicotiana tabacum [American tobacco]
ref|XP_009358896.1|  PREDICTED: aminoacylase-1-like isoform X1          266   6e-83   Pyrus x bretschneideri [bai li]
gb|EYU41243.1|  hypothetical protein MIMGU_mgv1a008993mg                263   9e-83   Erythranthe guttata [common monkey flower]
gb|ABK94846.1|  unknown                                                 266   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_008235829.1|  PREDICTED: aminoacylase-1 isoform X2               265   1e-82   Prunus mume [ume]
ref|XP_011000859.1|  PREDICTED: aminoacylase-1-like                     266   2e-82   Populus euphratica
ref|XP_007201041.1|  hypothetical protein PRUPE_ppa005858mg             264   5e-82   Prunus persica
ref|XP_009340792.1|  PREDICTED: aminoacylase-1-like isoform X2          264   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_010093337.1|  hypothetical protein L484_002939                   264   9e-82   
gb|KEH40951.1|  N-acyl-L-amino-acid amidohydrolase                      263   1e-81   Medicago truncatula
ref|XP_003589759.1|  Aminoacylase-1                                     263   1e-81   
ref|XP_002312793.2|  aminoacylase family protein                        263   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_004498100.1|  PREDICTED: aminoacylase-1-like isoform X1          262   4e-81   Cicer arietinum [garbanzo]
ref|XP_008347555.1|  PREDICTED: aminoacylase-1-like                     261   5e-81   
ref|XP_003556753.1|  PREDICTED: aminoacylase-1 isoform X1               261   6e-81   Glycine max [soybeans]
ref|XP_011092917.1|  PREDICTED: aminoacylase-1 isoform X2               261   7e-81   Sesamum indicum [beniseed]
ref|XP_003589774.1|  Aminoacylase-1                                     253   1e-80   
ref|XP_009358898.1|  PREDICTED: aminoacylase-1-like isoform X2          259   4e-80   Pyrus x bretschneideri [bai li]
ref|XP_002514407.1|  Aminoacylase-1, putative                           259   8e-80   Ricinus communis
ref|XP_011458107.1|  PREDICTED: aminoacylase-1 isoform X2               258   1e-79   Fragaria vesca subsp. vesca
gb|KDP47023.1|  hypothetical protein JCGZ_10750                         256   7e-79   Jatropha curcas
ref|XP_008382744.1|  PREDICTED: aminoacylase-1-like                     256   3e-78   
gb|AES60010.2|  N-acyl-L-amino-acid amidohydrolase                      251   4e-77   Medicago truncatula
gb|AFK34969.1|  unknown                                                 251   9e-77   Medicago truncatula
ref|XP_004498101.1|  PREDICTED: aminoacylase-1-like isoform X2          250   1e-76   Cicer arietinum [garbanzo]
ref|XP_006605409.1|  PREDICTED: aminoacylase-1 isoform X2               250   2e-76   Glycine max [soybeans]
ref|XP_008787043.1|  PREDICTED: aminoacylase-1 isoform X1               250   2e-76   Phoenix dactylifera
ref|XP_010932091.1|  PREDICTED: aminoacylase-1                          250   3e-76   Elaeis guineensis
ref|XP_007043100.1|  Peptidase M20/M25/M40 family protein isoform 1     247   2e-75   
ref|XP_008448158.1|  PREDICTED: aminoacylase-1                          247   2e-75   Cucumis melo [Oriental melon]
ref|XP_010090715.1|  hypothetical protein L484_013737                   244   6e-75   
ref|NP_001148589.1|  aminoacylase-1 precursor                           245   1e-74   Zea mays [maize]
ref|XP_007153022.1|  hypothetical protein PHAVU_003G001200g             244   2e-74   Phaseolus vulgaris [French bean]
ref|XP_003589763.1|  Aminoacylase-1                                     244   4e-74   Medicago truncatula
ref|XP_010690578.1|  PREDICTED: aminoacylase-1-like isoform X1          243   8e-74   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA47999.1|  TPA: aminoacylase-1                                    242   2e-73   
ref|XP_010270552.1|  PREDICTED: aminoacylase-1                          242   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006659580.1|  PREDICTED: aminoacylase-1-like                     241   5e-73   Oryza brachyantha
ref|XP_009390654.1|  PREDICTED: aminoacylase-1                          241   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17235.1|  Aminoacylase-1                                          240   1e-72   Gossypium arboreum [tree cotton]
ref|XP_010028870.1|  PREDICTED: aminoacylase-1                          239   2e-72   Eucalyptus grandis [rose gum]
ref|XP_004139978.1|  PREDICTED: aminoacylase-1-like                     239   4e-72   Cucumis sativus [cucumbers]
gb|KJB79746.1|  hypothetical protein B456_013G064900                    238   5e-72   Gossypium raimondii
ref|XP_010555164.1|  PREDICTED: aminoacylase-1 isoform X1               238   2e-71   Tarenaya hassleriana [spider flower]
gb|EMT30146.1|  Aminoacylase-1                                          233   2e-71   
gb|EAZ43309.1|  hypothetical protein OsJ_27905                          234   2e-71   Oryza sativa Japonica Group [Japonica rice]
gb|KJB31968.1|  hypothetical protein B456_005G216200                    236   5e-71   Gossypium raimondii
dbj|BAK06600.1|  predicted protein                                      236   5e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004973884.1|  PREDICTED: aminoacylase-1-like                     235   1e-70   Setaria italica
ref|XP_002444759.1|  hypothetical protein SORBIDRAFT_07g027550          234   2e-70   Sorghum bicolor [broomcorn]
ref|XP_010690574.1|  PREDICTED: aminoacylase-1-like                     234   2e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690579.1|  PREDICTED: aminoacylase-1-like isoform X2          234   3e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC83866.1|  hypothetical protein OsI_29850                          234   3e-70   Oryza sativa Indica Group [Indian rice]
dbj|BAD10058.1|  putative aminoacylase                                  234   4e-70   Oryza sativa Japonica Group [Japonica rice]
gb|EPS64004.1|  hypothetical protein M569_10775                         233   4e-70   Genlisea aurea
gb|KHG16687.1|  Aminoacylase-1                                          232   2e-69   Gossypium arboreum [tree cotton]
gb|KHG04612.1|  Aminoacylase-1                                          230   7e-69   Gossypium arboreum [tree cotton]
gb|EMS60311.1|  Aminoacylase-1                                          234   7e-69   Triticum urartu
ref|XP_003572375.1|  PREDICTED: aminoacylase-1                          229   1e-68   Brachypodium distachyon [annual false brome]
gb|KJB77468.1|  hypothetical protein B456_012G138500                    228   5e-68   Gossypium raimondii
ref|XP_010555165.1|  PREDICTED: aminoacylase-1 isoform X2               226   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_006411610.1|  hypothetical protein EUTSA_v10025205mg             224   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010690575.1|  PREDICTED: aminoacylase-1-like isoform X1          223   3e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006830441.1|  hypothetical protein AMTR_s00351p00009890          223   5e-66   
ref|XP_010431747.1|  PREDICTED: aminoacylase-1-like isoform X1          221   2e-65   Camelina sativa [gold-of-pleasure]
ref|NP_849516.1|  peptidase M20/M25/M40 family protein                  221   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KJB77466.1|  hypothetical protein B456_012G138500                    220   6e-65   Gossypium raimondii
ref|XP_010436913.1|  PREDICTED: aminoacylase-1-like isoform X1          219   8e-65   Camelina sativa [gold-of-pleasure]
gb|KEH15979.1|  M20/M25/M40 family peptidase                            211   1e-64   Medicago truncatula
ref|XP_010690577.1|  PREDICTED: aminoacylase-1-like                     218   6e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006411609.1|  hypothetical protein EUTSA_v10025205mg             212   4e-62   Eutrema salsugineum [saltwater cress]
dbj|BAH57228.1|  AT4G38220                                              209   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436185.1|  PREDICTED: uncharacterized protein LOC104719897    209   8e-62   
ref|XP_009125879.1|  PREDICTED: aminoacylase-1B-like isoform X1         211   2e-61   Brassica rapa
ref|XP_010431748.1|  PREDICTED: aminoacylase-1-like isoform X2          209   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010431749.1|  PREDICTED: aminoacylase-1-like                     209   4e-61   
ref|NP_568036.2|  peptidase M20/M25/M40 family protein                  209   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284995.1|  hypothetical protein CARUB_v10006302mg             209   6e-61   Capsella rubella
ref|XP_010446323.1|  PREDICTED: aminoacylase-1-like                     209   8e-61   
emb|CDY59101.1|  BnaCnng34250D                                          208   2e-60   Brassica napus [oilseed rape]
ref|XP_009132387.1|  PREDICTED: aminoacylase-1B-like isoform X2         208   2e-60   Brassica rapa
gb|KFK30432.1|  hypothetical protein AALP_AA7G260300                    208   2e-60   Arabis alpina [alpine rockcress]
ref|XP_010436914.1|  PREDICTED: aminoacylase-1-like isoform X2          208   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009101955.1|  PREDICTED: aminoacylase-1B                         207   5e-60   Brassica rapa
emb|CDY54793.1|  BnaA06g40880D                                          206   8e-60   Brassica napus [oilseed rape]
gb|KFK30433.1|  hypothetical protein AALP_AA7G260300                    205   2e-59   Arabis alpina [alpine rockcress]
ref|XP_002965773.1|  hypothetical protein SELMODRAFT_406809             205   3e-59   Selaginella moellendorffii
ref|XP_001760477.1|  predicted protein                                  204   8e-59   
ref|XP_002984445.1|  hypothetical protein SELMODRAFT_120255             203   1e-58   Selaginella moellendorffii
emb|CDY71051.1|  BnaCnng71090D                                          203   1e-58   Brassica napus [oilseed rape]
gb|ADE76225.1|  unknown                                                 203   2e-58   Picea sitchensis
emb|CDY65765.1|  BnaA03g56420D                                          198   2e-57   Brassica napus [oilseed rape]
emb|CBI19042.3|  unnamed protein product                                191   7e-57   Vitis vinifera
emb|CDX79602.1|  BnaC03g19380D                                          197   8e-57   
ref|XP_006410701.1|  hypothetical protein EUTSA_v10016717mg             198   8e-57   
ref|XP_007043101.1|  Peptidase M20/M25/M40 family protein isoform 2     197   1e-56   
ref|XP_010505049.1|  PREDICTED: aminoacylase-1-like isoform X1          195   1e-55   Camelina sativa [gold-of-pleasure]
emb|CDP15803.1|  unnamed protein product                                195   1e-55   Coffea canephora [robusta coffee]
gb|KDO80708.1|  hypothetical protein CISIN_1g013641mg                   194   5e-55   Citrus sinensis [apfelsine]
ref|XP_006472753.1|  PREDICTED: aminoacylase-1-like                     194   7e-55   Citrus sinensis [apfelsine]
ref|XP_010063988.1|  PREDICTED: aminoacylase-1 isoform X2               193   1e-54   Eucalyptus grandis [rose gum]
ref|XP_011027701.1|  PREDICTED: aminoacylase-1-like                     187   2e-54   Populus euphratica
ref|XP_010509616.1|  PREDICTED: aminoacylase-1-like                     191   4e-54   Camelina sativa [gold-of-pleasure]
gb|EMS66870.1|  Aminoacylase-1                                          184   5e-54   Triticum urartu
ref|XP_010505050.1|  PREDICTED: aminoacylase-1-like isoform X2          190   7e-54   
ref|XP_006393708.1|  hypothetical protein EUTSA_v10012140mg             184   1e-53   
ref|XP_002285843.1|  PREDICTED: aminoacylase-1                          190   2e-53   Vitis vinifera
ref|XP_006386375.1|  hypothetical protein POPTR_0002s08590g             189   2e-53   Populus trichocarpa [western balsam poplar]
gb|EYU23899.1|  hypothetical protein MIMGU_mgv1a005984mg                190   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_009123186.1|  PREDICTED: aminoacylase-1-like                     189   2e-53   Brassica rapa
ref|XP_004138118.1|  PREDICTED: aminoacylase-1-like                     189   5e-53   
ref|XP_004166496.1|  PREDICTED: aminoacylase-1-like                     189   6e-53   
emb|CAB37562.1|  putative protein                                       192   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219759.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     187   8e-53   
ref|XP_007019015.1|  Peptidase M20/M25/M40 family protein isoform 1     187   9e-53   
gb|EPS66024.1|  hypothetical protein M569_08749                         188   1e-52   Genlisea aurea
ref|XP_011027564.1|  PREDICTED: aminoacylase-1-like                     179   1e-52   Populus euphratica
ref|NP_001062216.2|  Os08g0511900                                       178   1e-52   
ref|XP_002866787.1|  hypothetical protein ARALYDRAFT_327784             191   2e-52   
ref|XP_007222264.1|  hypothetical protein PRUPE_ppa005883mg             186   3e-52   Prunus persica
ref|XP_002436680.1|  hypothetical protein SORBIDRAFT_10g006970          186   3e-52   Sorghum bicolor [broomcorn]
ref|XP_010694046.1|  PREDICTED: aminoacylase-1-like                     186   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004292687.1|  PREDICTED: aminoacylase-1                          186   6e-52   Fragaria vesca subsp. vesca
ref|XP_006295657.1|  hypothetical protein CARUB_v10024772mg             185   7e-52   
ref|XP_006393703.1|  hypothetical protein EUTSA_v10011489mg             185   8e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002300996.2|  aminoacylase family protein                        185   8e-52   
gb|KJB16266.1|  hypothetical protein B456_002G221000                    185   1e-51   Gossypium raimondii
ref|XP_002879550.1|  hypothetical protein ARALYDRAFT_345276             184   1e-51   
ref|XP_006307424.1|  hypothetical protein CARUB_v10009048mg             185   1e-51   
ref|XP_006845931.1|  hypothetical protein AMTR_s00157p00064680          186   2e-51   
ref|XP_010500161.1|  PREDICTED: aminoacylase-1-like                     184   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010272799.1|  PREDICTED: aminoacylase-1                          184   3e-51   Nelumbo nucifera [Indian lotus]
gb|KHN33869.1|  Aminoacylase-1B                                         181   3e-51   Glycine soja [wild soybean]
ref|XP_006307525.1|  hypothetical protein CARUB_v10009148mg             184   4e-51   
ref|XP_010461453.1|  PREDICTED: aminoacylase-1-like                     183   4e-51   Camelina sativa [gold-of-pleasure]
gb|EMT02607.1|  Aminoacylase-1A                                         184   4e-51   
ref|NP_175082.1|  peptidase M20/M25/M40 family protein                  183   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004964909.1|  PREDICTED: aminoacylase-1-like                     183   7e-51   Setaria italica
ref|XP_010544624.1|  PREDICTED: aminoacylase-1                          182   8e-51   Tarenaya hassleriana [spider flower]
dbj|BAK07394.1|  predicted protein                                      182   9e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009406638.1|  PREDICTED: aminoacylase-1-like                     182   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893983.1|  hypothetical protein ARALYDRAFT_473806             182   1e-50   
dbj|BAE99837.1|  aminoacylase like protein                              181   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344110.1|  PREDICTED: aminoacylase-1-like                     181   2e-50   
ref|NP_175103.2|  peptidase M20/M25/M40 family protein                  181   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32782.1|  hypothetical protein JCGZ_12074                         181   2e-50   Jatropha curcas
ref|XP_010943121.1|  PREDICTED: aminoacylase-1                          181   4e-50   
ref|XP_011074859.1|  PREDICTED: aminoacylase-1                          181   4e-50   
emb|CDY65424.1|  BnaC06g40730D                                          181   4e-50   Brassica napus [oilseed rape]
ref|XP_003543794.1|  PREDICTED: aminoacylase-1-like                     181   4e-50   Glycine max [soybeans]
ref|XP_010479044.1|  PREDICTED: aminoacylase-1                          181   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010500137.1|  PREDICTED: aminoacylase-1-like                     180   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002891296.1|  hypothetical protein ARALYDRAFT_473822             180   8e-50   
ref|XP_003564110.1|  PREDICTED: aminoacylase-1-like                     179   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_006845921.1|  hypothetical protein AMTR_s00157p00058420          172   2e-49   
gb|EEC80215.1|  hypothetical protein OsI_22115                          178   3e-49   Oryza sativa Indica Group [Indian rice]
ref|NP_001057113.1|  Os06g0210200                                       178   5e-49   
ref|XP_002513788.1|  Aminoacylase-1, putative                           177   8e-49   
gb|KFK42003.1|  hypothetical protein AALP_AA2G199700                    177   1e-48   Arabis alpina [alpine rockcress]
ref|NP_001150325.1|  aminoacylase-1 precursor                           177   1e-48   
gb|KFK35784.1|  hypothetical protein AALP_AA4G036200                    176   2e-48   Arabis alpina [alpine rockcress]
ref|XP_008777203.1|  PREDICTED: aminoacylase-1-like                     176   2e-48   Phoenix dactylifera
gb|ACN33832.1|  unknown                                                 176   3e-48   Zea mays [maize]
ref|XP_009774989.1|  PREDICTED: aminoacylase-1                          176   3e-48   Nicotiana sylvestris
ref|XP_006655902.1|  PREDICTED: aminoacylase-1-like                     175   5e-48   
ref|XP_004250324.1|  PREDICTED: aminoacylase-1                          174   1e-47   Solanum lycopersicum
dbj|BAH56753.1|  AT4G38220                                              173   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006351890.1|  PREDICTED: aminoacylase-1-like isoform X1          174   1e-47   Solanum tuberosum [potatoes]
ref|XP_010063989.1|  PREDICTED: aminoacylase-1 isoform X3               173   2e-47   Eucalyptus grandis [rose gum]
gb|KJB79748.1|  hypothetical protein B456_013G064900                    172   6e-47   Gossypium raimondii
ref|XP_010063986.1|  PREDICTED: aminoacylase-1 isoform X1               171   2e-46   Eucalyptus grandis [rose gum]
ref|XP_003614736.1|  Aminoacylase-1                                     166   2e-45   
ref|XP_010091376.1|  hypothetical protein L484_020178                   160   2e-42   
ref|XP_010690576.1|  PREDICTED: aminoacylase-1-like isoform X2          153   4e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001752334.1|  predicted protein                                  149   2e-38   
ref|XP_002879551.1|  hypothetical protein ARALYDRAFT_902649             142   1e-35   
ref|NP_001086906.1|  aminoacylase 1, gene 1                             134   5e-33   Xenopus laevis [clawed frog]
ref|XP_006783382.1|  PREDICTED: aminoacylase-1A-like                    134   6e-33   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004068561.1|  PREDICTED: aminoacylase-1                          133   1e-32   Oryzias latipes [Japanese rice fish]
gb|KJE95881.1|  aminoacylase-1A, variant                                130   4e-32   Capsaspora owczarzaki ATCC 30864
ref|XP_003217685.1|  PREDICTED: aminoacylase-1                          130   1e-31   
ref|XP_004345032.2|  aminoacylase-1A                                    130   2e-31   Capsaspora owczarzaki ATCC 30864
ref|XP_004548571.1|  PREDICTED: aminoacylase-1A-like                    130   2e-31   Maylandia zebra
ref|XP_003454610.1|  PREDICTED: aminoacylase-1A-like                    130   2e-31   Oreochromis niloticus
ref|XP_008654127.1|  PREDICTED: uncharacterized protein LOC103634365    126   2e-31   Zea mays [maize]
ref|NP_001083594.1|  aminoacylase 1, gene 2                             129   4e-31   Xenopus laevis [clawed frog]
ref|XP_007888691.1|  PREDICTED: aminoacylase-1                          128   5e-31   Callorhinchus milii [Australian ghost shark]
ref|XP_007425958.1|  PREDICTED: aminoacylase-1                          128   6e-31   Python bivittatus
ref|XP_009597815.1|  PREDICTED: aminoacylase-1-like                     121   6e-31   Nicotiana tomentosiformis
ref|XP_005724765.1|  PREDICTED: aminoacylase-1A-like                    128   9e-31   Pundamilia nyererei
ref|XP_002594432.1|  hypothetical protein BRAFLDRAFT_262219             128   9e-31   Branchiostoma floridae
ref|NP_001011406.1|  aminoacylase-1                                     128   9e-31   Xenopus tropicalis [western clawed frog]
ref|XP_009597816.1|  PREDICTED: aminoacylase-1-like                     120   1e-30   Nicotiana tomentosiformis
ref|XP_005074915.1|  PREDICTED: aminoacylase-1A-like isoform X4         127   1e-30   
gb|ERE76105.1|  aminoacylase-1A-like protein                            127   1e-30   Cricetulus griseus [Chinese hamsters]
ref|XP_009601623.1|  PREDICTED: aminoacylase-1-like                     120   1e-30   
ref|XP_005932307.1|  PREDICTED: aminoacylase-1A-like                    127   1e-30   Haplochromis burtoni
ref|XP_007617622.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase...    127   1e-30   
ref|XP_005142319.1|  PREDICTED: aminoacylase-1                          127   2e-30   Melopsittacus undulatus
gb|EGW08874.1|  Aminoacylase-1A                                         127   2e-30   Cricetulus griseus [Chinese hamsters]
ref|XP_005074913.1|  PREDICTED: aminoacylase-1A-like isoform X2         127   2e-30   
ref|XP_007639263.1|  PREDICTED: aminoacylase-1 isoform X1               127   2e-30   
ref|XP_005522205.1|  PREDICTED: aminoacylase-1                          127   2e-30   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005074912.1|  PREDICTED: aminoacylase-1A-like isoform X1         127   2e-30   Mesocricetus auratus [Syrian golden hamster]
emb|CDQ73988.1|  unnamed protein product                                127   2e-30   Oncorhynchus mykiss
ref|NP_001133433.1|  aminoacylase-1                                     127   2e-30   Salmo salar
ref|XP_001506809.2|  PREDICTED: aminoacylase-1                          127   2e-30   
ref|XP_010898926.1|  PREDICTED: aminoacylase-1                          127   3e-30   Esox lucius
ref|XP_003762644.1|  PREDICTED: aminoacylase-1A-like                    126   3e-30   Sarcophilus harrisii
gb|EDL21135.1|  aminoacylase 1                                          126   3e-30   Mus musculus [mouse]
ref|XP_005485543.1|  PREDICTED: aminoacylase-1 isoform X4               125   4e-30   
sp|Q99JW2.1|ACY1_MOUSE  RecName: Full=Aminoacylase-1; Short=ACY-1...    125   5e-30   Mus musculus [mouse]
ref|XP_008945704.1|  PREDICTED: aminoacylase-1                          125   5e-30   Merops nubicus
ref|XP_005485540.1|  PREDICTED: aminoacylase-1 isoform X1               125   5e-30   Zonotrichia albicollis
ref|XP_008283525.1|  PREDICTED: aminoacylase-1                          125   5e-30   Stegastes partitus
ref|XP_005485541.1|  PREDICTED: aminoacylase-1 isoform X2               125   6e-30   
ref|XP_007141070.1|  hypothetical protein PHAVU_008G164900g             119   6e-30   Phaseolus vulgaris [French bean]
ref|XP_009519815.1|  ACY1-like metalloprotease                          125   6e-30   Phytophthora sojae
gb|ETE70763.1|  Aminoacylase-1                                          125   6e-30   Ophiophagus hannah
ref|XP_008497203.1|  PREDICTED: aminoacylase-1                          125   7e-30   Calypte anna
ref|XP_006978456.1|  PREDICTED: aminoacylase-1A-like isoform X1         125   8e-30   Peromyscus maniculatus bairdii
ref|XP_003936643.1|  PREDICTED: aminoacylase-1                          125   8e-30   Saimiri boliviensis boliviensis
ref|XP_008511306.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     125   8e-30   Equus przewalskii [Przewalski horse]
ref|XP_005368552.1|  PREDICTED: aminoacylase-1A-like isoform X5         124   1e-29   
ref|XP_010141195.1|  PREDICTED: aminoacylase-1                          125   1e-29   Buceros rhinoceros silvestris
ref|XP_004944533.1|  PREDICTED: aminoacylase-1 isoform X10              124   1e-29   
ref|NP_079647.1|  aminoacylase-1                                        124   1e-29   Mus musculus [mouse]
ref|XP_005368550.1|  PREDICTED: aminoacylase-1A-like isoform X3         124   1e-29   
gb|KFQ45132.1|  Aminoacylase-1                                          124   2e-29   Nestor notabilis
ref|XP_009904590.1|  PREDICTED: aminoacylase-1                          124   2e-29   Picoides pubescens
ref|XP_004944532.1|  PREDICTED: aminoacylase-1 isoform X9               124   2e-29   
ref|XP_005368548.1|  PREDICTED: aminoacylase-1A-like isoform X1         124   2e-29   Microtus ochrogaster [prairie voles]
ref|XP_003642033.1|  PREDICTED: aminoacylase-1 isoformX1                124   2e-29   
ref|XP_009097762.1|  PREDICTED: aminoacylase-1                          124   2e-29   Serinus canaria [canary]
gb|EDL77312.1|  rCG25777, isoform CRA_a                                 123   3e-29   Rattus norvegicus [brown rat]
ref|XP_009484667.1|  PREDICTED: aminoacylase-1                          124   3e-29   Pelecanus crispus
ref|XP_008848074.1|  PREDICTED: aminoacylase-1                          124   3e-29   Nannospalax galili
ref|XP_003210064.2|  PREDICTED: aminoacylase-1                          124   3e-29   Meleagris gallopavo [common turkey]
ref|XP_010022017.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     124   3e-29   Nestor notabilis
ref|XP_010571264.1|  PREDICTED: aminoacylase-1                          124   3e-29   Haliaeetus leucocephalus
ref|XP_009994129.1|  PREDICTED: aminoacylase-1                          124   3e-29   Chaetura pelagica
ref|XP_009294792.1|  PREDICTED: aminoacylase-1A-like                    123   3e-29   
ref|XP_004944530.1|  PREDICTED: aminoacylase-1 isoform X7               124   4e-29   
ref|XP_007234507.1|  PREDICTED: aminoacylase-1A-like isoform X1         123   4e-29   
ref|NP_001005383.1|  aminoacylase-1A                                    123   4e-29   Rattus norvegicus [brown rat]
ref|XP_006243777.1|  PREDICTED: aminoacylase-1A isoform X1              123   4e-29   Rattus norvegicus [brown rat]
gb|AAH66489.1|  Zgc:55605 protein                                       123   4e-29   Danio rerio [leopard danio]
ref|NP_957289.2|  aminoacylase-1                                        123   4e-29   Danio rerio [leopard danio]
ref|XP_009294786.1|  PREDICTED: aminoacylase-1 isoform X2               123   4e-29   Danio rerio [leopard danio]
ref|XP_007527399.1|  PREDICTED: aminoacylase-1                          123   4e-29   
gb|AAH45399.1|  Zgc:55605                                               123   4e-29   Danio rerio [leopard danio]
ref|XP_005422486.1|  PREDICTED: aminoacylase-1                          123   4e-29   Geospiza fortis
ref|XP_004944531.1|  PREDICTED: aminoacylase-1 isoform X8               123   4e-29   
ref|XP_001380469.3|  PREDICTED: aminoacylase-1A-like isoform X1         123   4e-29   Monodelphis domestica
ref|XP_005053129.1|  PREDICTED: aminoacylase-1 isoform X4               122   5e-29   
ref|XP_010388288.1|  PREDICTED: aminoacylase-1                          123   5e-29   
ref|XP_009078003.1|  PREDICTED: aminoacylase-1 isoform X1               123   5e-29   Acanthisitta chloris
ref|XP_008630400.1|  PREDICTED: aminoacylase-1 isoform X1               123   5e-29   
ref|XP_004267923.1|  PREDICTED: aminoacylase-1 isoform 5                122   5e-29   
ref|XP_005992737.1|  PREDICTED: aminoacylase-1                          123   6e-29   
ref|XP_007451904.1|  PREDICTED: aminoacylase-1 isoform X5               122   6e-29   
ref|XP_005053126.1|  PREDICTED: aminoacylase-1 isoform X1               122   6e-29   
ref|XP_005053127.1|  PREDICTED: aminoacylase-1 isoform X2               122   6e-29   
ref|XP_009567656.1|  PREDICTED: aminoacylase-1                          122   6e-29   
dbj|GAM17084.1|  hypothetical protein SAMD00019534_002590               122   7e-29   
ref|XP_005898174.1|  PREDICTED: aminoacylase-1 isoform X5               122   7e-29   
ref|XP_005508915.1|  PREDICTED: aminoacylase-1                          122   7e-29   
ref|XP_002713420.1|  PREDICTED: aminoacylase-1                          122   7e-29   
emb|CAG06903.1|  unnamed protein product                                122   7e-29   
ref|XP_002191980.2|  PREDICTED: aminoacylase-1                          122   7e-29   
ref|XP_006892322.1|  PREDICTED: aminoacylase-1 isoform X4               121   8e-29   
ref|XP_010178411.1|  PREDICTED: aminoacylase-1                          122   8e-29   
gb|KFQ36529.1|  Aminoacylase-1                                          122   8e-29   
ref|XP_004944529.1|  PREDICTED: aminoacylase-1 isoform X6               123   8e-29   
ref|XP_004664366.1|  PREDICTED: aminoacylase-1A isoform X4              121   8e-29   
ref|XP_003973346.1|  PREDICTED: aminoacylase-1A-like                    122   8e-29   
ref|XP_005234602.1|  PREDICTED: aminoacylase-1 isoform X1               122   9e-29   
ref|XP_004267920.1|  PREDICTED: aminoacylase-1 isoform 2                122   9e-29   
ref|XP_005435995.1|  PREDICTED: aminoacylase-1                          122   9e-29   
ref|XP_004267921.1|  PREDICTED: aminoacylase-1 isoform 3                122   1e-28   
emb|CBN77243.1|  conserved unknown protein                              122   1e-28   
ref|XP_004944528.1|  PREDICTED: aminoacylase-1 isoform X5               123   1e-28   
ref|XP_007451901.1|  PREDICTED: aminoacylase-1 isoform X2               122   1e-28   
ref|XP_005898171.1|  PREDICTED: aminoacylase-1 isoform X2               122   1e-28   
ref|XP_004267919.1|  PREDICTED: aminoacylase-1 isoform 1                122   1e-28   
ref|XP_008318006.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     122   1e-28   
ref|XP_009990272.1|  PREDICTED: aminoacylase-1                          122   1e-28   
ref|XP_004944527.1|  PREDICTED: aminoacylase-1 isoform X4               123   1e-28   
gb|ETK75894.1|  hypothetical protein L915_17557                         120   1e-28   
gb|ETP33608.1|  hypothetical protein F442_17883                         120   1e-28   
ref|XP_005600649.1|  PREDICTED: aminoacylase-1 isoform X2               121   1e-28   
ref|XP_007451900.1|  PREDICTED: aminoacylase-1 isoform X1               122   1e-28   
ref|XP_006876108.1|  PREDICTED: aminoacylase-1                          122   1e-28   
ref|XP_008912646.1|  hypothetical protein PPTG_16650                    120   1e-28   
ref|XP_005898172.1|  PREDICTED: aminoacylase-1 isoform X3               121   1e-28   
ref|XP_005898170.1|  PREDICTED: aminoacylase-1 isoform X1               122   1e-28   
gb|KFP04889.1|  Aminoacylase-1                                          122   1e-28   
ref|XP_004315911.1|  PREDICTED: aminoacylase-1 isoform 5                121   1e-28   
ref|XP_007451902.1|  PREDICTED: aminoacylase-1 isoform X3               121   1e-28   
ref|XP_008055992.1|  PREDICTED: aminoacylase-1 isoform X2               122   1e-28   
ref|XP_008055991.1|  PREDICTED: aminoacylase-1 isoform X1               122   1e-28   
ref|XP_006892320.1|  PREDICTED: aminoacylase-1 isoform X2               121   1e-28   
ref|XP_004664364.1|  PREDICTED: aminoacylase-1A isoform X2              121   1e-28   
ref|XP_006892319.1|  PREDICTED: aminoacylase-1 isoform X1               121   2e-28   
ref|XP_010744640.1|  PREDICTED: aminoacylase-1                          121   2e-28   
ref|XP_004664363.1|  PREDICTED: aminoacylase-1A isoform X1              121   2e-28   
gb|ELR54724.1|  Aminoacylase-1                                          122   2e-28   
gb|EFA81878.1|  N-acyl-L-amino-acid amidohydrolase                      122   2e-28   
gb|KFO93961.1|  Aminoacylase-1                                          121   2e-28   
ref|XP_004315908.1|  PREDICTED: aminoacylase-1 isoform 2                121   2e-28   
ref|XP_009458865.1|  PREDICTED: aminoacylase-1                          121   2e-28   
tpg|DAA38854.1|  TPA: hypothetical protein ZEAMMB73_499244              118   2e-28   
ref|XP_004315909.1|  PREDICTED: aminoacylase-1 isoform 3                120   2e-28   
ref|XP_004315907.1|  PREDICTED: aminoacylase-1 isoform 1                121   2e-28   
ref|XP_001492888.2|  PREDICTED: aminoacylase-1 isoformX1                121   2e-28   
ref|XP_009949041.1|  PREDICTED: aminoacylase-1                          121   2e-28   
gb|KFV71761.1|  Aminoacylase-1                                          121   2e-28   
ref|XP_008897467.1|  hypothetical protein, variant 2                    119   3e-28   
ref|XP_004944526.1|  PREDICTED: aminoacylase-1 isoform X3               122   3e-28   
ref|NP_001070583.1|  aminoacylase-1                                     120   3e-28   
ref|XP_006045081.1|  PREDICTED: aminoacylase-1 isoform X2               120   3e-28   
ref|XP_006045080.1|  PREDICTED: aminoacylase-1 isoform X1               120   3e-28   
ref|XP_004018463.1|  PREDICTED: aminoacylase-1 isoform 4                120   3e-28   
ref|XP_004362746.1|  N-acyl-L-amino-acid amidohydrolase                 120   4e-28   
gb|ETI35653.1|  hypothetical protein F443_18039                         119   4e-28   
ref|XP_005222999.1|  PREDICTED: aminoacylase-1 isoform X1               120   4e-28   
ref|XP_010850067.1|  PREDICTED: aminoacylase-1                          120   4e-28   
ref|XP_008980012.1|  PREDICTED: aminoacylase-1 isoform X3               120   4e-28   
gb|KFU88246.1|  Aminoacylase-1                                          120   4e-28   
sp|Q6PTT0.1|ACY1B_RAT  RecName: Full=Aminoacylase-1B; Short=ACY-1...    120   4e-28   
gb|KFQ53232.1|  Aminoacylase-1                                          120   4e-28   
ref|XP_007174860.1|  PREDICTED: aminoacylase-1                          120   5e-28   
gb|ETL80839.1|  hypothetical protein, variant 1                         119   5e-28   
ref|XP_008897466.1|  hypothetical protein, variant 1                    119   5e-28   
ref|XP_004018462.1|  PREDICTED: aminoacylase-1 isoform 3                120   5e-28   
ref|XP_002908663.1|  aminoacylase-1, putative                           120   5e-28   
ref|XP_004018461.1|  PREDICTED: aminoacylase-1 isoform 2                120   5e-28   
ref|XP_002758452.1|  PREDICTED: aminoacylase-1 isoform X2               120   6e-28   
ref|XP_004018460.1|  PREDICTED: aminoacylase-1 isoform 1                120   7e-28   
ref|XP_001922589.1|  PREDICTED: aminoacylase-1A-like                    120   7e-28   
gb|EOA95612.1|  Aminoacylase-1                                          119   7e-28   
gb|KFO57991.1|  Aminoacylase-1                                          119   7e-28   
ref|XP_004465798.1|  PREDICTED: aminoacylase-1 isoform 1                119   7e-28   
ref|XP_009273045.1|  PREDICTED: aminoacylase-1                          119   8e-28   
ref|XP_005969393.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     119   8e-28   
ref|XP_005696152.1|  PREDICTED: aminoacylase-1                          119   9e-28   
ref|XP_004465800.1|  PREDICTED: aminoacylase-1 isoform 3                120   1e-27   
ref|XP_005285315.1|  PREDICTED: aminoacylase-1                          119   1e-27   
ref|XP_009065682.1|  hypothetical protein LOTGIDRAFT_197114             119   1e-27   
gb|KFO82386.1|  Aminoacylase-1                                          119   1e-27   
ref|XP_004615165.1|  PREDICTED: aminoacylase-1                          119   1e-27   
ref|XP_007061900.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase...    119   1e-27   
ref|XP_003789410.1|  PREDICTED: aminoacylase-1 isoform 1                119   1e-27   
ref|XP_008897465.1|  hypothetical protein PPTG_05617                    119   1e-27   
gb|ETL80838.1|  hypothetical protein L917_18701                         119   1e-27   
gb|KFQ31525.1|  Aminoacylase-1                                          119   1e-27   
gb|ETI33803.1|  hypothetical protein F443_19557                         119   1e-27   
ref|XP_007106004.1|  PREDICTED: aminoacylase-1                          119   1e-27   
dbj|GAM27570.1|  hypothetical protein SAMD00019534_107460               119   2e-27   
ref|XP_003789411.1|  PREDICTED: aminoacylase-1 isoform 2                119   2e-27   
ref|XP_004368646.1|  PREDICTED: alpha/beta hydrolase domain-conta...    119   2e-27   
gb|ETK75935.1|  hypothetical protein L915_17552                         118   2e-27   
gb|EMP33880.1|  Aminoacylase-1                                          119   2e-27   
gb|KFQ93528.1|  Aminoacylase-1                                          118   3e-27   
ref|XP_002908664.1|  aminoacylase-1, putative                           118   3e-27   
gb|KFQ10905.1|  Aminoacylase-1                                          117   4e-27   
ref|XP_007552056.1|  PREDICTED: aminoacylase-1                          117   4e-27   
ref|XP_008407053.1|  PREDICTED: aminoacylase-1                          117   4e-27   
ref|XP_004368645.1|  PREDICTED: alpha/beta hydrolase domain-conta...    118   4e-27   
gb|ETI35689.1|  hypothetical protein F443_18033                         117   4e-27   
ref|XP_005327043.1|  PREDICTED: aminoacylase-1                          117   4e-27   
ref|XP_006029040.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase...    117   5e-27   
gb|ETO64421.1|  hypothetical protein F444_18056                         117   5e-27   
ref|XP_004419835.1|  PREDICTED: aminoacylase-1 isoform 5                116   5e-27   
ref|XP_004419833.1|  PREDICTED: aminoacylase-1 isoform 3                117   7e-27   
ref|XP_004419832.1|  PREDICTED: aminoacylase-1 isoform 2                116   7e-27   
ref|XP_008912640.1|  hypothetical protein PPTG_16645                    117   8e-27   
ref|XP_008583257.1|  PREDICTED: aminoacylase-1 isoform X1               117   8e-27   
ref|XP_004676157.1|  PREDICTED: aminoacylase-1 isoform X1               117   8e-27   
ref|XP_004419831.1|  PREDICTED: aminoacylase-1 isoform 1                117   8e-27   
ref|XP_011439575.1|  PREDICTED: aminoacylase-1-like                     116   9e-27   
gb|EKC40392.1|  Aminoacylase-1                                          116   1e-26   
gb|ELT90864.1|  hypothetical protein CAPTEDRAFT_184037                  116   1e-26   
ref|XP_005807353.1|  PREDICTED: aminoacylase-1A-like                    116   1e-26   
gb|KFM04518.1|  Aminoacylase-1                                          116   1e-26   
ref|XP_004780127.1|  PREDICTED: aminoacylase-1                          116   1e-26   
ref|XP_646083.1|  N-acyl-L-amino-acid amidohydrolase                    116   1e-26   
ref|XP_009516985.1|  ACY1-like metalloprotease                          116   1e-26   
ref|XP_002119752.2|  PREDICTED: aminoacylase-1                          116   1e-26   
ref|XP_005027736.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     118   2e-26   
ref|XP_009065681.1|  hypothetical protein LOTGIDRAFT_222505             115   2e-26   
ref|XP_006169396.1|  PREDICTED: aminoacylase-1A-like                    115   2e-26   
ref|XP_006275196.1|  PREDICTED: aminoacylase-1A-like                    115   2e-26   
ref|NP_001280378.1|  aminoacylase-1-like                                115   2e-26   
ref|XP_008181414.1|  PREDICTED: aminoacylase-1-like isoform X1          115   2e-26   
ref|XP_006106514.1|  PREDICTED: aminoacylase-1B isoform X4              115   2e-26   
ref|XP_010623722.1|  PREDICTED: aminoacylase-1                          115   3e-26   
gb|ELV10388.1|  Aminoacylase-1A                                         115   3e-26   
ref|XP_007950232.1|  PREDICTED: aminoacylase-1 isoform X4               114   3e-26   
ref|XP_005006743.1|  PREDICTED: aminoacylase-1 isoform X5               114   3e-26   
ref|XP_008970397.1|  PREDICTED: aminoacylase-1 isoform X2               115   3e-26   
ref|XP_003257190.1|  PREDICTED: alpha/beta hydrolase domain-conta...    114   3e-26   
ref|XP_004034298.1|  PREDICTED: abhydrolase domain-containing pro...    114   3e-26   
ref|NP_001185825.1|  aminoacylase-1 isoform b                           114   3e-26   
ref|XP_006180042.1|  PREDICTED: aminoacylase-1 isoform X7               114   3e-26   
ref|XP_008153383.1|  PREDICTED: aminoacylase-1 isoform X4               114   3e-26   
ref|XP_006106511.1|  PREDICTED: aminoacylase-1B isoform X1              115   3e-26   
ref|XP_006106512.1|  PREDICTED: aminoacylase-1B isoform X2              114   3e-26   
ref|XP_007950230.1|  PREDICTED: aminoacylase-1 isoform X2               114   4e-26   
gb|ELK25076.1|  Aminoacylase-1                                          114   4e-26   
ref|XP_005881986.1|  PREDICTED: aminoacylase-1                          115   4e-26   
ref|XP_006770689.1|  PREDICTED: aminoacylase-1                          114   4e-26   
ref|XP_003257189.1|  PREDICTED: alpha/beta hydrolase domain-conta...    114   4e-26   
ref|XP_004411559.1|  PREDICTED: aminoacylase-1 isoform 5                114   4e-26   
ref|XP_006180039.1|  PREDICTED: aminoacylase-1 isoform X4               114   4e-26   
ref|XP_004034299.1|  PREDICTED: abhydrolase domain-containing pro...    114   4e-26   
ref|NP_001185827.1|  aminoacylase-1 isoform d                           114   4e-26   
ref|XP_007950229.1|  PREDICTED: aminoacylase-1 isoform X1               114   4e-26   
gb|EFX83187.1|  hypothetical protein DAPPUDRAFT_48442                   114   4e-26   
ref|XP_005006741.1|  PREDICTED: aminoacylase-1 isoform X3               114   4e-26   
ref|XP_004411556.1|  PREDICTED: aminoacylase-1 isoform 2                114   5e-26   
ref|XP_010984049.1|  PREDICTED: aminoacylase-1                          114   5e-26   
ref|XP_006180040.1|  PREDICTED: aminoacylase-1 isoform X5               114   5e-26   
ref|XP_005410397.1|  PREDICTED: aminoacylase-1A-like                    114   5e-26   
ref|XP_008153367.1|  PREDICTED: aminoacylase-1 isoform X2               114   5e-26   
ref|XP_004411557.1|  PREDICTED: aminoacylase-1 isoform 3                114   5e-26   
ref|XP_010967395.1|  PREDICTED: aminoacylase-1 isoform X1               114   5e-26   
ref|XP_004034294.1|  PREDICTED: abhydrolase domain-containing pro...    114   5e-26   
ref|NP_000657.1|  aminoacylase-1 isoform a                              114   5e-26   
ref|XP_003476523.1|  PREDICTED: aminoacylase-1 isoform X1               114   5e-26   
ref|XP_003257187.1|  PREDICTED: alpha/beta hydrolase domain-conta...    114   5e-26   
ref|XP_008153360.1|  PREDICTED: aminoacylase-1 isoform X1               114   5e-26   
ref|XP_006196437.1|  PREDICTED: aminoacylase-1 isoform X6               114   5e-26   
ref|XP_004411555.1|  PREDICTED: aminoacylase-1 isoform 1                114   5e-26   
ref|XP_003410117.1|  PREDICTED: aminoacylase-1 isoform X1               114   5e-26   
ref|XP_004715315.1|  PREDICTED: aminoacylase-1                          114   5e-26   
ref|XP_006180036.1|  PREDICTED: aminoacylase-1 isoform X1               114   6e-26   
ref|XP_004625316.1|  PREDICTED: aminoacylase-1A-like                    114   6e-26   
ref|XP_011222955.1|  PREDICTED: aminoacylase-1                          114   6e-26   
gb|EFB13632.1|  hypothetical protein PANDA_007594                       114   6e-26   
dbj|BAG60372.1|  unnamed protein product                                115   6e-26   
ref|XP_008547538.1|  PREDICTED: aminoacylase-1-like                     114   7e-26   
ref|XP_006196435.1|  PREDICTED: aminoacylase-1 isoform X4               114   8e-26   
ref|XP_004034296.1|  PREDICTED: abhydrolase domain-containing pro...    114   8e-26   
ref|XP_008702324.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     114   8e-26   
ref|XP_006196432.1|  PREDICTED: aminoacylase-1 isoform X1               114   8e-26   
ref|XP_004087930.1|  PREDICTED: alpha/beta hydrolase domain-conta...    114   8e-26   
ref|XP_004034297.1|  PREDICTED: abhydrolase domain-containing pro...    114   8e-26   
ref|XP_010298191.1|  PREDICTED: aminoacylase-1                          113   1e-25   
ref|XP_533806.2|  PREDICTED: aminoacylase-1 isoform 3                   113   1e-25   
ref|XP_004087931.1|  PREDICTED: alpha/beta hydrolase domain-conta...    114   1e-25   
ref|XP_010363342.1|  PREDICTED: aminoacylase-1                          113   1e-25   
ref|XP_004834240.1|  PREDICTED: aminoacylase-1 isoform X3               113   1e-25   
ref|XP_003894383.1|  PREDICTED: aminoacylase-1                          113   1e-25   
ref|XP_007982642.1|  PREDICTED: aminoacylase-1 isoform X4               113   1e-25   
ref|XP_007982641.1|  PREDICTED: aminoacylase-1 isoform X3               113   1e-25   
ref|XP_006909218.1|  PREDICTED: aminoacylase-1 isoform X1               113   1e-25   
emb|CDJ87807.1|  Peptidase M20 domain containing protein                113   2e-25   
ref|XP_007982640.1|  PREDICTED: aminoacylase-1 isoform X2               113   2e-25   
ref|XP_011362951.1|  PREDICTED: aminoacylase-1                          113   2e-25   
ref|XP_007982638.1|  PREDICTED: aminoacylase-1 isoform X1               113   2e-25   
emb|CDJ85938.1|  Peptidase M20 domain containing protein                113   2e-25   
gb|EPQ17469.1|  Aminoacylase-1                                          114   2e-25   
ref|XP_004599921.1|  PREDICTED: aminoacylase-1-like                     112   2e-25   
ref|XP_004834238.1|  PREDICTED: aminoacylase-1 isoform X1               113   2e-25   
ref|XP_004834239.1|  PREDICTED: aminoacylase-1 isoform X2               113   2e-25   
gb|KIH55029.1|  N-acyl-L-amino-acid amidohydrolase                      112   2e-25   
ref|NP_001124673.1|  aminoacylase-1                                     112   2e-25   
ref|XP_004882855.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     113   2e-25   
ref|XP_011277721.1|  PREDICTED: aminoacylase-1 isoform X2               112   2e-25   
gb|KFP85458.1|  Aminoacylase-1                                          112   3e-25   
sp|Q5RFB0.2|ACY1_PONAB  RecName: Full=Aminoacylase-1; Short=ACY-1...    112   3e-25   
gb|KFW65596.1|  Aminoacylase-1                                          112   3e-25   
ref|XP_002907735.1|  aminoacylase, metalloprotease family M20A, p...    112   3e-25   
gb|KIH59314.1|  N-acyl-L-amino-acid amidohydrolase                      111   3e-25   
ref|XP_003285199.1|  hypothetical protein DICPUDRAFT_53427              112   3e-25   
gb|EHH51274.1|  hypothetical protein EGM_10619                          113   3e-25   
ref|XP_009320072.1|  PREDICTED: aminoacylase-1                          112   3e-25   



>ref|XP_006422413.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|ESR35653.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|KDO68369.1| hypothetical protein CISIN_1g013216mg [Citrus sinensis]
Length=447

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  SLERRIVEEWAPASRNMTFELGQFK +AS++DKFGRP
Sbjct  285  MNLQPSEAEAGFDIRVPPTTDAESLERRIVEEWAPASRNMTFELGQFKQRASLHDKFGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AV+ ANGKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  345  ILTATDSSNPWWNLLEEAVRKANGKLGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI +YESIIKAYAS+V+H++D+ S+ EL
Sbjct  405  LHDHNEFLNQAEYLKGIDIYESIIKAYASYVQHSKDEASRDEL  447



>ref|XP_006486585.1| PREDICTED: aminoacylase-1-like isoform X1 [Citrus sinensis]
Length=447

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  SLERRIVEEWAPASRNMTFELGQFK +AS++DKFGRP
Sbjct  285  MNLQPSEAEAGFDIRVPPTTDAESLERRIVEEWAPASRNMTFELGQFKQRASLHDKFGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AV+ ANGKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  345  ILTATDSSNPWWNLLEEAVRKANGKLGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI +YESIIKA AS+V+H++D+ S+ EL
Sbjct  405  LHDHNEFLNQAEYLKGIDIYESIIKACASYVQHSKDEASRDEL  447



>ref|XP_002283140.2| PREDICTED: aminoacylase-1 isoform X1 [Vitis vinifera]
Length=481

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP ADQ SLE+RI EEWAPASRNMTFELGQFK K S+YDKFG+P
Sbjct  319  MNLQPSEAEAGFDIRIPPTADQVSLEKRIAEEWAPASRNMTFELGQFKQKVSVYDKFGKP  378

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AVK  N KLG+PEIFPASTDARYFR+ GLPAIGFSPM NTPIL
Sbjct  379  VLTATDSSNPWWTLLEEAVKKVNEKLGRPEIFPASTDARYFRQLGLPAIGFSPMKNTPIL  438

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYL+GI +YESIIKAYASF EHTRD++ K EL
Sbjct  439  LHDHNEFLNQAEYLRGIEIYESIIKAYASFNEHTRDEDRKEEL  481



>emb|CDP14501.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AG DIRVPP AD  SLERRI EEWAP+SRNMTFE   FK KAS+YDKFG+P
Sbjct  297  MNLQPSEAQAGLDIRVPPTADHLSLERRIAEEWAPSSRNMTFE---FKQKASVYDKFGKP  353

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE+A+K+ANGK+GKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  354  MLTAHDGSNPWWGLLEEAIKNANGKVGKPEIFPASTDARYFREQGLPAIGFSPMANTPIL  413

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI  YESIIKA+ASF E T DDESKAEL
Sbjct  414  LHDHNEFLNKDEYLKGIDAYESIIKAFASFDERTSDDESKAEL  456



>ref|XP_008235828.1| PREDICTED: aminoacylase-1 isoform X1 [Prunus mume]
Length=443

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLERRI EEWAP+SRNMTF  GQFK K S+ D  GRP
Sbjct  281  MNLQPSEAEAGFDIRVPPTADQESLERRIAEEWAPSSRNMTFMRGQFKQKVSVLDDSGRP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AVK ANGKLGKPEIFPASTD+RYFR+ GLPAIGFSPMANTPIL
Sbjct  341  VLTATDSSNPWWGLLEEAVKKANGKLGKPEIFPASTDSRYFRQLGLPAIGFSPMANTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI +YESIIKAYAS+V+H R   S+ EL
Sbjct  401  LHDHNEFLNKDEYLKGIEIYESIIKAYASYVDHGRSAGSRDEL  443



>ref|XP_009340791.1| PREDICTED: aminoacylase-1-like isoform X1 [Pyrus x bretschneideri]
Length=445

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLE+RI EEWAPASRNMTF  GQFK K S+ DK GRP
Sbjct  283  MNLQPSEAEAGFDIRVPPTADQESLEKRIAEEWAPASRNMTFRRGQFKQKVSVLDKAGRP  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE AVK ANGKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  343  ILTATDSSNPWWALLEDAVKKANGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPIL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIKAYAS+V+  R   S+ EL
Sbjct  403  LHDHNEFLNKDEYLKGIDVYESIIKAYASYVDGGRSAVSRDEL  445



>ref|XP_003589773.1| Aminoacylase-1 [Medicago truncatula]
Length=214

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F LGQFK K S+ D  G+P
Sbjct  52   MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSFRLGQFKQKLSVLDASGKP  111

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  112  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  171

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+KDEYLKGI+VYESIIKAYASF E  +D  SK EL
Sbjct  172  LHDHNEYLHKDEYLKGIKVYESIIKAYASFDERVKDGTSKDEL  214



>ref|XP_006422412.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|ESR35652.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|KDO68370.1| hypothetical protein CISIN_1g013216mg [Citrus sinensis]
Length=444

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 145/163 (89%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  SLERRIVEEWAPASRNMTFE   FK +AS++DKFGRP
Sbjct  285  MNLQPSEAEAGFDIRVPPTTDAESLERRIVEEWAPASRNMTFE---FKQRASLHDKFGRP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AV+ ANGKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  342  ILTATDSSNPWWNLLEEAVRKANGKLGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  401

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI +YESIIKAYAS+V+H++D+ S+ EL
Sbjct  402  LHDHNEFLNQAEYLKGIDIYESIIKAYASYVQHSKDEASRDEL  444



>ref|XP_009620561.1| PREDICTED: aminoacylase-1 [Nicotiana tomentosiformis]
Length=452

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP ADQ SLE+RI EEWAPASRNMTFE   FK K S+ DKFGRP
Sbjct  293  MNLQPSEAQAGFDIRVPPTADQASLEKRIAEEWAPASRNMTFE---FKQKVSVNDKFGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DSSN+WWALLE+++  AN  +GKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  350  AITAVDSSNVWWALLEESIVKANAGVGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIK YAS++EH RD+ S+ EL
Sbjct  410  LHDHNEFLNKDEYLKGIDVYESIIKTYASYIEHPRDEASREEL  452



>ref|XP_011040830.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1 [Populus euphratica]
Length=456

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLER+  EEWAP SRNMTF+LGQFK KASI+DKFGRP
Sbjct  294  MNLQPSEAEAGFDIRVPPTADPESLERQFAEEWAPVSRNMTFQLGQFKEKASIHDKFGRP  353

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WW+LLE+AV+ ANG+L KPEIFPASTDARYFRE GLPAIGFSPMANTP+L
Sbjct  354  MLTKTDSSNPWWSLLEEAVRKANGRLSKPEIFPASTDARYFREXGLPAIGFSPMANTPVL  413

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+DEYLKGI +YESIIKAYAS+VE      S+ EL
Sbjct  414  LHDHNEFLNQDEYLKGINIYESIIKAYASYVEDKSTGSSRDEL  456



>ref|XP_006384867.1| aminoacylase family protein [Populus trichocarpa]
 gb|ERP62664.1| aminoacylase family protein [Populus trichocarpa]
Length=456

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLER+  EEWAP SRNMTF+LGQFK KASI+DKFGRP
Sbjct  294  MNLQPSEAEAGFDIRVPPTADPESLERQFAEEWAPVSRNMTFQLGQFKEKASIHDKFGRP  353

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WW+LLE+AV+ ANGKL KPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  354  MLTKTDSSNPWWSLLEEAVRKANGKLSKPEIFPASTDARYFREQGLPAIGFSPMANTPIL  413

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+DEYLKGI +YESIIKAYAS+V       S+ EL
Sbjct  414  LHDHNEFLNQDEYLKGINIYESIIKAYASYVGDKSTRSSRDEL  456



>ref|XP_009796337.1| PREDICTED: aminoacylase-1 [Nicotiana sylvestris]
Length=452

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP ADQ SLE+RI EEWAPASRNMTFE   FK K S+ DKFGRP
Sbjct  293  MNLQPSEAQAGFDIRVPPTADQASLEKRIAEEWAPASRNMTFE---FKQKVSVNDKFGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DSSNIWWALLE+++  AN  +GKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  350  AITAVDSSNIWWALLEESIVKANAGVGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIK YAS++EH RD+  + EL
Sbjct  410  LHDHNEFLNKDEYLKGIDVYESIIKTYASYIEHPRDEAPREEL  452



>ref|XP_011092916.1| PREDICTED: aminoacylase-1 isoform X1 [Sesamum indicum]
Length=458

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP AD  SLERRI EEWAPA+RNMTFEL QFK +AS YDKFG+P
Sbjct  296  MNLQPSEAQAGFDIRVPPTADVASLERRIGEEWAPATRNMTFELVQFKQRASTYDKFGKP  355

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WWALLE A+K+A+GKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  356  ILTAFDGSNPWWALLEDAIKNASGKLGKPEIFPASTDARYFRELGLPAIGFSPMANTPIL  415

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+K+EYL+GI +YESIIKAYAS+ E  +D+ S+AEL
Sbjct  416  LHDHNEFLSKNEYLRGIDIYESIIKAYASYAEPVKDEASRAEL  458



>emb|CBI37723.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP ADQ SLE+RI EEWAPASRNMTFE   FK K S+YDKFG+P
Sbjct  248  MNLQPSEAEAGFDIRIPPTADQVSLEKRIAEEWAPASRNMTFE---FKQKVSVYDKFGKP  304

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AVK  N KLG+PEIFPASTDARYFR+ GLPAIGFSPM NTPIL
Sbjct  305  VLTATDSSNPWWTLLEEAVKKVNEKLGRPEIFPASTDARYFRQLGLPAIGFSPMKNTPIL  364

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYL+GI +YESIIKAYASF EHTRD++ K EL
Sbjct  365  LHDHNEFLNQAEYLRGIEIYESIIKAYASFNEHTRDEDRKEEL  407



>ref|XP_004290084.1| PREDICTED: aminoacylase-1 isoform X1 [Fragaria vesca subsp. vesca]
Length=446

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLE+RI EEWAP SRNMTF LGQFK K S+ DK GRP
Sbjct  285  MNLQPSEAEAGFDIRVPPTADQESLEKRIAEEWAPTSRNMTFRLGQFKQKVSVLDKSGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE+AVK ANGKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  345  VLTATDSSNPWWALLEEAVKKANGKLGKPEIFPASTDARYFRLQGLPAIGFSPMANTPIL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHT  275
            LHDHNEFLNKDEYLKGI++YE IIK+Y+S+ EH 
Sbjct  405  LHDHNEFLNKDEYLKGIKIYEFIIKSYSSYAEHV  438



>ref|XP_006486586.1| PREDICTED: aminoacylase-1-like isoform X2 [Citrus sinensis]
Length=444

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  SLERRIVEEWAPASRNMTFE   FK +AS++DKFGRP
Sbjct  285  MNLQPSEAEAGFDIRVPPTTDAESLERRIVEEWAPASRNMTFE---FKQRASLHDKFGRP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AV+ ANGKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  342  ILTATDSSNPWWNLLEEAVRKANGKLGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  401

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI +YESIIKA AS+V+H++D+ S+ EL
Sbjct  402  LHDHNEFLNQAEYLKGIDIYESIIKACASYVQHSKDEASRDEL  444



>ref|XP_006364339.1| PREDICTED: aminoacylase-1-like [Solanum tuberosum]
Length=452

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP ADQ SLERRI +EWAPA RNMTFE   FK K S+ DKFGRP
Sbjct  293  MNLQPSEAQAGFDIRVPPTADQASLERRIADEWAPAWRNMTFE---FKQKVSVNDKFGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DSSNIWWAL E+A+  AN +LGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  350  AVTAVDSSNIWWALFEEAIIKANARLGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIK YAS++++ RDD S+ EL
Sbjct  410  LHDHNEFLNKDEYLKGIDVYESIIKTYASYIQYQRDDASREEL  452



>gb|EYU40489.1| hypothetical protein MIMGU_mgv1a005945mg [Erythranthe guttata]
Length=463

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP AD  SLERRI EEWAPA+RNMTFE   FK K SIYDKFG+ 
Sbjct  304  MNLQPSEAQAGFDIRVPPTADVVSLERRIAEEWAPATRNMTFE---FKQKGSIYDKFGKQ  360

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE A+K ANG+LGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  361  ILTAFDSSNPWWVLLEDAIKSANGELGKPEIFPASTDARYFRELGLPAIGFSPMANTPIL  420

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNK+EYL+GI +YESIIKAYAS+VE T+D++S+AEL
Sbjct  421  LHDHNEFLNKNEYLRGIHIYESIIKAYASYVEPTKDEDSRAEL  463



>ref|XP_004231104.1| PREDICTED: aminoacylase-1 [Solanum lycopersicum]
Length=448

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP ADQ SLER I +EWAPASRNMTFE   FK K S+ DK GRP
Sbjct  289  MNLQPSEAQAGFDIRVPPTADQASLERLIADEWAPASRNMTFE---FKQKVSVNDKLGRP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DSSNIWWAL E+A+  AN +LGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  346  AVTAVDSSNIWWALFEEAIIKANARLGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIK YAS++++ RDD S+ EL
Sbjct  406  LHDHNEFLNKDEYLKGIDVYESIIKTYASYIQYQRDDASREEL  448



>dbj|BAO98754.1| putative aminoacylase [Nicotiana benthamiana]
Length=452

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSE +AGFDIRVPP ADQ SLERRI EEWAPASRNMTFE   FK K S+ DKFGRP
Sbjct  293  MNLQPSEVQAGFDIRVPPTADQASLERRIAEEWAPASRNMTFE---FKQKVSVNDKFGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DSSNIWWALLE+++  AN  +GKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  350  AITAVDSSNIWWALLEESIVKANAGVGKPEIFPASTDARYFRERGLPAIGFSPMANTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VY SIIK YAS++EH RD+  + EL
Sbjct  410  LHDHNEFLNKDEYLKGIDVYGSIIKTYASYIEHPRDEAPREEL  452



>ref|XP_010645690.1| PREDICTED: aminoacylase-1 isoform X2 [Vitis vinifera]
Length=478

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP ADQ SLE+RI EEWAPASRNMTFE   FK K S+YDKFG+P
Sbjct  319  MNLQPSEAEAGFDIRIPPTADQVSLEKRIAEEWAPASRNMTFE---FKQKVSVYDKFGKP  375

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AVK  N KLG+PEIFPASTDARYFR+ GLPAIGFSPM NTPIL
Sbjct  376  VLTATDSSNPWWTLLEEAVKKVNEKLGRPEIFPASTDARYFRQLGLPAIGFSPMKNTPIL  435

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYL+GI +YESIIKAYASF EHTRD++ K EL
Sbjct  436  LHDHNEFLNQAEYLRGIEIYESIIKAYASFNEHTRDEDRKEEL  478



>gb|ACU20502.1| unknown [Glycine max]
Length=214

 Score =   259 bits (663),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI  EWAP+SRNM+F LGQFK KA   DK G+P
Sbjct  52   MNLQPSEAEAGFDIRVPPTADPESLERRIAGEWAPSSRNMSFTLGQFKQKAHTRDKSGKP  111

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WWALLE AV+ A GKLGKPE+FPA+TD+RYFRE GLPAIGFSPMANTP+L
Sbjct  112  ILTKTDSSNPWWALLENAVQKAGGKLGKPEVFPAATDSRYFRERGLPAIGFSPMANTPVL  171

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI++YESIIK YAS  ++ RD  SK EL
Sbjct  172  LHDHNEFLHKDEYLKGIKIYESIIKVYASLDDNGRDGASKDEL  214



>dbj|BAQ00430.1| putative aminoacylase [Nicotiana tabacum]
Length=452

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP ADQ SLE+RI EEWAPASRNMTFE   FK K S+ DKFGRP
Sbjct  293  MNLQPSEAQAGFDIRVPPTADQASLEKRIAEEWAPASRNMTFE---FKQKVSVNDKFGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DSSNIWWALLE+++  AN  +GKPEIFPASTDARYFRE GLPAIGFSPMANTPI 
Sbjct  350  AITAVDSSNIWWALLEESIVKANAGVGKPEIFPASTDARYFRERGLPAIGFSPMANTPIP  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIK YAS++EH RD+  + EL
Sbjct  410  LHDHNEFLNKDEYLKGIDVYESIIKTYASYIEHPRDEAPREEL  452



>ref|XP_009358896.1| PREDICTED: aminoacylase-1-like isoform X1 [Pyrus x bretschneideri]
Length=446

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPPIAD  SLE+RI EEWAP SRNMTF  GQ K K S+ DK G+P
Sbjct  284  MNLQPSEAEAGFDIRVPPIADHESLEKRIAEEWAPTSRNMTFRHGQLKQKVSVLDKSGKP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE AVK ANGKLGKPEIFPASTDA YFR  GLPAIGFSPMANTPIL
Sbjct  344  ILTATDSSNPWWALLEDAVKKANGKLGKPEIFPASTDAHYFRNLGLPAIGFSPMANTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI +YESIIKAYAS+V+H +   S+ EL
Sbjct  404  LHDHNEFLNKDEYLKGIDIYESIIKAYASYVDHGKIAGSRDEL  446



>gb|EYU41243.1| hypothetical protein MIMGU_mgv1a008993mg [Erythranthe guttata]
Length=356

 Score =   263 bits (672),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP AD  SLERRI EEWAPA+RNMTFE   FK K S Y+KFG+ 
Sbjct  197  MNLQPSEAQAGFDIRVPPTADVVSLERRIAEEWAPATRNMTFE---FKQKGSTYNKFGKQ  253

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE A+K A+G+LGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  254  ILTAFDSSNPWWALLEDAIKSADGELGKPEIFPASTDARYFRELGLPAIGFSPMANTPIL  313

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNK+EYL+GI +YESIIKAYAS+VE T+D+ S+AEL
Sbjct  314  LHDHNEFLNKNEYLRGIHMYESIIKAYASYVEPTKDEASRAEL  356



>gb|ABK94846.1| unknown [Populus trichocarpa]
Length=448

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP SRNMTF   QFK + SI+DK GRP
Sbjct  289  MNLQPSEAEAGFDIRVPPTADPESLERRIAEEWAPVSRNMTF---QFKQQVSIHDKSGRP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WW+LLE+AV+ ANGKLGKPEIFPASTDARYFR+ GLPAIGFSPMANTPIL
Sbjct  346  VVTKTDSSNPWWSLLEEAVRKANGKLGKPEIFPASTDARYFRQLGLPAIGFSPMANTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+DEYLKGI +YE+IIKAYAS++EHT D  ++ EL
Sbjct  406  LHDHNEFLNQDEYLKGIHIYEAIIKAYASYIEHTSDGSTRDEL  448



>ref|XP_008235829.1| PREDICTED: aminoacylase-1 isoform X2 [Prunus mume]
Length=440

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLERRI EEWAP+SRNMTF    FK K S+ D  GRP
Sbjct  281  MNLQPSEAEAGFDIRVPPTADQESLERRIAEEWAPSSRNMTF---MFKQKVSVLDDSGRP  337

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AVK ANGKLGKPEIFPASTD+RYFR+ GLPAIGFSPMANTPIL
Sbjct  338  VLTATDSSNPWWGLLEEAVKKANGKLGKPEIFPASTDSRYFRQLGLPAIGFSPMANTPIL  397

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI +YESIIKAYAS+V+H R   S+ EL
Sbjct  398  LHDHNEFLNKDEYLKGIEIYESIIKAYASYVDHGRSAGSRDEL  440



>ref|XP_011000859.1| PREDICTED: aminoacylase-1-like [Populus euphratica]
Length=486

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP SRNMTF   QFK + SI+DK GRP
Sbjct  327  MNLQPSEAEAGFDIRVPPTADPESLERRIAEEWAPVSRNMTF---QFKQQVSIHDKSGRP  383

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WW+LLE+AV+ ANGKLGKPEIFPASTDARYFR+ GLPAIGFSPMANTPIL
Sbjct  384  VVTKTDSSNPWWSLLEEAVRKANGKLGKPEIFPASTDARYFRQLGLPAIGFSPMANTPIL  443

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+DEYLKGIR+YE IIKAYAS++EHT +  ++ EL
Sbjct  444  LHDHNEFLNQDEYLKGIRIYEEIIKAYASYIEHTSNGSTRDEL  486



>ref|XP_007201041.1| hypothetical protein PRUPE_ppa005858mg [Prunus persica]
 gb|EMJ02240.1| hypothetical protein PRUPE_ppa005858mg [Prunus persica]
Length=440

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLERRI EEWAP+SRNMTF    FK K S+ D  GRP
Sbjct  281  MNLQPSEAEAGFDIRVPPTADQESLERRIAEEWAPSSRNMTF---MFKQKVSVLDDSGRP  337

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW LLE+AVK A+GKLGKPEIFPASTDARYFR+ GLPAIGFSPMANTPIL
Sbjct  338  ILTATDSSNPWWGLLEEAVKKADGKLGKPEIFPASTDARYFRQLGLPAIGFSPMANTPIL  397

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI +YESIIKAYAS+V+H R   S+ EL
Sbjct  398  LHDHNEFLNKDEYLKGIEIYESIIKAYASYVDHGRSAGSRDEL  440



>ref|XP_009340792.1| PREDICTED: aminoacylase-1-like isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLE+RI EEWAPASRNMTF   +FK K S+ DK GRP
Sbjct  283  MNLQPSEAEAGFDIRVPPTADQESLEKRIAEEWAPASRNMTF---RFKQKVSVLDKAGRP  339

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE AVK ANGKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  340  ILTATDSSNPWWALLEDAVKKANGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPIL  399

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIKAYAS+V+  R   S+ EL
Sbjct  400  LHDHNEFLNKDEYLKGIDVYESIIKAYASYVDGGRSAVSRDEL  442



>ref|XP_010093337.1| hypothetical protein L484_002939 [Morus notabilis]
 gb|EXB53900.1| hypothetical protein L484_002939 [Morus notabilis]
Length=469

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP AD  +LERRI EEWAPASRNMTFE   FK K S  DK G+P
Sbjct  310  MNLQPSEAEAGFDIRIPPTADPDALERRIAEEWAPASRNMTFE---FKQKHSSLDKSGKP  366

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ DSSN WW LLE+AVK ANGKLGKPEIFPASTDARYFR+ GLPAIGFSPMANTPIL
Sbjct  367  LITATDSSNPWWNLLEEAVKKANGKLGKPEIFPASTDARYFRDLGLPAIGFSPMANTPIL  426

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI VYESIIKAYAS+++H R D SK EL
Sbjct  427  LHDHNEFLNKDEYLKGIEVYESIIKAYASYIQHARRDGSKDEL  469



>gb|KEH40951.1| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=452

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F LGQFK K S+ D  G+P
Sbjct  290  MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSFRLGQFKQKLSVLDASGKP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  350  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+KDEYLKGI+VYESIIKAYASF E  +D  SK EL
Sbjct  410  LHDHNEYLHKDEYLKGIKVYESIIKAYASFDERVKDGTSKDEL  452



>ref|XP_003589759.1| Aminoacylase-1 [Medicago truncatula]
Length=451

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F LGQFK K S+ D  G+P
Sbjct  289  MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSFRLGQFKQKLSVLDASGKP  348

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  349  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  408

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+KDEYLKGI+VYESIIKAYASF E  +D  SK EL
Sbjct  409  LHDHNEYLHKDEYLKGIKVYESIIKAYASFDERVKDGTSKDEL  451



>ref|XP_002312793.2| aminoacylase family protein [Populus trichocarpa]
 gb|EEE86748.2| aminoacylase family protein [Populus trichocarpa]
Length=448

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP SRNMTF   QFK + SI+DK  RP
Sbjct  289  MNLQPSEAEAGFDIRVPPTADPESLERRIAEEWAPVSRNMTF---QFKQQVSIHDKSVRP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WW+LLE+AV+ ANGKLGKPEIFPASTDARYFR+ GLPAIGFSPMANTPIL
Sbjct  346  VVTKTDSSNPWWSLLEEAVRKANGKLGKPEIFPASTDARYFRQLGLPAIGFSPMANTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+DEYLKGI +YE+IIKAYAS++EHT D  ++ EL
Sbjct  406  LHDHNEFLNQDEYLKGIHIYEAIIKAYASYIEHTSDGSTRDEL  448



>ref|XP_004498100.1| PREDICTED: aminoacylase-1-like isoform X1 [Cicer arietinum]
Length=456

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAPA RNM+  LGQFK K  + D +G+P
Sbjct  294  MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPAWRNMSVSLGQFKQKVPVTDAYGKP  353

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV++A GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTP+L
Sbjct  354  VVTKTDSSNPWWALLENAVQEAGGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPVL  413

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+LNKDEYLKGI++YESIIK++ASF EH RD+  K EL
Sbjct  414  LHDHNEYLNKDEYLKGIKIYESIIKSFASFDEHGRDERFKDEL  456



>ref|XP_008347555.1| PREDICTED: aminoacylase-1-like [Malus domestica]
Length=446

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 136/155 (88%), Gaps = 3/155 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIRVPPIADQ SLE+RI EEWAP SRNMTF   +FK K S+ DK G+P
Sbjct  286  MNMQPSEAEAGFDIRVPPIADQESLEKRIAEEWAPTSRNMTF---RFKQKVSVLDKSGKP  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE AVK ANGKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  343  ILTATDSSNPWWALLEDAVKKANGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPIL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTR  272
            LHDHNEFLNKDEYLKGI +YESIIKAYAS+V+H +
Sbjct  403  LHDHNEFLNKDEYLKGIEIYESIIKAYASYVDHGK  437



>ref|XP_003556753.1| PREDICTED: aminoacylase-1 isoform X1 [Glycine max]
Length=449

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+SRNM+F LGQFK KA   DK G+P
Sbjct  287  MNLQPSEAEAGFDIRVPPTADPESLERRIAEEWAPSSRNMSFTLGQFKQKAHTRDKSGKP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WWALLE AV+ A GKLGKPE+FPA+TD+RYFRE GLPAIGFSPMANTP+L
Sbjct  347  ILTKTDSSNPWWALLENAVQKAGGKLGKPEVFPAATDSRYFRERGLPAIGFSPMANTPVL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI++YESIIK YAS  ++ RD  SK EL
Sbjct  407  LHDHNEFLHKDEYLKGIKIYESIIKVYASLDDNGRDGASKDEL  449



>ref|XP_011092917.1| PREDICTED: aminoacylase-1 isoform X2 [Sesamum indicum]
Length=455

 Score =   261 bits (668),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+AGFDIRVPP AD  SLERRI EEWAPA+RNMTFE   FK +AS YDKFG+P
Sbjct  296  MNLQPSEAQAGFDIRVPPTADVASLERRIGEEWAPATRNMTFE---FKQRASTYDKFGKP  352

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WWALLE A+K+A+GKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPIL
Sbjct  353  ILTAFDGSNPWWALLEDAIKNASGKLGKPEIFPASTDARYFRELGLPAIGFSPMANTPIL  412

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+K+EYL+GI +YESIIKAYAS+ E  +D+ S+AEL
Sbjct  413  LHDHNEFLSKNEYLRGIDIYESIIKAYASYAEPVKDEASRAEL  455



>ref|XP_003589774.1| Aminoacylase-1 [Medicago truncatula]
Length=211

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F   +FK K S+ D  G+P
Sbjct  52   MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSF---RFKQKLSVLDASGKP  108

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  109  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  168

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+KDEYLKGI+VYESIIKAYASF E  +D  SK EL
Sbjct  169  LHDHNEYLHKDEYLKGIKVYESIIKAYASFDERVKDGTSKDEL  211



>ref|XP_009358898.1| PREDICTED: aminoacylase-1-like isoform X2 [Pyrus x bretschneideri]
Length=443

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPPIAD  SLE+RI EEWAP SRNMTF L Q   K S+ DK G+P
Sbjct  284  MNLQPSEAEAGFDIRVPPIADHESLEKRIAEEWAPTSRNMTFRLKQ---KVSVLDKSGKP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE AVK ANGKLGKPEIFPASTDA YFR  GLPAIGFSPMANTPIL
Sbjct  341  ILTATDSSNPWWALLEDAVKKANGKLGKPEIFPASTDAHYFRNLGLPAIGFSPMANTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNKDEYLKGI +YESIIKAYAS+V+H +   S+ EL
Sbjct  401  LHDHNEFLNKDEYLKGIDIYESIIKAYASYVDHGKIAGSRDEL  443



>ref|XP_002514407.1| Aminoacylase-1, putative [Ricinus communis]
 gb|EEF48003.1| Aminoacylase-1, putative [Ricinus communis]
Length=459

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPPIAD  SLERRI EEW PASRNMTF   QFK KA ++DKFGRP
Sbjct  300  MNLQPSEAEAGFDIRVPPIADPESLERRIAEEWGPASRNMTF---QFKQKAILHDKFGRP  356

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WWALLE+AV+ ANGKLGKPEIFPA+TDARYFRE GLPAIGFSPMANTP+L
Sbjct  357  LLTKTDSSNPWWALLEEAVQKANGKLGKPEIFPAATDARYFRELGLPAIGFSPMANTPLL  416

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI +Y SI+K YAS+V H   +  K EL
Sbjct  417  LHDHNEFLNQAEYLKGIDIYASIVKVYASYVNHASSEVVKDEL  459



>ref|XP_011458107.1| PREDICTED: aminoacylase-1 isoform X2 [Fragaria vesca subsp. vesca]
Length=443

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 134/154 (87%), Gaps = 3/154 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP ADQ SLE+RI EEWAP SRNMTF   +FK K S+ DK GRP
Sbjct  285  MNLQPSEAEAGFDIRVPPTADQESLEKRIAEEWAPTSRNMTF---RFKQKVSVLDKSGRP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE+AVK ANGKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  342  VLTATDSSNPWWALLEEAVKKANGKLGKPEIFPASTDARYFRLQGLPAIGFSPMANTPIL  401

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHT  275
            LHDHNEFLNKDEYLKGI++YE IIK+Y+S+ EH 
Sbjct  402  LHDHNEFLNKDEYLKGIKIYEFIIKSYSSYAEHV  435



>gb|KDP47023.1| hypothetical protein JCGZ_10750 [Jatropha curcas]
Length=446

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPPIAD  SLERRI EEWAPASRNMTF   QFK KAS+YDK GR 
Sbjct  287  MNLQPSEAEAGFDIRVPPIADPESLERRIAEEWAPASRNMTF---QFKQKASVYDKSGRA  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WW LLE AV+ ANGKLGKPEIFPA+TD+RYFR  GLPAIGFSPMANTPIL
Sbjct  344  LLTKTDSSNPWWTLLEGAVRKANGKLGKPEIFPAATDSRYFRLLGLPAIGFSPMANTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI +YESIIK YAS+ EH   + +K EL
Sbjct  404  LHDHNEFLNQAEYLKGIDIYESIIKDYASYAEHPSSEGAKDEL  446



>ref|XP_008382744.1| PREDICTED: aminoacylase-1-like, partial [Malus domestica]
Length=485

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 133/152 (88%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAG DIRVPP ADQ SLE+RI EEWAPASRNMTF   +FK K S+ DK GRP
Sbjct  326  MNLQPSEAEAGLDIRVPPTADQESLEKRIAEEWAPASRNMTF---RFKHKVSVLDKAGRP  382

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE AVK ANGKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  383  ILTATDSSNPWWALLEDAVKKANGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPIL  442

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFLNKDEYLKGI +YES+IKAYAS+V+
Sbjct  443  LHDHNEFLNKDEYLKGIDIYESVIKAYASYVD  474



>gb|AES60010.2| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=449

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F   +FK K S+ D  G+P
Sbjct  290  MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSF---RFKQKLSVLDASGKP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  347  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+KDEYLKGI+VYESIIKAYASF E  +D  SK EL
Sbjct  407  LHDHNEYLHKDEYLKGIKVYESIIKAYASFDERVKDGTSKDEL  449



>gb|AFK34969.1| unknown [Medicago truncatula]
Length=449

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F   +FK K S+ D  G+P
Sbjct  290  MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSF---RFKQKLSVLDASGKP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  347  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+KDEYLKGI+VYESIIKAY SF E  +D  SK EL
Sbjct  407  LHDHNEYLHKDEYLKGIKVYESIIKAYVSFDERVKDGTSKDEL  449



>ref|XP_004498101.1| PREDICTED: aminoacylase-1-like isoform X2 [Cicer arietinum]
Length=453

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAPA RNM+     FK K  + D +G+P
Sbjct  294  MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPAWRNMSV---SFKQKVPVTDAYGKP  350

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV++A GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTP+L
Sbjct  351  VVTKTDSSNPWWALLENAVQEAGGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPVL  410

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+LNKDEYLKGI++YESIIK++ASF EH RD+  K EL
Sbjct  411  LHDHNEYLNKDEYLKGIKIYESIIKSFASFDEHGRDERFKDEL  453



>ref|XP_006605409.1| PREDICTED: aminoacylase-1 isoform X2 [Glycine max]
Length=446

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+SRNM+F    FK KA   DK G+P
Sbjct  287  MNLQPSEAEAGFDIRVPPTADPESLERRIAEEWAPSSRNMSF---TFKQKAHTRDKSGKP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WWALLE AV+ A GKLGKPE+FPA+TD+RYFRE GLPAIGFSPMANTP+L
Sbjct  344  ILTKTDSSNPWWALLENAVQKAGGKLGKPEVFPAATDSRYFRERGLPAIGFSPMANTPVL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI++YESIIK YAS  ++ RD  SK EL
Sbjct  404  LHDHNEFLHKDEYLKGIKIYESIIKVYASLDDNGRDGASKDEL  446



>ref|XP_008787043.1| PREDICTED: aminoacylase-1 isoform X1 [Phoenix dactylifera]
Length=466

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIRVPP AD  +LERRI EEWAP+SRNMTFE   FK K S++D FG+P
Sbjct  307  MNLQPSEAEVGLDIRVPPNADTEALERRIAEEWAPSSRNMTFE---FKHKVSVHDLFGKP  363

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ D+SN WW LLE+A+K ANGKL KPEIFPASTD+R+FRE G+PA GFSPMANTPIL
Sbjct  364  AITAADNSNPWWMLLEEAMKKANGKLSKPEIFPASTDSRFFRERGIPAFGFSPMANTPIL  423

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LH HNEFLNKDEYLKGI +YESIIKA+AS+   T+D+ES+AEL
Sbjct  424  LHGHNEFLNKDEYLKGIEIYESIIKAFASYKGDTKDEESRAEL  466



>ref|XP_010932091.1| PREDICTED: aminoacylase-1 [Elaeis guineensis]
Length=466

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIRVPP A+  +LERRI EEWAP+SRN+TFE   FK K S++D FG+P
Sbjct  307  MNLQPSEAEVGLDIRVPPNANTEALERRIAEEWAPSSRNLTFE---FKHKVSVHDMFGKP  363

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  D+SN WW LLE AVK ANGKLGKPEIFPASTDAR+FRE G+PA GFSPMANTPIL
Sbjct  364  AITPADNSNPWWMLLEAAVKKANGKLGKPEIFPASTDARFFRERGIPAFGFSPMANTPIL  423

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNK EYLKGI +YESIIKA+AS+    +D+ES+AEL
Sbjct  424  LHDHNEFLNKHEYLKGIEIYESIIKAFASYKGDAKDEESRAEL  466



>ref|XP_007043100.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOX98931.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=454

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP A+  SLE+RIVEEWAPASRNMTFE   FK K +++D  GRP
Sbjct  295  MNLQPSEAEAGFDIRIPPTANAESLEKRIVEEWAPASRNMTFE---FKQKGTLHDNLGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T+ D SN WW LLE+A+K ANGK+GKPEIFPASTDARYFR+ GLPAIGFSPMANTP+L
Sbjct  352  LQTAIDKSNPWWTLLEEAIKKANGKIGKPEIFPASTDARYFRQLGLPAIGFSPMANTPLL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYL+GI VYESIIKAY S++   RD  S+ EL
Sbjct  412  LHDHNEFLNQAEYLRGIDVYESIIKAYTSYIPPGRDAVSRDEL  454



>ref|XP_008448158.1| PREDICTED: aminoacylase-1 [Cucumis melo]
Length=448

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+R+PP  +  SLERRI EEWAPASRNMTFE   FK K SIYDKFG+P
Sbjct  289  MNLQPSEAEAGFDVRLPPTTNPESLERRIAEEWAPASRNMTFE---FKQKESIYDKFGKP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            ALT+ D SN WW LLE+AV++ANGKL  PEIFPASTDARYFR  GLPAIGFSPM NTPIL
Sbjct  346  ALTAIDKSNPWWNLLEEAVRNANGKLANPEIFPASTDARYFRNLGLPAIGFSPMVNTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI VYESIIKAYAS+    R +  K EL
Sbjct  406  LHDHNEFLNQAEYLKGIEVYESIIKAYASYDGDKRMESFKDEL  448



>ref|XP_010090715.1| hypothetical protein L484_013737 [Morus notabilis]
 gb|EXB40434.1| hypothetical protein L484_013737 [Morus notabilis]
Length=408

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RV P AD  SLE+RI EEWAPASRNM FE   +K K  + DKFG+P
Sbjct  249  MNLQPSEAEAGFDVRVSPNADPKSLEKRIAEEWAPASRNMAFE---YKQKVPVLDKFGKP  305

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WW+LLE+AVKDANG LGKPEI   +TDARYFR  G+PAIGFSP+ANTPIL
Sbjct  306  VLTATDSSNPWWSLLEEAVKDANGTLGKPEIIIGTTDARYFRARGVPAIGFSPIANTPIL  365

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
             HDHNEFLNKDEYLKGI VYESIIKAYAS+V H     SK EL
Sbjct  366  FHDHNEFLNKDEYLKGISVYESIIKAYASYVGHGSSGISKDEL  408



>ref|NP_001148589.1| aminoacylase-1 precursor [Zea mays]
 gb|ACG32149.1| aminoacylase-1 [Zea mays]
Length=457

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP A   +LERR+VEEWAP SRN+TFE   FK K S+ D FG+P
Sbjct  298  MNLQPSEAEVGLDIRIPPSAHVEALERRLVEEWAPPSRNLTFE---FKQKMSVLDNFGKP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DS+N WW LLE+AVK A+GKLGKPEIFPASTDARYFR+ GLPA GFSPMANTPIL
Sbjct  355  AMTAADSTNPWWTLLEEAVKSADGKLGKPEIFPASTDARYFRKIGLPAFGFSPMANTPIL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESII+A A+  +  +DDES+AEL
Sbjct  415  LHDHNEFLSKDEYLKGIGIYESIIRALATHEDGGKDDESRAEL  457



>ref|XP_007153022.1| hypothetical protein PHAVU_003G001200g [Phaseolus vulgaris]
 gb|ESW25016.1| hypothetical protein PHAVU_003G001200g [Phaseolus vulgaris]
Length=452

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+SRNM+F    FK KAS  +K G+ 
Sbjct  293  MNLQPSEAEAGFDIRVPPTADPESLERRIAEEWAPSSRNMSF---AFKQKASTRNKSGKL  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WW LL  AV+ A GKLGKPE+FPA+TD+RYFRE GLPAIGFSPMANTP+L
Sbjct  350  LLTETDSSNPWWNLLGNAVELAGGKLGKPEVFPAATDSRYFRELGLPAIGFSPMANTPVL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESIIKAYASF +H RD  SK EL
Sbjct  410  LHDHNEFLHKDEYLKGIEIYESIIKAYASFNDHGRDGASKDEL  452



>ref|XP_003589763.1| Aminoacylase-1 [Medicago truncatula]
 gb|AES60014.1| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=446

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP SRNM+F    FK K S++D  G+P
Sbjct  287  MNLQPSEAEAGFDIRVPPTADTKSLERRIAEEWAPTSRNMSF---TFKEKISVHDASGKP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T  DSSN WWALL+ AV++A GK+ KPE+FPASTD R+FR  GLP IGFSPMANTPIL
Sbjct  344  VFTKTDSSNPWWALLKNAVEEAGGKIRKPEVFPASTDGRFFRNLGLPTIGFSPMANTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+K EYLKGI++YESIIKAYASF EH RD  SK EL
Sbjct  404  LHDHNEYLHKSEYLKGIKIYESIIKAYASFDEHGRDARSKDEL  446



>ref|XP_010690578.1| PREDICTED: aminoacylase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  DQ +  +RI +EWAPASRNMTFE GQFK K S+ D  G P
Sbjct  292  MNLQPSEAEAGFDIRIPPTTDQEAFIKRIADEWAPASRNMTFEHGQFKQKQSVLDNSGNP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            ALT   SSN WW LLE+AV+ A G+L  PEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  352  ALTVAGSSNPWWVLLEEAVRSAGGELENPEIFPASTDARYFRRQGLPAIGFSPMANTPIL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKA  254
            LHDHNEFLN+ EYLKG+ +Y SIIKAYAS+ EH    ES +
Sbjct  412  LHDHNEFLNQAEYLKGVDIYVSIIKAYASYAEHAEAKESNS  452



>tpg|DAA47999.1| TPA: aminoacylase-1 [Zea mays]
Length=446

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP A   +LERR+VEEWAP SRN+TFE   FK K S+ D FG+P
Sbjct  287  MNLQPSEAEVGLDIRIPPSAHVEALERRLVEEWAPPSRNLTFE---FKQKMSVLDNFGKP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ DS+N WW LLE+AVK A+GKLGK EIFPASTDARYFR+ GLPA GFSPMANTPIL
Sbjct  344  AMTAADSTNPWWTLLEEAVKSADGKLGKAEIFPASTDARYFRKIGLPAFGFSPMANTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESII+A A+  +  +DDES+AEL
Sbjct  404  LHDHNEFLSKDEYLKGIGIYESIIRALATHEDGGKDDESRAEL  446



>ref|XP_010270552.1| PREDICTED: aminoacylase-1 [Nelumbo nucifera]
Length=450

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 7/163 (4%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP ADQ SLERRI EEWAP+SRNMTFE   FK K S+ +K G+P
Sbjct  295  MNLQPSEAEAGFDIRLPPTADQPSLERRIAEEWAPSSRNMTFE---FKQKVSV-NKHGKP  350

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE+AVK A+GKLGKPEIFPASTDAR+FR  GLPAIGFSPMANTPIL
Sbjct  351  ILTATDSSNPWWALLEEAVKKASGKLGKPEIFPASTDARHFRTRGLPAIGFSPMANTPIL  410

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL++ EYL+GI +YESII+AYAS++     D++K EL
Sbjct  411  LHDHNEFLSQAEYLRGIEIYESIIQAYASYM---NKDDAKDEL  450



>ref|XP_006659580.1| PREDICTED: aminoacylase-1-like [Oryza brachyantha]
Length=454

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     ++ERR+ EEWAP+SRN+TFE   FK KAS+ DKFG+P
Sbjct  295  MNLQPSEAEIGLDIRLPPGVHIEAMERRLAEEWAPSSRNLTFE---FKQKASVLDKFGKP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN WW LLE+AVK A GKLGKPEIFPASTDARYFRE GLPA GFSPMANTPIL
Sbjct  352  AVTPADSSNSWWPLLEEAVKRAGGKLGKPEIFPASTDARYFREIGLPAFGFSPMANTPIL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESII+  A+  +   D+ES+AEL
Sbjct  412  LHDHNEFLSKDEYLKGIGIYESIIRTLATLKDSNVDEESRAEL  454



>ref|XP_009390654.1| PREDICTED: aminoacylase-1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 5/163 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G D+RVPP  D  +LE+RI EEWAP+SRNMT+E   FK K S+YD FG+P
Sbjct  312  MNLQPSEAEVGLDVRVPPNTDPKALEKRIAEEWAPSSRNMTYE---FKQKVSVYDMFGKP  368

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T+ D SN WW L E+AVK+ANGKL KPEIFPASTDAR+FRE G+PA GFSPMANTPIL
Sbjct  369  AITAADRSNSWWILFEEAVKEANGKLSKPEIFPASTDARFFRELGIPAFGFSPMANTPIL  428

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNK+EYLKG+ +YESIIKA+AS+ +    +ESKAEL
Sbjct  429  LHDHNEFLNKEEYLKGVTIYESIIKAFASYKDEV--EESKAEL  469



>gb|KHG17235.1| Aminoacylase-1 [Gossypium arboreum]
Length=451

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PPI D  SLE++I EEWAPASRNMTFE   FK K  ++D  GRP
Sbjct  292  MNLQPSEAEAGFDIRIPPIGDLESLEKQIAEEWAPASRNMTFE---FKAKGILHDDLGRP  348

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ DSSN WW LLE+A+K ANGK+GKPEIFPASTDA+ FR+ GLPAIGFSPMANTPIL
Sbjct  349  LVTATDSSNPWWTLLEEAIKKANGKIGKPEIFPASTDAQNFRKLGLPAIGFSPMANTPIL  408

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYL+GI VYESIIKAY S++      +S+ EL
Sbjct  409  LHDHNEFLNQAEYLRGIEVYESIIKAYTSYIPPGGHGDSRDEL  451



>ref|XP_010028870.1| PREDICTED: aminoacylase-1 [Eucalyptus grandis]
 gb|KCW55690.1| hypothetical protein EUGRSUZ_I01541 [Eucalyptus grandis]
Length=449

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RVPP AD  +L  RI EEWAP SRNMTFE   FK K S +D  G P
Sbjct  290  MNLQPSEAEAGFDVRVPPTADPKALMTRIAEEWAPISRNMTFE---FKQKVSPHDALGNP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ DSSN WWALLE+AVK ANGKLG PEIFPASTDARYFR+ GLPAIGFSPMANTP+L
Sbjct  347  ILTATDSSNPWWALLEEAVKKANGKLGSPEIFPASTDARYFRDLGLPAIGFSPMANTPVL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+K EYL+GI +YESIIKAYAS      D  SK EL
Sbjct  407  LHDHNEFLSKTEYLRGIEIYESIIKAYASHAGPPGDGGSKDEL  449



>ref|XP_004139978.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
 ref|XP_004154523.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
 gb|KGN46643.1| hypothetical protein Csa_6G117740 [Cucumis sativus]
Length=448

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 128/150 (85%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RVPP  +  SLERRI EEWAPASRNMTFE   FK K SIY+KFG+P
Sbjct  289  MNLQPSEAEAGFDVRVPPTTNPESLERRIAEEWAPASRNMTFE---FKQKESIYNKFGKP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            ALT+ D SN  W LLE+AV++ANGKL  PEIFPASTDARYFR  GLPAIGFSPM NTPIL
Sbjct  346  ALTAIDKSNPRWNLLEEAVRNANGKLANPEIFPASTDARYFRNLGLPAIGFSPMVNTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFLN+ EYLKGI VYESIIKAYAS+
Sbjct  406  LHDHNEFLNQAEYLKGIEVYESIIKAYASY  435



>gb|KJB79746.1| hypothetical protein B456_013G064900 [Gossypium raimondii]
Length=454

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 133/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  +  SLE+RI EEWAPASRNM+FE   FK K S  D +GRP
Sbjct  295  MNLQPSEAEAGFDIRIPPTVNAESLEKRIAEEWAPASRNMSFE---FKQKGSTQDFWGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WWALL +AVK ANGK+GKPEIFPA+TD+RYFR+ GL AIGFSPMANTP+L
Sbjct  352  LITATDRSNPWWALLVEAVKKANGKIGKPEIFPAATDSRYFRQQGLRAIGFSPMANTPVL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI VYESIIKAY S++   RD  S+ EL
Sbjct  412  LHDHNEFLNQAEYLKGIDVYESIIKAYTSYIPPGRDSLSRDEL  454



>ref|XP_010555164.1| PREDICTED: aminoacylase-1 isoform X1 [Tarenaya hassleriana]
Length=500

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  +LE+R+VEEWAPA+RNM+ ELGQFK +A   D  G+P
Sbjct  338  MNLQPSEAEAGFDIRVPPTADYEALEKRLVEEWAPAARNMSMELGQFKQRADPLDNSGKP  397

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AV++A GK GKPEIFPASTDARYFR  GLPAIGFSP++NTP L
Sbjct  398  LLTATDQSNPWWGLLENAVREAGGKTGKPEIFPASTDARYFRRAGLPAIGFSPISNTPSL  457

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+K EYLKGI VY SIIKAYAS+V    D  ++ EL
Sbjct  458  LHDHNEYLSKAEYLKGIDVYASIIKAYASYVPLETDVGARDEL  500



>gb|EMT30146.1| Aminoacylase-1 [Aegilops tauschii]
Length=313

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LE+R+ EEWAP+SRN+TFE   FK K S+ DK G+P
Sbjct  154  MNLQPSEAEVGIDIRIPPSVHTEALEKRLAEEWAPSSRNLTFE---FKQKGSVLDKLGKP  210

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  +SSN WW + E++VK A GKLGKPEIFPASTDARYFRE G+PA GFSPMANTPIL
Sbjct  211  AMTIANSSNPWWPVFEESVKRAGGKLGKPEIFPASTDARYFREVGIPAFGFSPMANTPIL  270

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESIIKA A+  +   D+ES+AEL
Sbjct  271  LHDHNEFLSKDEYLKGIGIYESIIKALATHKDDGIDEESRAEL  313



>gb|EAZ43309.1| hypothetical protein OsJ_27905 [Oryza sativa Japonica Group]
Length=347

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LE+R+ EEWAP+SRN+TFE   FK K S+ D FG+P
Sbjct  188  MNLQPSEAEIGLDIRLPPSVHTEALEKRLAEEWAPSSRNLTFE---FKQKTSVLDNFGKP  244

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN+WWAL E+AVK A GKLGKPEIFPASTDARYFR  G+PA GFSPM NTPIL
Sbjct  245  AVTPADSSNVWWALFEEAVKRAGGKLGKPEIFPASTDARYFRVLGIPAFGFSPMTNTPIL  304

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESII+  A+  +   D ES+AEL
Sbjct  305  LHDHNEFLSKDEYLKGIGIYESIIRTLATLKDSNVDYESRAEL  347



>gb|KJB31968.1| hypothetical protein B456_005G216200 [Gossypium raimondii]
Length=451

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 133/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PPI +  SLE++I EEWAPASRNMTFE   FK K  ++D  GRP
Sbjct  292  MNLQPSEAEAGFDIRIPPIGNVESLEKQIAEEWAPASRNMTFE---FKAKGILHDDLGRP  348

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ DSSN WW LLE+A+K ANGK+GKPEIFPASTDA+ FR+  LPAIGFSPMANTPIL
Sbjct  349  LVTATDSSNPWWTLLEEAIKKANGKIGKPEIFPASTDAQNFRKLSLPAIGFSPMANTPIL  408

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYL+GI VYESIIKAY S++      +S+ EL
Sbjct  409  LHDHNEFLNQAEYLRGIEVYESIIKAYTSYIPPGGHGDSRDEL  451



>dbj|BAK06600.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92000.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LE+R+ EEWAP SRN+TFE   FK K S+ DKFG+P
Sbjct  290  MNLQPSEAEVGIDIRIPPSVHTEALEKRLAEEWAPCSRNLTFE---FKQKGSVLDKFGKP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN WW + E++VK A GKLGKPEIFPASTDARYFRE G+PA GFSPMANTP+L
Sbjct  347  AMTIADSSNPWWPVFEESVKRAGGKLGKPEIFPASTDARYFREIGIPAFGFSPMANTPVL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESIIKA A+  +   D+ES+AEL
Sbjct  407  LHDHNEFLSKDEYLKGIGIYESIIKALATHKDDGIDEESRAEL  449



>ref|XP_004973884.1| PREDICTED: aminoacylase-1-like [Setaria italica]
Length=456

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP A   +LERR+VEEWAP+SRN+TFE   FK K S+ D FG+P
Sbjct  298  MNLQPSEAEVGLDIRIPPSAHVEALERRLVEEWAPSSRNLTFE---FKQKMSVLDNFGKP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DS+N WW LLE+AVK A GKLGKPEIFPASTDARYFR+ GLPA GFSPMANTPIL
Sbjct  355  AITPADSTNPWWLLLEEAVKSAGGKLGKPEIFPASTDARYFRQIGLPAFGFSPMANTPIL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL KDEYLKGI +YESII+A A+  +  +D++ +AEL
Sbjct  415  LHDHNEFLRKDEYLKGIGIYESIIRALATHKDGGKDND-RAEL  456



>ref|XP_002444759.1| hypothetical protein SORBIDRAFT_07g027550 [Sorghum bicolor]
 gb|EES14254.1| hypothetical protein SORBIDRAFT_07g027550 [Sorghum bicolor]
Length=457

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA+ G DIR+PP     +LERR++EEWAP+SRNMTFE   FK + S+ D FG+P
Sbjct  298  MNLQPSEAQVGLDIRMPPDVHTEALERRLIEEWAPSSRNMTFE---FKQRGSVLDNFGKP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A T  DSSN WW +L +AVK A GKLGKPE+FPASTDARYFR+ GLPA GFSPMANTP+L
Sbjct  355  AFTPADSSNPWWPVLGEAVKKAGGKLGKPEVFPASTDARYFRKIGLPAFGFSPMANTPVL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEY+KGI VYESII+  A+  +  RD+ES+AEL
Sbjct  415  LHDHNEFLSKDEYIKGIGVYESIIRELATHNDEARDEESRAEL  457



>ref|XP_010690574.1| PREDICTED: aminoacylase-1-like [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAG DIRVPP ADQ SLE+RI EEWAPA+RNMTFE   FK+K  + DKFG+P
Sbjct  290  MNLQPSEAEAGIDIRVPPTADQKSLEKRIAEEWAPAARNMTFE---FKLKVPVVDKFGKP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            ALT  D+SN WW LLEKA+  A GKLGK EI   +TDARYFR+ GLPAIGFSP+ANTP+L
Sbjct  347  ALTVADNSNPWWDLLEKAIHSAGGKLGKAEINIGTTDARYFRQRGLPAIGFSPIANTPLL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE LN+ EYLKGI +Y SII+AYAS+ + T    S+ EL
Sbjct  407  LHDHNELLNQREYLKGIDIYASIIRAYASYAKETETIASRDEL  449



>ref|XP_010690579.1| PREDICTED: aminoacylase-1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=453

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 126/161 (78%), Gaps = 3/161 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  DQ +  +RI +EWAPASRNMTFE   FK K S+ D  G P
Sbjct  292  MNLQPSEAEAGFDIRIPPTTDQEAFIKRIADEWAPASRNMTFE---FKQKQSVLDNSGNP  348

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            ALT   SSN WW LLE+AV+ A G+L  PEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  349  ALTVAGSSNPWWVLLEEAVRSAGGELENPEIFPASTDARYFRRQGLPAIGFSPMANTPIL  408

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKA  254
            LHDHNEFLN+ EYLKG+ +Y SIIKAYAS+ EH    ES +
Sbjct  409  LHDHNEFLNQAEYLKGVDIYVSIIKAYASYAEHAEAKESNS  449



>gb|EEC83866.1| hypothetical protein OsI_29850 [Oryza sativa Indica Group]
Length=457

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LE+R+ EEWAP+SRN+TFE   FK K S+ D FG+P
Sbjct  298  MNLQPSEAEIGLDIRLPPSVHTEALEKRLAEEWAPSSRNLTFE---FKQKTSVLDNFGKP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN+WWAL E+AVK A GKLGKPEIFPASTDARYFR  G+PA GFSPM NTPIL
Sbjct  355  AVTPADSSNVWWALFEEAVKRAGGKLGKPEIFPASTDARYFRVLGIPAFGFSPMTNTPIL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESII+  A+  +   D ES+AEL
Sbjct  415  LHDHNEFLSKDEYLKGIGIYESIIRTLATLKDSNVDYESRAEL  457



>dbj|BAD10058.1| putative aminoacylase [Oryza sativa Japonica Group]
Length=456

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LE+R+ EEWAP+SRN+TFE   FK K S+ D FG+P
Sbjct  297  MNLQPSEAEIGLDIRLPPSVHTEALEKRLAEEWAPSSRNLTFE---FKQKTSVLDNFGKP  353

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN+WWAL E+AVK A GKLGKPEIFPASTDARYFR  G+PA GFSPM NTPIL
Sbjct  354  AVTPADSSNVWWALFEEAVKRAGGKLGKPEIFPASTDARYFRVLGIPAFGFSPMTNTPIL  413

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESII+  A+  +   D ES+AEL
Sbjct  414  LHDHNEFLSKDEYLKGIGIYESIIRTLATLKDSNVDYESRAEL  456



>gb|EPS64004.1| hypothetical protein M569_10775, partial [Genlisea aurea]
Length=439

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 134/164 (82%), Gaps = 4/164 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD+ SLE+RI EEWAP+ RNMTFE   FK +   +DK G+P
Sbjct  279  MNLQPSEAEAGFDIRVPPTADKESLEKRIAEEWAPSVRNMTFE---FKQRPPTHDKHGKP  335

Query  556  ALTSPD-SSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPI  380
             +T+ D S+N WW LLE+AV+ A GKLGKPEIFPASTDARYFRE GLPAIGFSPMANTPI
Sbjct  336  LITAFDGSNNPWWRLLEEAVEVAGGKLGKPEIFPASTDARYFRELGLPAIGFSPMANTPI  395

Query  379  LLHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LLHDHNEFLN+DEYL+GI VY +I+KAYASFV       S+ EL
Sbjct  396  LLHDHNEFLNRDEYLRGIDVYAAIVKAYASFVADDSSSSSRDEL  439



>gb|KHG16687.1| Aminoacylase-1 [Gossypium arboreum]
Length=463

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLE+RI EEWAPASRNMTFE   FK KA+ +D  GRP
Sbjct  304  MNLQPSEAEAGFDIRVPPTADIESLEKRIEEEWAPASRNMTFE---FKQKATPHDDLGRP  360

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW L+E+A+K ANGK+GKPEI   +TDARY+R+ GL AIGF PM NTP L
Sbjct  361  LITATDGSNPWWTLIEEAIKKANGKIGKPEILTGATDARYYRQLGLTAIGFLPMTNTPFL  420

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNK EY KGI VYESIIKAY S++   RD  S+ EL
Sbjct  421  LHDHNEFLNKAEYFKGINVYESIIKAYTSYIPPGRDGVSRDEL  463



>gb|KHG04612.1| Aminoacylase-1 [Gossypium arboreum]
Length=454

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  +   LE+RI EEWAPASRNM+FE   FK K S  D  GRP
Sbjct  295  MNLQPSEAEAGFDIRIPPTVNAEFLEKRIAEEWAPASRNMSFE---FKQKGSTQDYRGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WWALL +A+K ANGK+GKPEIFPA+TD+RYFR+ GL AIGFSPMANTP+L
Sbjct  352  LITATDRSNPWWALLVEAIKKANGKIGKPEIFPAATDSRYFRQQGLRAIGFSPMANTPVL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LH+HNEFLN+ EYLKGI VYESIIKAY S++   RD   + EL
Sbjct  412  LHEHNEFLNQAEYLKGIDVYESIIKAYTSYIPPGRDSLLRDEL  454



>gb|EMS60311.1| Aminoacylase-1 [Triticum urartu]
Length=614

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LE+R+ EEWAP+SRN+TFE   FK K S+ DK G+P
Sbjct  393  MNLQPSEAEVGIDIRIPPSVHTEALEKRLAEEWAPSSRNLTFE---FKQKGSVLDKLGKP  449

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN WW + E++VK A GKLGKPEIFPASTDARYFRE G+PA GFSPMANTP+L
Sbjct  450  AMTIADSSNPWWPVFEESVKRAGGKLGKPEIFPASTDARYFREIGIPAFGFSPMANTPVL  509

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +YESIIKA A+  +   D+ES+AEL
Sbjct  510  LHDHNEFLSKDEYLKGIGIYESIIKALATHKDDGIDEESRAEL  552



>ref|XP_003572375.1| PREDICTED: aminoacylase-1 [Brachypodium distachyon]
Length=445

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 131/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAE G DIR+PP     +LERR+ EEWAP+SRN+TFE   FK K +++D FG+P
Sbjct  286  MNLQPSEAEIGIDIRMPPNVHIEALERRLAEEWAPSSRNLTFE---FKQKGTVFDNFGKP  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  DSSN WW + E+AVK A GKL KPEIFPASTDARYFR+ G+PA GFSPMANTPIL
Sbjct  343  AMTLADSSNPWWPVFEEAVKRAGGKLSKPEIFPASTDARYFRQIGIPAFGFSPMANTPIL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+KDEYLKGI +Y+SIIKA A+      D+ES+AEL
Sbjct  403  LHDHNEFLSKDEYLKGIEIYKSIIKALATHKGDEVDEESRAEL  445



>gb|KJB77468.1| hypothetical protein B456_012G138500 [Gossypium raimondii]
Length=453

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR PP AD  SLE+RI EEWAPASRNMTFE   FK K + +D  GRP
Sbjct  294  MNLQPSEAEAGFDIRAPPTADIESLEKRIEEEWAPASRNMTFE---FKQKVTPHDDLGRP  350

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW L+E+A+  ANGK+GKPEI   +TDARYFR+ GL AIGFSPM NTP L
Sbjct  351  LITATDDSNPWWTLIEEAINKANGKIGKPEILSGATDARYFRQLGLTAIGFSPMTNTPFL  410

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLNK EY KGI VYESII+AY S++   RD  S+ EL
Sbjct  411  LHDHNEFLNKAEYFKGINVYESIIEAYTSYIPPGRDGVSRDEL  453



>ref|XP_010555165.1| PREDICTED: aminoacylase-1 isoform X2 [Tarenaya hassleriana]
Length=497

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  +LE+R+VEEWAPA+RNM+ E   FK +A   D  G+P
Sbjct  338  MNLQPSEAEAGFDIRVPPTADYEALEKRLVEEWAPAARNMSME---FKQRADPLDNSGKP  394

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AV++A GK GKPEIFPASTDARYFR  GLPAIGFSP++NTP L
Sbjct  395  LLTATDQSNPWWGLLENAVREAGGKTGKPEIFPASTDARYFRRAGLPAIGFSPISNTPSL  454

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNE+L+K EYLKGI VY SIIKAYAS+V    D  ++ EL
Sbjct  455  LHDHNEYLSKAEYLKGIDVYASIIKAYASYVPLETDVGARDEL  497



>ref|XP_006411610.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
 gb|ESQ53063.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
Length=444

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FELGQFK K S     G P
Sbjct  290  MNLQPSEAEAGFDIRVPPNVDSEALERRLVEEWAPAARNMSFELGQFKQKLS-----GEP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  345  LLTAADDSNPWWRLLETAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYASF
Sbjct  405  LHDHNEYLGKAEYLKGINVYVSIIKAYASF  434



>ref|XP_010690575.1| PREDICTED: aminoacylase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP A+  SLE+RI EEWAPASRNMTFE  Q   K  + DKFG+P
Sbjct  293  MNLQPSEAEAGFDIRVPPTANLESLEKRIAEEWAPASRNMTFEFIQ---KDPLLDKFGKP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  DSSN WW L E+A++ A+GK+GK EI   STDA +FR+ GLPAIGFS +ANTP  
Sbjct  350  ILTVADSSNPWWFLFEEAIRSADGKVGKAEILLGSTDASFFRQRGLPAIGFSAIANTPER  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            +HDHNEFLN++EYLKG+ +YESIIKAYAS+  HT  + SK EL
Sbjct  410  VHDHNEFLNQEEYLKGVDIYESIIKAYASYAAHTEAEASKYEL  452



>ref|XP_006830441.1| hypothetical protein AMTR_s00351p00009890 [Amborella trichopoda]
 gb|ERM97857.1| hypothetical protein AMTR_s00351p00009890 [Amborella trichopoda]
Length=459

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 124/158 (78%), Gaps = 3/158 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIRVPP AD TSLERRI EEWAPASRNMTF   QFK K    DKFG P
Sbjct  305  MNVQPSEAEAGFDIRVPPHADSTSLERRIEEEWAPASRNMTF---QFKDKFPTVDKFGNP  361

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A T+ D+SN WW L E+AVK A+G L +PEIF   +DARYFRE  LP I FSP++NTPIL
Sbjct  362  AFTATDASNSWWTLFEEAVKKAHGNLAEPEIFLGGSDARYFRERNLPVIAFSPISNTPIL  421

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDE  263
             H HNEFLNK+EYLKGI+VYESIIK +ASF E  ++ E
Sbjct  422  HHHHNEFLNKEEYLKGIKVYESIIKTFASFDEPIKEGE  459



>ref|XP_010431747.1| PREDICTED: aminoacylase-1-like isoform X1 [Camelina sativa]
Length=442

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FELGQFK K +     G+ 
Sbjct  288  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFELGQFKQKLT-----GKK  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  343  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  403  LHDHNEYLGKTEYLKGIDVYVSIIKAYASY  432



>ref|NP_849516.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AEE86895.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=433

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FELGQFK K +     G+ 
Sbjct  279  MNLQPSEAEAGFDIRVPPSVDAEALERRLVEEWAPAARNMSFELGQFKQKLT-----GKQ  333

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  334  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  393

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  394  LHDHNEYLGKAEYLKGIEVYVSIIKAYASY  423



>gb|KJB77466.1| hypothetical protein B456_012G138500 [Gossypium raimondii]
Length=446

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 122/159 (77%), Gaps = 3/159 (2%)
 Frame = -3

Query  724  PSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPALTS  545
            PSEAEAGFDIR PP AD  SLE+RI EEWAPASRNMTFE   FK K + +D  GRP +T+
Sbjct  291  PSEAEAGFDIRAPPTADIESLEKRIEEEWAPASRNMTFE---FKQKVTPHDDLGRPLITA  347

Query  544  PDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILLHDH  365
             D SN WW L+E+A+  ANGK+GKPEI   +TDARYFR+ GL AIGFSPM NTP LLHDH
Sbjct  348  TDDSNPWWTLIEEAINKANGKIGKPEILSGATDARYFRQLGLTAIGFSPMTNTPFLLHDH  407

Query  364  NEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            NEFLNK EY KGI VYESII+AY S++   RD  S+ EL
Sbjct  408  NEFLNKAEYFKGINVYESIIEAYTSYIPPGRDGVSRDEL  446



>ref|XP_010436913.1| PREDICTED: aminoacylase-1-like isoform X1 [Camelina sativa]
Length=442

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FELGQFK K +     G+ 
Sbjct  288  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFELGQFKQKLT-----GKQ  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  343  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI +Y SIIKAYAS+
Sbjct  403  LHDHNEYLGKAEYLKGIDLYVSIIKAYASY  432



>gb|KEH15979.1| M20/M25/M40 family peptidase, partial [Medicago truncatula]
Length=177

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP AD  SLERRI EEWAP+ RNM+F LGQFK K S+ D  G+P
Sbjct  52   MNLQPSEAEAGFDIRVPPTADAESLERRIAEEWAPSCRNMSFRLGQFKQKLSVLDASGKP  111

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  DSSN WWALLE AV+++ GKLGKPEIFPASTDARYFR  GLPAIGFSPMANTPIL
Sbjct  112  VITKTDSSNPWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPIL  171

Query  376  LHDHNE  359
            LHDHNE
Sbjct  172  LHDHNE  177



>ref|XP_010690577.1| PREDICTED: aminoacylase-1-like [Beta vulgaris subsp. vulgaris]
Length=452

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 125/163 (77%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG DIRVPP ADQ +LERRI EEWAPASRNMTFE   FK K    DKFG+P
Sbjct  293  MNMQPSEAEAGIDIRVPPTADQEALERRIAEEWAPASRNMTFE---FKDKFPTLDKFGKP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            A+T  +SSN WW LLE+AV+ A GKL KPEIF  +TDA ++R  GLPAIGFS +ANTP L
Sbjct  350  AITVTNSSNPWWVLLEEAVQGAGGKLEKPEIFRGATDASFYRIRGLPAIGFSAIANTPSL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
             HDHNEFLN+ EY+KGI +Y SIIKA+AS+ +      SK EL
Sbjct  410  AHDHNEFLNQQEYIKGIDIYASIIKAFASYAKQPEATASKDEL  452



>ref|XP_006411609.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
 gb|ESQ53062.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
Length=441

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K S     G P
Sbjct  290  MNLQPSEAEAGFDIRVPPNVDSEALERRLVEEWAPAARNMSFE---FKQKLS-----GEP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  342  LLTAADDSNPWWRLLETAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  401

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYASF
Sbjct  402  LHDHNEYLGKAEYLKGINVYVSIIKAYASF  431



>dbj|BAH57228.1| AT4G38220 [Arabidopsis thaliana]
Length=348

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K +     G+ 
Sbjct  168  MNLQPSEAEAGFDIRVPPSVDAEALERRLVEEWAPAARNMSFE---FKQKLT-----GKQ  219

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  220  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  279

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  280  LHDHNEYLGKAEYLKGIEVYVSIIKAYASY  309



>ref|XP_010436185.1| PREDICTED: uncharacterized protein LOC104719897 [Camelina sativa]
Length=337

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FE   FK K +     G+ 
Sbjct  186  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFE---FKQKLT-----GKK  237

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  238  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  297

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  298  LHDHNEYLGKAEYLKGIDVYVSIIKAYASY  327



>ref|XP_009125879.1| PREDICTED: aminoacylase-1B-like isoform X1 [Brassica rapa]
Length=439

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 119/154 (77%), Gaps = 9/154 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFE----LGQFKVKASIYDK  569
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA+RNM+ E    L QFK K S    
Sbjct  281  MNLQPSEAEAGFDIRIPPSVDSEALERRLVEEWAPAARNMSVECCQCLRQFKQKHS----  336

Query  568  FGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMAN  389
             G P LT+ D SN WW LLE AVK+A GK  KPEIFPASTDARYFR  G+PA GFSP++N
Sbjct  337  -GEPLLTTADDSNPWWRLLENAVKEAGGKTSKPEIFPASTDARYFRMAGVPAFGFSPISN  395

Query  388  TPILLHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            TP LLHDHNE+L + EYLKGI VY SIIKAYAS+
Sbjct  396  TPSLLHDHNEYLGRAEYLKGIDVYVSIIKAYASY  429



>ref|XP_010431748.1| PREDICTED: aminoacylase-1-like isoform X2 [Camelina sativa]
Length=439

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FE   FK K +     G+ 
Sbjct  288  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFE---FKQKLT-----GKK  339

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  340  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  399

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  400  LHDHNEYLGKTEYLKGIDVYVSIIKAYASY  429



>ref|XP_010431749.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=435

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FE   FK K +     G+ 
Sbjct  284  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFE---FKQKLT-----GKK  335

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  336  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  395

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  396  LHDHNEYLGKTEYLKGIDVYVSIIKAYASY  425



>ref|NP_568036.2| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AAL75900.1| AT4g38220/F20D10_340 [Arabidopsis thaliana]
 gb|AEE86894.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=430

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K +     G+ 
Sbjct  279  MNLQPSEAEAGFDIRVPPSVDAEALERRLVEEWAPAARNMSFE---FKQKLT-----GKQ  330

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  331  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  390

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  391  LHDHNEYLGKAEYLKGIEVYVSIIKAYASY  420



>ref|XP_006284995.1| hypothetical protein CARUB_v10006302mg [Capsella rubella]
 gb|EOA17893.1| hypothetical protein CARUB_v10006302mg [Capsella rubella]
Length=436

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 118/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D   LERR+VEEWAPASRNM+FE   FK K +     G+ 
Sbjct  285  MNLQPSEAEAGFDIRVPPSVDAEVLERRLVEEWAPASRNMSFE---FKQKVT-----GKQ  336

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  337  FLTAADDSNPWWGLLETAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  396

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  397  LHDHNEYLGKAEYLKGIDVYVSIIKAYASY  426



>ref|XP_010446323.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=436

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FE   FK K +     G+ 
Sbjct  285  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFE---FKQKLT-----GKK  336

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  337  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  396

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  397  LHDHNEYLGKAEYLKGIDVYVSIIKAYASY  426



>emb|CDY59101.1| BnaCnng34250D [Brassica napus]
Length=447

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 117/150 (78%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K S     G P
Sbjct  296  MNLQPSEAEAGFDIRVPPNVDSEALERRLVEEWAPAARNMSFE---FKRKHS-----GDP  347

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW L E AVK+A G+  KPEIFPASTDARYFR  G+PA GFSP++NTP L
Sbjct  348  LLTAADDSNPWWRLFENAVKEAGGRTSKPEIFPASTDARYFRNAGVPAFGFSPISNTPSL  407

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  408  LHDHNEYLGKAEYLKGIDVYVSIIKAYASY  437



>ref|XP_009132387.1| PREDICTED: aminoacylase-1B-like isoform X2 [Brassica rapa]
 emb|CDY61892.1| BnaAnng17940D [Brassica napus]
Length=432

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 117/150 (78%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA+RNM+ E   FK K S     G P
Sbjct  281  MNLQPSEAEAGFDIRIPPSVDSEALERRLVEEWAPAARNMSVE---FKQKHS-----GEP  332

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A GK  KPEIFPASTDARYFR  G+PA GFSP++NTP L
Sbjct  333  LLTTADDSNPWWRLLENAVKEAGGKTSKPEIFPASTDARYFRMAGVPAFGFSPISNTPSL  392

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L + EYLKGI VY SIIKAYAS+
Sbjct  393  LHDHNEYLGRAEYLKGIDVYVSIIKAYASY  422



>gb|KFK30432.1| hypothetical protein AALP_AA7G260300 [Arabis alpina]
Length=437

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 7/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA RNM+FE  QFK K S     G+ 
Sbjct  285  MNLQPSEAEAGFDIRIPPNYDSEALERRLVEEWAPAGRNMSFE--QFKQKFS-----GKQ  337

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW+LLE AVK+A G+  KPEIFPASTDARYFR+ GL A GFSP++NTP L
Sbjct  338  VVTATDDSNPWWSLLENAVKEAGGRTSKPEIFPASTDARYFRQAGLLAFGFSPISNTPGL  397

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L KD YLKGI VY SIIKAYAS+
Sbjct  398  LHDHNEYLGKDVYLKGIDVYVSIIKAYASY  427



>ref|XP_010436914.1| PREDICTED: aminoacylase-1-like isoform X2 [Camelina sativa]
Length=439

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPASRNM+FE   FK K +     G+ 
Sbjct  288  MNLQPSEAEAGFDIRIPPSVDAEALERRLVEEWAPASRNMSFE---FKQKLT-----GKQ  339

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  340  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  399

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI +Y SIIKAYAS+
Sbjct  400  LHDHNEYLGKAEYLKGIDLYVSIIKAYASY  429



>ref|XP_009101955.1| PREDICTED: aminoacylase-1B [Brassica rapa]
Length=433

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 117/150 (78%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA+RNM+FE   FK K S     G P
Sbjct  282  MNLQPSEAEAGFDIRIPPNVDSEALERRLVEEWAPAARNMSFE---FKRKHS-----GDP  333

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN+WW L   AVK+A G+  KPE+FPASTDARYFR  G+PA GFSP++NTP L
Sbjct  334  LLTAADDSNLWWRLFGNAVKEAGGRTSKPEVFPASTDARYFRMAGVPAFGFSPISNTPSL  393

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  394  LHDHNEYLGKAEYLKGIDVYVSIIKAYASY  423



>emb|CDY54793.1| BnaA06g40880D [Brassica napus]
Length=433

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 117/150 (78%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA+RNM+FE   FK K S     G P
Sbjct  282  MNLQPSEAEAGFDIRIPPNVDSEALERRLVEEWAPAARNMSFE---FKRKHS-----GDP  333

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN+WW L   AVK+A G+  KPE+FPASTDARYFR  G+PA GFSP++NTP L
Sbjct  334  LLTAADVSNLWWRLFGNAVKEAGGRTSKPEVFPASTDARYFRMAGVPAFGFSPISNTPSL  393

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L K EYLKGI VY SIIKAYAS+
Sbjct  394  LHDHNEYLGKAEYLKGIDVYVSIIKAYASY  423



>gb|KFK30433.1| hypothetical protein AALP_AA7G260300 [Arabis alpina]
Length=436

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 118/150 (79%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA RNM+FE   FK K S     G+ 
Sbjct  285  MNLQPSEAEAGFDIRIPPNYDSEALERRLVEEWAPAGRNMSFE---FKQKFS-----GKQ  336

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW+LLE AVK+A G+  KPEIFPASTDARYFR+ GL A GFSP++NTP L
Sbjct  337  VVTATDDSNPWWSLLENAVKEAGGRTSKPEIFPASTDARYFRQAGLLAFGFSPISNTPGL  396

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L KD YLKGI VY SIIKAYAS+
Sbjct  397  LHDHNEYLGKDVYLKGIDVYVSIIKAYASY  426



>ref|XP_002965773.1| hypothetical protein SELMODRAFT_406809 [Selaginella moellendorffii]
 gb|EFJ33193.1| hypothetical protein SELMODRAFT_406809 [Selaginella moellendorffii]
Length=453

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFE--LGQFKVKASIYDKFG  563
            MNLQPSEAEAGFD+R+PP AD  ++E+RI EEWAPASRNMT+E  L QFK K  +  + G
Sbjct  289  MNLQPSEAEAGFDVRMPPFADPVAMEKRIAEEWAPASRNMTYEFRLVQFKQKTPVKRRDG  348

Query  562  RPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTP  383
                T  D SN WW++ ++A+  +N +L KPE+FPA+TDARYFR+ G+PA GFSPMANTP
Sbjct  349  SLNYTPVDDSNPWWSVFKEAISKSNQRLAKPEVFPAATDARYFRDLGIPAFGFSPMANTP  408

Query  382  ILLHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            ILLHDHNEFL+  EY KGI VY+ ++ + ASFV    D  S +EL
Sbjct  409  ILLHDHNEFLSSREYFKGIEVYQILLNSLASFVGSKDDTTSHSEL  453



>ref|XP_001760477.1| predicted protein [Physcomitrella patens]
 gb|EDQ74868.1| predicted protein [Physcomitrella patens]
Length=443

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 119/163 (73%), Gaps = 6/163 (4%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+R+PP+ D   L+RRI EEWAPASRN T+    F  K    DK G P
Sbjct  287  MNLQPSEAEAGFDVRIPPLGDIEDLQRRIDEEWAPASRNFTY---SFAEKVFPRDKHGNP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW LL+ AV  A GKL K EIFPA+TD+RY R+ G+ A GFSPMANTP+L
Sbjct  344  TVTAADDSNPWWGLLKDAVAKAGGKLNKVEIFPAATDSRYVRQEGIVAFGFSPMANTPVL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN +EY KGI VYE IIKAY+S+     D  S+AEL
Sbjct  404  LHDHNEFLNAEEYTKGIHVYEEIIKAYSSYAP---DAASEAEL  443



>ref|XP_002984445.1| hypothetical protein SELMODRAFT_120255 [Selaginella moellendorffii]
 gb|EFJ14495.1| hypothetical protein SELMODRAFT_120255 [Selaginella moellendorffii]
Length=448

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+R+PP AD  ++E+RI EEWAPASRNMT+E   FK K  +  + G  
Sbjct  289  MNLQPSEAEAGFDVRMPPFADPVAMEKRIAEEWAPASRNMTYE---FKQKTPVKRRDGSL  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T  D SN WW++ ++A+  +N +L KPEIFPASTDARYFR+ G+PA GFSPMANTPIL
Sbjct  346  NYTPVDDSNPWWSVFKEAISKSNQRLAKPEIFPASTDARYFRDLGIPAFGFSPMANTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFL+  EY KGI VY+ ++ + ASFV    D  S +EL
Sbjct  406  LHDHNEFLSSREYFKGIEVYQILLNSLASFVGSKDDTTSHSEL  448



>emb|CDY71051.1| BnaCnng71090D [Brassica napus]
Length=432

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 117/150 (78%), Gaps = 8/150 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP  D  +LERR+VEEWAPA+RNM+ E   FK K S       P
Sbjct  281  MNLQPSEAEAGFDIRIPPSVDSEALERRLVEEWAPAARNMSVE---FKQKHS-----EEP  332

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LL+ AVK+A GK  KPEIFPASTDARYFR  G+PA GFSP++NTP L
Sbjct  333  LLTAADDSNPWWRLLKNAVKEAGGKTSKPEIFPASTDARYFRMAGVPAFGFSPISNTPSL  392

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYLKGI VY SIIKAYAS+
Sbjct  393  LHDHNEYLSRAEYLKGIDVYVSIIKAYASY  422



>gb|ADE76225.1| unknown [Picea sitchensis]
Length=446

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEA AGFDIR+PP AD   + +RI EEWAPA+RNMT+++ +   K  I+D  GRP
Sbjct  287  MNLQPSEAAAGFDIRLPPTADPQLVRKRISEEWAPAARNMTYQILE---KGPIWDTQGRP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  + SN WW L E+A+    GKL KPEI  ++TDAR+ RE G+PA GFSPMANTPIL
Sbjct  344  LLTVANDSNPWWLLFEQAIMATGGKLRKPEILASTTDARFVREQGIPAFGFSPMANTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            LHDHNEFLN+ EYLKGI+VY +II++ +SF+E      SK EL
Sbjct  404  LHDHNEFLNEGEYLKGIKVYAAIIESLSSFIESDHSIASKDEL  446



>emb|CDY65765.1| BnaA03g56420D [Brassica napus]
Length=387

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP AD  +LE+R+VEEWAP +RNM+++L +F    S     G+ 
Sbjct  240  MNLQPSEAEAGFDIRIPPTADLVALEKRLVEEWAPVARNMSYKLWRFDQNLS-----GKQ  294

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  D+SN WW LL+ AV +A GK  +PEIFPASTD+RYFR+ GLPA GFSP++NTP L
Sbjct  295  LLTGNDNSNPWWVLLQNAVNEAGGKTSEPEIFPASTDSRYFRKAGLPAFGFSPISNTPSL  354

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYLKGI +Y SIIKA+ S+
Sbjct  355  LHDHNEYLSQAEYLKGIDMYVSIIKAFTSY  384



>emb|CBI19042.3| unnamed protein product [Vitis vinifera]
Length=199

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   ++ RI EEWAPA RNMT+++ +   K  I D  GRP
Sbjct  48   MNMQPSEAEAGFDLRMPPTADPDLVKIRIAEEWAPAIRNMTYQIIE---KGPIRDYMGRP  104

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++A+ +A GKL KPEI  ++TDARY R+ G+P +GFSPM NTPIL
Sbjct  105  LMTLTNDSNPWWSIFKQAITEAGGKLAKPEILASTTDARYMRQMGIPTLGFSPMTNTPIL  164

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFV  284
            LHDHNEFL    YL+GI+VYES+I + +SFV
Sbjct  165  LHDHNEFLKDTIYLRGIKVYESVISSLSSFV  195



>emb|CDX79602.1| BnaC03g19380D [Brassica napus]
Length=410

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDI +PP AD  +LE+R+VEEWAP SRNM+++L +F    S     G+ 
Sbjct  263  MNLQPSEAEAGFDICIPPTADLVALEKRLVEEWAPVSRNMSYKLWRFDQNLS-----GKQ  317

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  D+SN WW LL+ AV +A GK  +PEIFPASTD+RYFR+ GLPA GFSP++NTP L
Sbjct  318  LLTGNDNSNPWWGLLQNAVNEAGGKTSEPEIFPASTDSRYFRKAGLPAFGFSPISNTPSL  377

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYL+GI +Y SIIKAY S+
Sbjct  378  LHDHNEYLSQAEYLRGIDMYVSIIKAYTSY  407



>ref|XP_006410701.1| hypothetical protein EUTSA_v10016717mg [Eutrema salsugineum]
 gb|ESQ52154.1| hypothetical protein EUTSA_v10016717mg [Eutrema salsugineum]
Length=420

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP AD  +LERR+VEEWAP++RNM+FEL +F    S     G+ 
Sbjct  272  MNLQPSEAEAGFDIRIPPTADLEALERRVVEEWAPSARNMSFELWRFDQNPS-----GKQ  326

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             L + D SN W  LLE AV  A G+  +PEIFPASTDA+YFR+ GLPAIGFSP++NTP L
Sbjct  327  LLAAKDDSNPWTGLLENAVNAAGGQTSEPEIFPASTDAKYFRKAGLPAIGFSPISNTPSL  386

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYLKGI +Y SII+AY S+
Sbjct  387  LHDHNEYLSQSEYLKGIDMYVSIIQAYTSY  416



>ref|XP_007043101.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOX98932.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
Length=434

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 5/126 (4%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIR+PP A+  SLE+RIVEEWAPASRNMTFE      K +++D  GRP
Sbjct  295  MNLQPSEAEAGFDIRIPPTANAESLEKRIVEEWAPASRNMTFEQ-----KGTLHDNLGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T+ D SN WW LLE+A+K ANGK+GKPEIFPASTDARYFR+ GLPAIGFSPMANTP+L
Sbjct  350  LQTAIDKSNPWWTLLEEAIKKANGKIGKPEIFPASTDARYFRQLGLPAIGFSPMANTPLL  409

Query  376  LHDHNE  359
            LHDHNE
Sbjct  410  LHDHNE  415



>ref|XP_010505049.1| PREDICTED: aminoacylase-1-like isoform X1 [Camelina sativa]
Length=420

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RVPP+ D  +LE+R+VEEWAP SRNM+FEL +F       D   + 
Sbjct  272  MNLQPSEAEAGFDMRVPPVVDSVALEKRLVEEWAPISRNMSFELWRFN-----QDIEEKH  326

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN W  LL  AVK+A GK  +PEIFPASTD+RYFR  GLPAIGFSP++NTP L
Sbjct  327  LVTAKDDSNPWLELLGNAVKEAGGKTSEPEIFPASTDSRYFRRAGLPAIGFSPISNTPSL  386

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYLKGI +Y SI+KAY S+
Sbjct  387  LHDHNEYLSQYEYLKGIDMYVSILKAYTSY  416



>emb|CDP15803.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD  ++ RRI EEWAP+ RNM+FE+ +   K  + D  GRP
Sbjct  301  MNVQPSEAEAGFDLRLPPTADPDAVRRRIAEEWAPSWRNMSFEITE---KGPLRDHKGRP  357

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  + SN WW++ ++AV  A GKL KPEI P++TDAR+ R+ G+P IGFSPM NTPIL
Sbjct  358  LLTPTNDSNSWWSVFKQAVTSAGGKLAKPEILPSTTDARFMRQLGIPTIGFSPMRNTPIL  417

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    YL+GI+VYES+IK+ +SF +
Sbjct  418  LHDHNEFLKDSVYLEGIKVYESVIKSLSSFAD  449



>gb|KDO80708.1| hypothetical protein CISIN_1g013641mg [Citrus sinensis]
Length=439

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD R+PP  D   + RRI EEWAPA RNM++E+ +   K  I D  GRP
Sbjct  288  MNMQPSEAEAGFDARLPPTVDPDLIRRRIAEEWAPAIRNMSYEIIE---KGPIRDYKGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN WW++ ++AV  A GKLGKPEI  ++TDARY R+ G+P +GFSPMANTPIL
Sbjct  345  LMTLTDDSNPWWSVFKRAVTSAGGKLGKPEILASTTDARYMRQLGIPVLGFSPMANTPIL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +LKG+ VYES+I + +SFVE
Sbjct  405  LHDHNEFLKDTVFLKGVEVYESVISSLSSFVE  436



>ref|XP_006472753.1| PREDICTED: aminoacylase-1-like [Citrus sinensis]
Length=475

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD R+PP  D   + RRI EEWAPA RNM++E+ +   K  I D  GRP
Sbjct  324  MNMQPSEAEAGFDARLPPTVDPDLIRRRIAEEWAPAIRNMSYEIIE---KGPIRDYKGRP  380

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN WW++ ++AV  A GKLGKPEI  ++TDARY R+ G+P +GFSPMANTPIL
Sbjct  381  LMTLTDDSNPWWSVFKRAVTSAGGKLGKPEILASTTDARYMRQLGIPVLGFSPMANTPIL  440

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +LKG+ VYES+I + +SFVE
Sbjct  441  LHDHNEFLKDTVFLKGVEVYESVISSLSSFVE  472



>ref|XP_010063988.1| PREDICTED: aminoacylase-1 isoform X2 [Eucalyptus grandis]
 gb|KCW71276.1| hypothetical protein EUGRSUZ_F04363 [Eucalyptus grandis]
Length=450

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 3/155 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPS+AEAGFD+R+PP AD   +++RI EEWAPA RNMT+++ Q      I D  GRP
Sbjct  295  MNVQPSDAEAGFDVRLPPTADPDLVKKRIAEEWAPAIRNMTYQITQ---TGPIRDYEGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN+WW+   +AV  A GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  352  LMTRTDDSNLWWSAFNQAVAAAGGKLAKPEILSSTTDARFIRQLGIPALGFSPMINTPIL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTR  272
            LHDHNEFL    +L+GI+VYESII + +SFVE ++
Sbjct  412  LHDHNEFLEDKVFLRGIKVYESIISSLSSFVEESQ  446



>ref|XP_011027701.1| PREDICTED: aminoacylase-1-like [Populus euphratica]
Length=275

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   +++RI EEWAPA RNMT+E+ +   K  + D  GRP
Sbjct  123  MNMQPSEAEAGFDLRLPPTADPDLVKKRIAEEWAPAVRNMTYEIIE---KGPLRDYMGRP  179

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW++ ++A+  A GKL KPEI  ++TDAR+ R+ G+P  GFSPM NTPIL
Sbjct  180  LLTATDDSNPWWSVFKQAIAAAGGKLAKPEILSSTTDARFMRQMGIPTFGFSPMTNTPIL  239

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +LKGI VYE II   +SF E
Sbjct  240  LHDHNEFLKDTIFLKGIEVYEHIIHELSSFEE  271



>ref|XP_010509616.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=420

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RVPP+ D  +LE+R+VEEWAP SRNM+F+L +F       D   + 
Sbjct  272  MNLQPSEAEAGFDMRVPPVVDPVALEKRLVEEWAPVSRNMSFDLWRFN-----QDIEEKH  326

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D +N W  LL  AVK+A GK  +PEIFPASTD+RYFR  GLPAIGFSP++NTP L
Sbjct  327  LVTAKDDANPWLELLGNAVKEAGGKTSEPEIFPASTDSRYFRRAGLPAIGFSPISNTPSL  386

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYLKGI +Y SI+K Y S+
Sbjct  387  LHDHNEYLSQYEYLKGIDMYVSILKVYTSY  416



>gb|EMS66870.1| Aminoacylase-1 [Triticum urartu]
Length=179

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   +ERRI EEWAPA +N+T++L +   K  + D  GRP
Sbjct  31   MNMQPSEAEVGFDLRLPPTEDIEQIERRIKEEWAPAHKNLTYQLMK---KGPVRDVTGRP  87

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  + SN WW++ E+A+  + GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  88   LLTPANESNPWWSVFEQAIISSGGKLAKPEILSSTTDARFVRQMGVPALGFSPMINTPIL  147

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L GI VYE +I+A +SF
Sbjct  148  LHDHNEFLEDKVFLGGIEVYEHLIRALSSF  177



>ref|XP_010505050.1| PREDICTED: aminoacylase-1-like isoform X2 [Camelina sativa]
Length=414

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 11/150 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RVPP+ D  +LE+R+VEEWAP SRNM+FE           D   + 
Sbjct  272  MNLQPSEAEAGFDMRVPPVVDSVALEKRLVEEWAPISRNMSFE-----------DIEEKH  320

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN W  LL  AVK+A GK  +PEIFPASTD+RYFR  GLPAIGFSP++NTP L
Sbjct  321  LVTAKDDSNPWLELLGNAVKEAGGKTSEPEIFPASTDSRYFRRAGLPAIGFSPISNTPSL  380

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE+L++ EYLKGI +Y SI+KAY S+
Sbjct  381  LHDHNEYLSQYEYLKGIDMYVSILKAYTSY  410



>ref|XP_006393708.1| hypothetical protein EUTSA_v10012140mg [Eutrema salsugineum]
 gb|ESQ30994.1| hypothetical protein EUTSA_v10012140mg [Eutrema salsugineum]
Length=248

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 9/153 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTF---ELGQFKVKASIYDKF  566
            MN+QPSEAE G+D+R+PP+AD  +L++RI EEWAPA RNMT+   ELG+FK      D  
Sbjct  94   MNMQPSEAEVGYDLRLPPMADPDALKKRIAEEWAPAIRNMTYTISELGKFK------DHL  147

Query  565  GRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANT  386
            G P +T  ++SN WW++  +AV++  GKL KPEI  ++TDARY R  G+P +GFSPM NT
Sbjct  148  GSPIMTPTNASNPWWSIFRQAVEETGGKLAKPEILLSTTDARYIRALGIPLLGFSPMINT  207

Query  385  PILLHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            PIL+HDHNEFL    ++KGI VYES+I A +SF
Sbjct  208  PILVHDHNEFLKDTVFMKGIEVYESVIGALSSF  240



>ref|XP_002285843.1| PREDICTED: aminoacylase-1 [Vitis vinifera]
 ref|XP_003634461.1| PREDICTED: aminoacylase-1 [Vitis vinifera]
 ref|XP_010664226.1| PREDICTED: aminoacylase-1 [Vitis vinifera]
Length=450

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   ++ RI EEWAPA RNMT+++ +   K  I D  GRP
Sbjct  299  MNMQPSEAEAGFDLRMPPTADPDLVKIRIAEEWAPAIRNMTYQIIE---KGPIRDYMGRP  355

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++A+ +A GKL KPEI  ++TDARY R+ G+P +GFSPM NTPIL
Sbjct  356  LMTLTNDSNPWWSIFKQAITEAGGKLAKPEILASTTDARYMRQMGIPTLGFSPMTNTPIL  415

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFV  284
            LHDHNEFL    YL+GI+VYES+I + +SFV
Sbjct  416  LHDHNEFLKDTIYLRGIKVYESVISSLSSFV  446



>ref|XP_006386375.1| hypothetical protein POPTR_0002s08590g [Populus trichocarpa]
 gb|ERP64172.1| hypothetical protein POPTR_0002s08590g [Populus trichocarpa]
Length=442

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   +++RI EEWAPA RNMT+E+ +   K  + D  GRP
Sbjct  290  MNMQPSEAEAGFDLRLPPTADPDLVKKRIAEEWAPAVRNMTYEIIE---KGPLRDYMGRP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW++ ++A+  A GKL KPEI  ++TDAR+ R+ G+PA GFSPM NTPIL
Sbjct  347  LMTATDDSNPWWSVFKQAIAAAGGKLAKPEILSSTTDARFMRQLGIPAFGFSPMTNTPIL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +LKGI VYE II A +SF E
Sbjct  407  LHDHNEFLKDTIFLKGIEVYEHIIHALSSFEE  438



>gb|EYU23899.1| hypothetical protein MIMGU_mgv1a005984mg [Erythranthe guttata]
Length=462

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 117/162 (72%), Gaps = 4/162 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSE EAGFD+R+PP      ++RRI +EWAP+ RNM++E+ +   K  I D  GRP
Sbjct  294  MNMQPSEVEAGFDVRLPPTVHPDLMKRRIEDEWAPSWRNMSYEITE---KGPILDYMGRP  350

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW++  + V++  GKLGKPEI P++TDAR+ RE G+P +GFSPM NTPIL
Sbjct  351  LITAIDDSNPWWSVFRQGVEEGGGKLGKPEILPSTTDARFMREKGIPTLGFSPMKNTPIL  410

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAE  251
            LHDHNEFL    YL+GI+VYE II++ +SF +    DE K E
Sbjct  411  LHDHNEFLETSVYLEGIKVYEHIIRSLSSF-DGLLKDEIKVE  451



>ref|XP_009123186.1| PREDICTED: aminoacylase-1-like [Brassica rapa]
 emb|CDY14997.1| BnaA10g08590D [Brassica napus]
Length=437

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   +++RI EEWAP+ RNMT+ +   K K  + D FGRP
Sbjct  283  MNMQPSEAEAGYDLRLPPMADPDVMKKRIAEEWAPSIRNMTYTI---KEKGKLRDHFGRP  339

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + SN WW++ ++AV+   GKL KPEI  ++TDARY R  G+P +GFSPM NTPIL
Sbjct  340  IMTATNGSNPWWSVFKQAVEATGGKLAKPEILASTTDARYIRTLGIPLVGFSPMINTPIL  399

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +LKGI VYES+I A +SF
Sbjct  400  LHDHNEFLKDTVFLKGIEVYESVISALSSF  429



>ref|XP_004138118.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
 gb|KGN63599.1| hypothetical protein Csa_1G005600 [Cucumis sativus]
Length=451

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD  ++ RRI EEWAPA RNMT+++ +   K  I D  G P
Sbjct  298  MNMQPSEAEAGFDLRLPPTADPDAMRRRIAEEWAPARRNMTYQILE---KGPIRDYLGSP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  ++SN WWA+ + A+ DA GKL KPEI   +TDAR+ R+  +P +GFSPM NTPIL
Sbjct  355  LMTMTNASNPWWAVFKAAISDAGGKLSKPEILATTTDARFMRQMRIPVLGFSPMINTPIL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL+   +++GI+VYES+I A +SF E
Sbjct  415  LHDHNEFLSDSVFIRGIKVYESLISALSSFQE  446



>ref|XP_004166496.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
Length=451

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD  ++ RRI EEWAPA RNMT+++ +   K  I D  G P
Sbjct  298  MNMQPSEAEAGFDLRLPPTADPDAMRRRIAEEWAPARRNMTYQILE---KGPIRDYLGSP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  ++SN WWA+ + A+ DA GKL KPEI   +TDAR+ R+  +P +GFSPM NTPIL
Sbjct  355  LMTMTNASNPWWAVFKAAISDAGGKLSKPEILATTTDARFMRQMRIPVLGFSPMINTPIL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL+   +++GI+VYES+I A +SF E
Sbjct  415  LHDHNEFLSDSVFIRGIKVYESLISALSSFQE  446



>emb|CAB37562.1| putative protein [Arabidopsis thaliana]
 emb|CAB80487.1| putative protein [Arabidopsis thaliana]
Length=753

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K +     G+ 
Sbjct  293  MNLQPSEAEAGFDIRVPPSVDAEALERRLVEEWAPAARNMSFE---FKQKLT-----GKQ  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  345  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  404

Query  376  LHDHNEFLNKDEYLKGIRV  320
            LHDHNE+L K EYLKGI V
Sbjct  405  LHDHNEYLGKAEYLKGIEV  423



>ref|XP_008219759.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1 [Prunus mume]
Length=422

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIR+PP  D   + +RI EEWAP +RN+T++L Q   K    D  GRP
Sbjct  270  MNMQPSEAEAGFDIRIPPTVDPELVRKRIAEEWAPEARNLTYQLIQ---KGPTRDYRGRP  326

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAI-GFSPMANTPI  380
              T  D SN WW++ ++A+  A GKL KPEI  ++TDARY R+ G+PA+ GFSPM NTPI
Sbjct  327  LATPTDDSNPWWSVFKQAIASAGGKLAKPEILASTTDARYMRQQGIPALGGFSPMTNTPI  386

Query  379  LLHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LLHDHNEFL    +LKGI+VYES+I A +S VE
Sbjct  387  LLHDHNEFLKDTVFLKGIKVYESVISALSSLVE  419



>ref|XP_007019015.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY16240.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=426

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP  D   ++RRI EEW PA RNMT+E+ +   K  I D  GRP
Sbjct  275  MNVQPSEAEAGFDLRLPPTVDPDLIKRRIAEEWGPARRNMTYEIIE---KGPIRDYMGRP  331

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  ++SN WW + ++A++ A GKL +PEI  ++TDAR+ RE G+P +GFSPM NTPIL
Sbjct  332  LMTVTNNSNPWWPVFKQAIEAAGGKLSRPEILASTTDARFMRERGIPTLGFSPMTNTPIL  391

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    YL+GI VYESII + +SF
Sbjct  392  LHDHNEFLKDTVYLRGIEVYESIISSLSSF  421



>gb|EPS66024.1| hypothetical protein M569_08749 [Genlisea aurea]
Length=454

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 112/145 (77%), Gaps = 3/145 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIR+PP+AD   + +RI +EWAP+ RNM++++ +   K  + D  GRP
Sbjct  287  MNVQPSEAEAGFDIRMPPMADPEVMRKRIADEWAPSWRNMSYQITE---KGPLRDASGRP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D +N WW+L E  V  A GKLGKPEI P++TDAR+ R+ G+P +GFSPM NTPIL
Sbjct  344  LMTATDDTNPWWSLFEGGVASAGGKLGKPEILPSTTDARFVRQLGIPCLGFSPMKNTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIK  302
            LHDH+EFL +D YL+GIRVY+ II+
Sbjct  404  LHDHDEFLKEDVYLEGIRVYQHIIR  428



>ref|XP_011027564.1| PREDICTED: aminoacylase-1-like [Populus euphratica]
Length=153

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   +++RI EEWAPA RNMT+E+ +   K  + D  G P
Sbjct  1    MNMQPSEAEAGFDLRLPPTADPDLVKKRIAEEWAPAVRNMTYEIIE---KGPLRDYMGLP  57

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW++ ++A+  A GKL KPEI  ++TDAR+ R+ G+P  GFSPM NTP+L
Sbjct  58   LMTATDDSNPWWSVFKQAIAAAGGKLAKPEILRSTTDARFMRQLGIPTFGFSPMTNTPLL  117

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
             HDHNEFL    +LKGI VYE II   +SF E
Sbjct  118  SHDHNEFLKDTIFLKGIEVYEHIIHELSSFEE  149



>ref|NP_001062216.2| Os08g0511900 [Oryza sativa Japonica Group]
 dbj|BAF24130.2| Os08g0511900, partial [Oryza sativa Japonica Group]
Length=118

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  601  QFKVKASIYDKFGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENG  422
            QFK K S+ D FG+PA+T  DSSN+WWAL E+AVK A GKLGKPEIFPASTDARYFR  G
Sbjct  1    QFKQKTSVLDNFGKPAVTPADSSNVWWALFEEAVKRAGGKLGKPEIFPASTDARYFRVLG  60

Query  421  LPAIGFSPMANTPILLHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
            +PA GFSPM NTPILLHDHNEFL+KDEYLKGI +YESII+  A+  +   D ES+AEL
Sbjct  61   IPAFGFSPMTNTPILLHDHNEFLSKDEYLKGIGIYESIIRTLATLKDSNVDYESRAEL  118



>ref|XP_002866787.1| hypothetical protein ARALYDRAFT_327784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43046.1| hypothetical protein ARALYDRAFT_327784 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K +     G+ 
Sbjct  282  MNLQPSEAEAGFDIRVPPNVDAEALERRLVEEWAPAARNMSFE---FKQKLT-----GKQ  333

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  334  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  393

Query  376  LHDHNEFLNKDEYLKGIRV  320
            LHDHNE+L K EYLKGI V
Sbjct  394  LHDHNEYLGKAEYLKGIDV  412



>ref|XP_007222264.1| hypothetical protein PRUPE_ppa005883mg [Prunus persica]
 gb|EMJ23463.1| hypothetical protein PRUPE_ppa005883mg [Prunus persica]
Length=439

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGF+IR+PP  D   + +RI EEWAP +RN+T++L +   K    D  GRP
Sbjct  288  MNMQPSEAEAGFNIRIPPTVDPELVRKRIAEEWAPEARNLTYQLIE---KGPNSDYRGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T  D SN WW++ ++A+  A GKL KPEI  ++TDARY R+ G+PA+GFSPM NTP+L
Sbjct  345  LATPTDDSNPWWSVFKQAIASAGGKLAKPEILASTTDARYMRQQGIPALGFSPMTNTPVL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +LKGI+VYES+I A +S VE
Sbjct  405  LHDHNEFLKDTVFLKGIKVYESVISALSSVVE  436



>ref|XP_002436680.1| hypothetical protein SORBIDRAFT_10g006970 [Sorghum bicolor]
 gb|EER88047.1| hypothetical protein SORBIDRAFT_10g006970 [Sorghum bicolor]
Length=439

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   ++RR+ EEWAPA +N+T++L Q   K  + D  GRP
Sbjct  291  MNMQPSEAEVGFDLRLPPTEDIEQIKRRVKEEWAPAHKNLTYQLMQ---KGPVTDVAGRP  347

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T+ + SN WW++ EKA+  A GKL KPEI  ++TD+R+ R+ G+PA+GFSPM NTPIL
Sbjct  348  IFTATNESNPWWSIFEKAITSAGGKLSKPEILSSTTDSRFVRQLGIPALGFSPMTNTPIL  407

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L+GI+VYE +I+A +SF
Sbjct  408  LHDHNEFLEDKVFLRGIKVYEHVIRALSSF  437



>ref|XP_010694046.1| PREDICTED: aminoacylase-1-like [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIR+PP AD   +  RI  EWAPASRNMTF++ +   K    D  G P
Sbjct  295  MNMQPSEAEAGFDIRLPPTADLELIRNRIAHEWAPASRNMTFKIVE---KGPNRDFLGHP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +TS D +N WW++  +A+    GKLG PEI  ++TDARY R+ G+PA+GFSPMANTPIL
Sbjct  352  LMTSTDDTNPWWSVFVQAITAVGGKLGNPEILASTTDARYMRQRGIPALGFSPMANTPIL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    YL+G+ VYES+I   +SF
Sbjct  412  LHDHNEFLQDAVYLRGVAVYESVISFLSSF  441



>ref|XP_004292687.1| PREDICTED: aminoacylase-1 [Fragaria vesca subsp. vesca]
Length=435

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGF+IR+PP  D   + +RI EEWAP +RN+T++L +   K    D  GRP
Sbjct  287  MNMQPSEAEAGFNIRIPPTVDPELVRKRIAEEWAPQARNLTYQLIE---KGPSRDYMGRP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN WW++ ++AV  A GKL KPEI  ++TDAR+ R+ G+P +GFSPM NTPIL
Sbjct  344  LMTPTDDSNPWWSVFKQAVAAAGGKLAKPEILASTTDARFMRQQGIPTLGFSPMTNTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +LKGI+VYES+I A +SF
Sbjct  404  LHDHNEFLKDTIFLKGIKVYESVISALSSF  433



>ref|XP_006295657.1| hypothetical protein CARUB_v10024772mg [Capsella rubella]
 gb|EOA28555.1| hypothetical protein CARUB_v10024772mg [Capsella rubella]
Length=423

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 112/152 (74%), Gaps = 7/152 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPS AEAGFDIRVPP AD  +LERR+VEEWAP +RNM+  L +         +  R 
Sbjct  275  MNLQPSVAEAGFDIRVPPTADPEALERRLVEEWAPPARNMSLTLWRAD------QELARN  328

Query  556  ALTSP-DSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPI  380
             L +P D SN W  LLE AV++A G   KPEIFPASTD+RYFR+ GL AIGFSP++NTP 
Sbjct  329  QLVTPIDDSNPWLELLENAVQEAGGNTSKPEIFPASTDSRYFRKAGLLAIGFSPISNTPS  388

Query  379  LLHDHNEFLNKDEYLKGIRVYESIIKAYASFV  284
            LLHDHNE+L + EYLKGI +Y SI+KAY S++
Sbjct  389  LLHDHNEYLGQSEYLKGIDMYVSILKAYTSYI  420



>ref|XP_006393703.1| hypothetical protein EUTSA_v10011489mg [Eutrema salsugineum]
 gb|ESQ30989.1| hypothetical protein EUTSA_v10011489mg [Eutrema salsugineum]
Length=438

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD  ++++RI EEWAPA RNMT+ +     K  + D  GRP
Sbjct  284  MNMQPSEAEAGYDLRLPPMADPDAMKKRIAEEWAPAIRNMTYTI---IAKGKLRDHLGRP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++AV+   GKL KPEI  ++TDARY R  G+P +GFSPM NTPIL
Sbjct  341  MMTPTNDSNPWWSIFKRAVEATGGKLAKPEILASTTDARYIRAFGIPLLGFSPMINTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  401  LHDHNEFLKDTMFMKGIEVYESVISALSSF  430



>ref|XP_002300996.2| aminoacylase family protein [Populus trichocarpa]
 gb|EEE80269.2| aminoacylase family protein [Populus trichocarpa]
Length=444

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   +++RI EEWAPA RNMT+E+ +   K  + D  GRP
Sbjct  292  MNMQPSEAEAGFDLRLPPTADPDPMKKRIAEEWAPAVRNMTYEIIE---KGPLRDYMGRP  348

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW++ ++A+  A GKL KPEI  ++TDAR+ R+ G+P  GFSPM NTP+L
Sbjct  349  LMTATDDSNPWWSVFKQAIAAAGGKLAKPEILRSTTDARFMRQLGIPTFGFSPMTNTPVL  408

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
             HDHNEFL    +LKGI VYE II A +SF E
Sbjct  409  SHDHNEFLKDTIFLKGIEVYEHIIHALSSFEE  440



>gb|KJB16266.1| hypothetical protein B456_002G221000 [Gossypium raimondii]
 gb|KJB16267.1| hypothetical protein B456_002G221000 [Gossypium raimondii]
Length=430

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   +++RI EEWAPA RNMT+EL +   K  I D   RP
Sbjct  279  MNMQPSEAEAGFDLRLPPTADPDLIKKRIAEEWAPARRNMTYELIE---KGPIRDYLDRP  335

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW + ++A++ A GKL +PEI  ++TDAR+ R+ G+P +GFSPM NTPIL
Sbjct  336  LMTLTNDSNPWWPVFKQAIEAAGGKLSRPEILASTTDARFMRQRGIPTLGFSPMTNTPIL  395

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    YL+GI VYES+I + +SF
Sbjct  396  LHDHNEFLKDTVYLRGIEVYESVISSLSSF  425



>ref|XP_002879550.1| hypothetical protein ARALYDRAFT_345276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55809.1| hypothetical protein ARALYDRAFT_345276 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 5/150 (3%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+RVPP  D   LERR+V EWA  +RNM+FEL  ++    I  K    
Sbjct  267  MNLQPSEAEAGFDMRVPPDVDSEELERRLVLEWASPARNMSFEL--WRSDQGIPKKH---  321

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D+SN WW LLE AVK+A G + +PEIFPA TD+RYFR  GLPAIGFSP++ TP L
Sbjct  322  LVTAKDNSNPWWELLENAVKEAGGLISEPEIFPAGTDSRYFRRAGLPAIGFSPISKTPSL  381

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE++++ EYLKGI +Y SI+KAY S+
Sbjct  382  LHDHNEYVSQSEYLKGIDMYVSILKAYTSY  411



>ref|XP_006307424.1| hypothetical protein CARUB_v10009048mg [Capsella rubella]
 gb|EOA40322.1| hypothetical protein CARUB_v10009048mg [Capsella rubella]
Length=469

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+DIR+PP++D   +++RI EEWAP+ RNMT+ + +   K  + D  GRP
Sbjct  315  MNMQPSEAEAGYDIRLPPMSDPDVMKKRIAEEWAPSIRNMTYTINE---KGKLRDHLGRP  371

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ + AV+   GKL KPEI P++TD+R+FR  G+P +GFSPM NTPIL
Sbjct  372  MMTPTNESNPWWSIFKHAVEATGGKLAKPEILPSTTDSRFFRFFGIPVLGFSPMTNTPIL  431

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LH+HNEFL    ++KGI VYES+I A +SF
Sbjct  432  LHEHNEFLKDTVFMKGIEVYESVIAALSSF  461



>ref|XP_006845931.1| hypothetical protein AMTR_s00157p00064680 [Amborella trichopoda]
 gb|ERN07606.1| hypothetical protein AMTR_s00157p00064680 [Amborella trichopoda]
Length=493

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 113/154 (73%), Gaps = 3/154 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSE EAG+D+R+PP AD   L  RI  EWAPA+RNMT+E+    VK  + D  GRP
Sbjct  341  MNLQPSEVEAGYDVRLPPTADPELLRWRIANEWAPATRNMTYEI---IVKGPLRDNEGRP  397

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + SN WW + ++A+    GKL KPEI  ++TD R+ R+ G+PA+GFSPM NTPIL
Sbjct  398  LMTATNGSNPWWLVFQQAIHACGGKLSKPEILASTTDTRFMRQMGIPALGFSPMINTPIL  457

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHT  275
            LH+HNEFLN++ Y++GI VYES+I + +S+  +T
Sbjct  458  LHEHNEFLNENVYMRGIEVYESVISSLSSYTGYT  491



>ref|XP_010500161.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=444

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   +++RI EEWAP+ RNMT+ +   K K  + D  GRP
Sbjct  290  MNMQPSEAEAGYDVRLPPMADPDVMKKRIAEEWAPSIRNMTYTV---KEKGKLRDHLGRP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + +N WW++ ++AV+   GKL KPEI  ++TD+RY R  G+P +GFSPM NTPIL
Sbjct  347  IMTPTNDTNPWWSIFKQAVEATGGKLAKPEILASTTDSRYIRSLGIPVLGFSPMTNTPIL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  407  LHDHNEFLKDIVFMKGIEVYESVITALSSF  436



>ref|XP_010272799.1| PREDICTED: aminoacylase-1 [Nelumbo nucifera]
Length=451

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG D+R+PP AD   L +RI +EWAPA+RNMT+++ +   K  I D  GRP
Sbjct  293  MNMQPSEAEAGLDVRLPPTADPDLLRKRIADEWAPATRNMTYQISE---KGPIRDYMGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++A+  A GKL +PEI  ++TDARY R+ G+P +GFSPM NTPIL
Sbjct  350  LMTLTNESNPWWSVFKQAIIAAGGKLSRPEILASTTDARYMRQMGIPTLGFSPMINTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LH+HNE+L    +LKGI VYESII + +SF
Sbjct  410  LHEHNEYLKDSVFLKGIEVYESIISSLSSF  439



>gb|KHN33869.1| Aminoacylase-1B [Glycine soja]
Length=343

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+ P  D   + RRI EEWAPA RNM++E+ +   K  + D  GRP
Sbjct  192  MNVQPSEAEAGFDLRLTPTTDPEEMRRRIAEEWAPAVRNMSYEIIE---KGPLRDYMGRP  248

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW++ ++A+     KL +PEI  ++TDARY R+ G+P +GFSPM NTPIL
Sbjct  249  LMTATDDSNPWWSVFKQAITSVGEKLSRPEILASTTDARYLRQKGIPVLGFSPMKNTPIL  308

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNE L    ++KGI+VYES+I + ++F E
Sbjct  309  LHDHNEHLKDTVFMKGIQVYESLISSLSTFTE  340



>ref|XP_006307525.1| hypothetical protein CARUB_v10009148mg [Capsella rubella]
 gb|EOA40423.1| hypothetical protein CARUB_v10009148mg [Capsella rubella]
Length=442

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+ P+AD   +E+RI EEWAP+ RNMT+    FKVK ++ D  GRP
Sbjct  288  MNMQPSEAEAGYDLRLHPMADPNLMEKRIAEEWAPSIRNMTY---IFKVKGNLRDNLGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN WW + ++AV+   GKL KPE+  ++TD+R+ R  G+P +GFSPM+NTP+L
Sbjct  345  IMTPIDDSNPWWFIFKQAVEATGGKLAKPEVLLSTTDSRFIRAMGIPVLGFSPMSNTPVL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            +HDHNEFL    ++KGI VYES+I A +SF
Sbjct  405  VHDHNEFLRDTVFMKGIEVYESVISALSSF  434



>ref|XP_010461453.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=438

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   +++RI EEWAP+ RNMT+ +   K K  + D  GRP
Sbjct  284  MNMQPSEAEAGYDLRLPPMADPDVMKKRIAEEWAPSIRNMTYTV---KEKGKLRDHLGRP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + +N WW++ ++AV+   GKL KPEI  ++TD+RY R  G+P +GFSPM NTPIL
Sbjct  341  IMTPTNDTNPWWSIFKQAVEATGGKLAKPEILASTTDSRYIRSLGIPVLGFSPMTNTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  401  LHDHNEFLKDIVFMKGIEVYESVITALSSF  430



>gb|EMT02607.1| Aminoacylase-1A [Aegilops tauschii]
Length=471

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   +ERRI EEWAPA +N+T++L +   K  + D  GRP
Sbjct  323  MNMQPSEAEVGFDLRLPPTEDIEQIERRIKEEWAPAHKNLTYQLLK---KGPVSDVTGRP  379

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  + SN WWA+ E+A+  + GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  380  LLTPANESNPWWAVFEQAIISSGGKLAKPEILSSTTDARFVRQMGVPALGFSPMINTPIL  439

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L+GI VY+ +I+A +SF
Sbjct  440  LHDHNEFLEDKVFLRGIEVYQHLIRALSSF  469



>ref|NP_175082.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AAG50548.1|AC074228_3 aminoacylase, putative [Arabidopsis thaliana]
 gb|AAK43484.1|AC084807_9 hypothetical protein [Arabidopsis thaliana]
 gb|AEE32028.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=435

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE G+D+R+PP+AD  +L++RI EEWAP+ RNMT+ L Q   +  + D  GRP
Sbjct  286  MNMQPSEAEVGYDLRLPPMADPVALKKRIAEEWAPSIRNMTYTLKQ---QGKLTDHLGRP  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + +N WW++ ++AV+   GKL KPEI  ++TD+R+ R  G+P +GFSPM NTPIL
Sbjct  343  IMTTTNDTNPWWSIFKQAVEATGGKLAKPEILISTTDSRFIRTLGIPVLGFSPMINTPIL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            +HDHNEFL    ++KGI VYES+I A +SF
Sbjct  403  VHDHNEFLKDTVFMKGIGVYESVISALSSF  432



>ref|XP_004964909.1| PREDICTED: aminoacylase-1-like [Setaria italica]
Length=441

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   ++RR+ EEWAPA +N+T+EL Q   K  + D  GRP
Sbjct  293  MNIQPSEAEVGFDLRLPPTEDIEQIKRRVKEEWAPAHKNLTYELMQ---KGPVMDVAGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T+ + SN WW++ E+A+  A GKL KPEI  ++TD+R+ R+ G+PA+GFSPM NTPIL
Sbjct  350  IFTATNESNPWWSVFEQAITSAGGKLSKPEILSSTTDSRFVRQLGIPALGFSPMTNTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHD+NEFL    +L+GI+VYE +I+A +SF
Sbjct  410  LHDNNEFLEDKVFLRGIKVYEHVIRALSSF  439



>ref|XP_010544624.1| PREDICTED: aminoacylase-1 [Tarenaya hassleriana]
Length=438

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP+AD   +++RI EEWAP+ RNMT+++ +      + D  G P
Sbjct  284  MNMQPSEAEAGFDVRLPPLADPDLMKKRIAEEWAPSIRNMTYKIEE---HGPMRDILGHP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++AV+   GKL KPEI  ++TDARY R+ G+P +GFSPM+NTPIL
Sbjct  341  IMTPTNDSNPWWSIFKQAVEAVGGKLAKPEILASTTDARYLRQWGIPVLGFSPMSNTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  401  LHDHNEFLKDSVFMKGIEVYESVISALSSF  430



>dbj|BAK07394.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=439

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   +ERRI EEWAPA +N+T++L +   K  + D  GRP
Sbjct  291  MNMQPSEAEVGFDLRLPPTEDIEQIERRIKEEWAPAHKNLTYQLMK---KGPVRDVTGRP  347

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT  ++SN WW++ E+A+  + GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  348  LLTPANASNPWWSVFEQAIISSGGKLAKPEILSSTTDARFARQMGVPALGFSPMINTPIL  407

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L+GI VY+ +I+A +SF
Sbjct  408  LHDHNEFLEDKVFLRGIEVYQHLIRALSSF  437



>ref|XP_009406638.1| PREDICTED: aminoacylase-1-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D + L+RRI EEWAP  +NMT++L Q   K  I D  GRP
Sbjct  287  MNMQPSEAEVGFDVRLPPTTDLSVLKRRIDEEWAPNIKNMTYQLIQ---KGPIRDNKGRP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T  D SN WW+  ++AV  + G L KPEI  ++TDAR+ R+ G+PA+GFSPMANTPIL
Sbjct  344  LATPTDESNPWWSAFKQAVLASGGTLAKPEILSSTTDARFMRQMGIPALGFSPMANTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +LKGI+VYE +I A +S  E
Sbjct  404  LHDHNEFLMDSVFLKGIKVYEHVISALSSLPE  435



>ref|XP_002893983.1| hypothetical protein ARALYDRAFT_473806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70242.1| hypothetical protein ARALYDRAFT_473806 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE G+DIR+PP+AD  ++++RI EEWAP+ RNMT+ + +   K  + D+ GRP
Sbjct  285  MNMQPSEAEVGYDIRLPPMADPVAMKKRIAEEWAPSIRNMTYTIEE---KGKLADQLGRP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++A++   GKL KPEI  +STD+R+ R  G+P +GFSPM NTPIL
Sbjct  342  IMTLTNGSNPWWSIFKQAIEATGGKLAKPEILISSTDSRFIRTLGIPVLGFSPMINTPIL  401

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            +HDHNEFL    ++KGI VYES+I A +SF
Sbjct  402  VHDHNEFLKDTVFMKGIGVYESVISALSSF  431



>dbj|BAE99837.1| aminoacylase like protein [Arabidopsis thaliana]
Length=424

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   +++RI EEWAP+ RNMT+ + +   K  + D  GRP
Sbjct  270  MNMQPSEAEAGYDLRLPPMADPDVMKKRIAEEWAPSIRNMTYSIQE---KGKLRDHLGRP  326

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++AV+   GKL KPEI  ++TD+R+ R  G+P  GFSPM NTPIL
Sbjct  327  IMTPVNDSNPWWSIFKQAVEAMGGKLAKPEILASTTDSRFIRTLGIPTFGFSPMTNTPIL  386

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  387  LHDHNEFLKDTVFMKGIEVYESVISALSSF  416



>ref|XP_009344110.1| PREDICTED: aminoacylase-1-like [Pyrus x bretschneideri]
Length=441

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 115/160 (72%), Gaps = 8/160 (5%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGF+IR+PP AD   L +RI EEWAPASRN+T++L     +    D  GRP
Sbjct  285  MNMQPSEAEAGFNIRIPPTADPELLRKRIAEEWAPASRNLTYQLLD---QGPTRDFIGRP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENG-----LPAIGFSPMA  392
              T+ D SN WW++ ++A++ A GKL KPEI  ++TDAR+ R+ G     +PA+GFSPM 
Sbjct  342  LATATDDSNPWWSVFKQAIESAGGKLAKPEILTSTTDARFIRQQGIXXXXIPALGFSPMT  401

Query  391  NTPILLHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTR  272
            NTP+LLHDHNE L    +LKGI+VYES+I A +SF + ++
Sbjct  402  NTPVLLHDHNEHLKDTVFLKGIKVYESLISALSSFEQTSQ  441



>ref|NP_175103.2| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AAF78265.1|AC020576_9 Contains similarity to aminoacylase from Sus scrofa domestica 
gi|S27010 and contains a peptidase M20 PF|01546 domain. ESTs 
gb|H76043, gb|AA394953, gb|AI995115, gb|AA651481 come from 
this gene [Arabidopsis thaliana]
 gb|ABG48486.1| At1g44820 [Arabidopsis thaliana]
 gb|AEE32055.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=438

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   +++RI EEWAP+ RNMT+ + +   K  + D  GRP
Sbjct  284  MNMQPSEAEAGYDLRLPPMADPDVMKKRIAEEWAPSIRNMTYSIQE---KGKLRDHLGRP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++AV+   GKL KPEI  ++TD+R+ R  G+P  GFSPM NTPIL
Sbjct  341  IMTPVNDSNPWWSIFKQAVEAMGGKLAKPEILASTTDSRFIRTLGIPTFGFSPMTNTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  401  LHDHNEFLKDTVFMKGIEVYESVISALSSF  430



>gb|KDP32782.1| hypothetical protein JCGZ_12074 [Jatropha curcas]
Length=442

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFD+R+PP AD   +++ I EEWAPA RN+T+E+ +   K  I D  GRP
Sbjct  290  MNLQPSEAEAGFDLRLPPTADPDLMKKIIAEEWAPAIRNITYEIIE---KGPIRDYKGRP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN WW + ++A+  A GK+ KPEI  ++TDAR+ R+ G+P  GFSPM NTPIL
Sbjct  347  LMTLTDDSNPWWPVFKQAIVAAGGKVSKPEILSSTTDARFIRQLGIPVFGFSPMTNTPIL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNEFL    +L+GI VYE II + +SFVE
Sbjct  407  LHDHNEFLKDTTFLRGIEVYEHIISSLSSFVE  438



>ref|XP_010943121.1| PREDICTED: aminoacylase-1 [Elaeis guineensis]
 ref|XP_010943122.1| PREDICTED: aminoacylase-1 [Elaeis guineensis]
Length=439

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   L +RI EEWAPA RNMT++L +   K  I D  GRP
Sbjct  288  MNMQPSEAEVGFDVRLPPTVDPDLLRKRIDEEWAPAIRNMTYQLIE---KGPIKDIAGRP  344

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T  + SN WW++ ++AV  + GKL +PEI  ++TDAR+ R+ G+PA+GFSPMANTPIL
Sbjct  345  LATPANESNPWWSVFQQAVIASGGKLARPEILASTTDARFVRQMGIPALGFSPMANTPIL  404

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LH+HNEFL    +L+GI+VYE +I A +SF
Sbjct  405  LHEHNEFLKDTVFLRGIKVYEHVISALSSF  434



>ref|XP_011074859.1| PREDICTED: aminoacylase-1 [Sesamum indicum]
Length=448

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSE EAGFD+R+PP  D   + RRI  EWAPA RN+T+E+ +   K  + D  GRP
Sbjct  293  MNMQPSEVEAGFDVRLPPTVDPDLMRRRIAGEWAPAWRNLTYEITE---KGPLRDYMGRP  349

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + SN WW + ++A++ A GKL KPEI  ++TDAR+ R+ G+P +GFSPM NTPIL
Sbjct  350  LVTATNDSNPWWTIFKQAIEAAGGKLAKPEILSSTTDARFMRQMGIPTLGFSPMKNTPIL  409

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    YL GI+VYE +I+  +SF
Sbjct  410  LHDHNEFLKDSVYLNGIKVYEHVIRLLSSF  439



>emb|CDY65424.1| BnaC06g40730D [Brassica napus]
Length=438

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   ++ RI +EWAP+ RNMT+ +   K K  + D  GRP
Sbjct  284  MNMQPSEAEAGYDLRLPPMADPDVIKTRISQEWAPSIRNMTYTI---KEKGKLRDHLGRP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + SN WW++ ++AV+   GKL KPEI  ++TDARY R  G+P +GFSPM NTPIL
Sbjct  341  IMTATNDSNPWWSVFKQAVEATGGKLAKPEILASTTDARYIRTLGIPLVGFSPMINTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHD NEFL    +LKGI VYES+I A +SF
Sbjct  401  LHDDNEFLKDTVFLKGIEVYESVISALSSF  430



>ref|XP_003543794.1| PREDICTED: aminoacylase-1-like [Glycine max]
Length=446

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+ P  D   + RRI EEWAPA RNM++E+ +   K  + D  GRP
Sbjct  295  MNVQPSEAEAGFDLRLTPTTDPEEMRRRIAEEWAPAVRNMSYEIIE---KGPLRDYMGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WW++ ++A+     KL +PEI  ++TDARY R+ G+P +GFSPM NTPIL
Sbjct  352  LMTATDDSNPWWSVFKQAITSVGEKLSRPEILASTTDARYLRQKGIPVLGFSPMKNTPIL  411

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LHDHNE L    ++KGI+VYES+I + ++F E
Sbjct  412  LHDHNEHLKDTVFMKGIQVYESLISSLSTFTE  443



>ref|XP_010479044.1| PREDICTED: aminoacylase-1 [Camelina sativa]
Length=445

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP AD   +E+RI EEWAP+ RNMT+ +   K+K ++ D  GR 
Sbjct  290  MNMQPSEAEAGYDLRLPPTADPDLMEKRIAEEWAPSIRNMTYII---KLKGNLRDHLGRA  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +   D SN WW++ ++AVK   GKL KPE+  ++TD+R+ R  G+P +GFSPM+NTP+L
Sbjct  347  MMNPIDDSNPWWSIFKQAVKATGGKLAKPEVLLSTTDSRFIRTLGIPVLGFSPMSNTPVL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            +HDHNEFL    ++KGI VYES+I A +SF
Sbjct  407  VHDHNEFLKDTVFMKGIEVYESVISALSSF  436



>ref|XP_010500137.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=444

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP AD   +E+RI EEWAP+ RNMT+ +   K+K ++ D  GR 
Sbjct  289  MNMQPSEAEAGYDLRLPPTADPDLMEKRIAEEWAPSIRNMTYII---KLKGNLRDHLGRA  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D +N WW++ ++AV+   GKL KPE+  ++TD+RY R  G+P +GFSPM+NTP+L
Sbjct  346  IMTPIDDTNPWWSIFKQAVEATGGKLAKPEVLLSTTDSRYIRPLGIPVLGFSPMSNTPVL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            +HDHNEFL    ++KGI VYE++I A +SF
Sbjct  406  VHDHNEFLKDTVFVKGIEVYETVISALSSF  435



>ref|XP_002891296.1| hypothetical protein ARALYDRAFT_473822 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67555.1| hypothetical protein ARALYDRAFT_473822 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP+AD   +++RI EEWAP+ RN+T+ + +   K  + D  GRP
Sbjct  285  MNMQPSEAEAGYDLRLPPMADPDVMKKRIAEEWAPSIRNLTYTIIE---KGKLRDHLGRP  341

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++AV+   GKL KPEI  ++TD+R+ R  G+P  GFSPM NTPIL
Sbjct  342  IMTPANDSNPWWSIFKQAVEATGGKLAKPEILASTTDSRFLRTLGIPVFGFSPMTNTPIL  401

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYES+I A +SF
Sbjct  402  LHDHNEFLKDTVFMKGIEVYESVISALSSF  431



>ref|XP_003564110.1| PREDICTED: aminoacylase-1-like [Brachypodium distachyon]
Length=437

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFDIR+PP  D   + RRI EEWAPA +N+T++L +   K  + D  GRP
Sbjct  289  MNMQPSEAEVGFDIRIPPTEDIEQIIRRIEEEWAPAHKNLTYQLMK---KGPVRDVAGRP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ E A+  + GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  346  LVTQTNESNPWWSVFEHAIISSGGKLAKPEILSSTTDARFVRQMGVPALGFSPMINTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L+GI +Y+ +I+A +SF
Sbjct  406  LHDHNEFLEDKVFLRGIEIYQHLIRALSSF  435



>ref|XP_006845921.1| hypothetical protein AMTR_s00157p00058420 [Amborella trichopoda]
 gb|ERN07596.1| hypothetical protein AMTR_s00157p00058420 [Amborella trichopoda]
Length=197

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 109/151 (72%), Gaps = 3/151 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAG+D+R+PP AD   L+ R+  EWAPA+RNMT+E+ +   K  + D  GRP
Sbjct  45   MNMQPSEAEAGYDVRLPPTADAEVLKWRVANEWAPATRNMTYEIIE---KGPLRDINGRP  101

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + SN WW +L +A+    G L KPEI  ++TD R+ R+  +PA+GFSP+ NTP L
Sbjct  102  LMTATNESNPWWLVLRQAILSTGGILSKPEILGSTTDTRFMRKMDIPALGFSPVINTPRL  161

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFV  284
            LH H+EFLN+D Y+KGI VYE++I + +SF 
Sbjct  162  LHAHDEFLNEDMYMKGIEVYETVISSLSSFT  192



>gb|EEC80215.1| hypothetical protein OsI_22115 [Oryza sativa Indica Group]
Length=415

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD R+PP  D   + RRI EEWAPA +N+T++L Q   K    D  GRP
Sbjct  267  MNMQPSEAEVGFDFRLPPTEDVEHIIRRIKEEWAPAHKNLTYKLMQ---KGPTRDLAGRP  323

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  ++SN WW++ E+A+  A GKL KPEI  ++TD+R+ R+ G+PA+GFSPM NTPIL
Sbjct  324  MVTPTNASNPWWSVFEQAIISAGGKLAKPEILSSTTDSRFIRQLGIPALGFSPMTNTPIL  383

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHD+NEFL    +L+GI+VYE II+A +SF
Sbjct  384  LHDNNEFLEDKVFLRGIKVYEHIIRALSSF  413



>ref|NP_001057113.1| Os06g0210200 [Oryza sativa Japonica Group]
 dbj|BAD35700.1| putative aminoacylase [Oryza sativa Japonica Group]
 dbj|BAF19027.1| Os06g0210200 [Oryza sativa Japonica Group]
Length=446

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD R+PP  D   + RRI EEWAPA +N+T++L Q   K    D  GRP
Sbjct  298  MNMQPSEAEVGFDFRLPPTEDVEHIIRRIKEEWAPAHKNLTYKLMQ---KGPTRDLAGRP  354

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  ++SN WW++ E+A+  A GKL KPEI  ++TD+R+ R+ G+PA+GFSPM NTPIL
Sbjct  355  MVTPTNASNPWWSVFEQAIISAGGKLAKPEILSSTTDSRFIRQLGIPALGFSPMTNTPIL  414

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHD+NEFL    +L+GI+VYE II+A +SF
Sbjct  415  LHDNNEFLEDKVFLRGIKVYEHIIRALSSF  444



>ref|XP_002513788.1| Aminoacylase-1, putative [Ricinus communis]
 gb|EEF48371.1| Aminoacylase-1, putative [Ricinus communis]
Length=436

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGF+IR+ P  D   L+++I EEWAPA RNMT+E+ +   K  I D  GRP
Sbjct  284  MNMQPSEAEAGFNIRLTPTTDTDLLKKKIAEEWAPAVRNMTYEIIE---KGPIRDIRGRP  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D+SN WW++ ++A+  A G+L KPEI  ++TD R+ R  G+P  GFSPM NTPIL
Sbjct  341  LMTAVDNSNPWWSVFKRAITAAGGQLAKPEILASTTDGRFIRRLGVPVFGFSPMTNTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            LH+HNEFL    +LKGI VYE II + +SF E
Sbjct  401  LHEHNEFLKDTVFLKGIEVYEHIISSLSSFEE  432



>gb|KFK42003.1| hypothetical protein AALP_AA2G199700 [Arabis alpina]
Length=438

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPS AEAG+DIR+PP+AD    ++RI EEWAP+ RNM++ + +   +  + D  GR 
Sbjct  284  MNMQPSVAEAGYDIRLPPMADPDVFKKRIDEEWAPSIRNMSYSILE---RGKLKDHLGRL  340

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +TS D SN WW++ ++AV+   GKL KPEI  ++TDARY R  G+P +GFSPM NTPIL
Sbjct  341  IMTSIDDSNPWWSIFKQAVEATGGKLAKPEILASTTDARYIRTLGVPVLGFSPMINTPIL  400

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            +HDHNEFL    ++KGI VYESII A +SF
Sbjct  401  VHDHNEFLKDTVFMKGIEVYESIINALSSF  430



>ref|NP_001150325.1| aminoacylase-1 precursor [Zea mays]
 gb|ACG38652.1| aminoacylase-1 [Zea mays]
Length=439

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   ++RR+ EEWAP+ +N+T+EL Q   K    D  GRP
Sbjct  291  MNMQPSEAEVGFDLRLPPTEDIEQIKRRVEEEWAPSHKNLTYELVQ---KGPATDVSGRP  347

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T+ ++SN WW   EKA+  A G+L KPEI  ++TD+R+ R+ G+PA+GFSPM  TPIL
Sbjct  348  VSTATNASNPWWLTFEKAIASAGGELSKPEILSSTTDSRFARQLGIPALGFSPMTRTPIL  407

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L+GI+VYE +I+A +SF
Sbjct  408  LHDHNEFLEDRVFLRGIQVYEHVIRALSSF  437



>gb|KFK35784.1| hypothetical protein AALP_AA4G036200 [Arabis alpina]
Length=440

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE G+D+R+PP+AD   +++RI EEWAPA RNMT+ +   K K  + D  GR 
Sbjct  286  MNMQPSEAEVGYDLRLPPMADPDVMKKRIAEEWAPAIRNMTYTI---KEKGMLRDHLGRL  342

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW++ ++AV+    KL KPEI  ++TDARY R  G+P  GFSPM NTPIL
Sbjct  343  IMTPANDSNPWWSIFKQAVEATGEKLAKPEILASTTDARYIRALGIPLFGFSPMKNTPIL  402

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    ++KGI VYESII A +S+
Sbjct  403  LHDHNEFLKDTVFMKGIEVYESIISALSSY  432



>ref|XP_008777203.1| PREDICTED: aminoacylase-1-like [Phoenix dactylifera]
Length=440

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSE E GFD+R+PP AD   L +RI EEWAPA RNMT++L Q   K  I D  G P
Sbjct  289  MNMQPSEVEVGFDVRLPPTADPDLLRKRIDEEWAPAIRNMTYQLIQ---KGPIKDIAGLP  345

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T  + SN WW   ++A+  + GKL +PEI  ++TDAR+ R+ G+PA+GFSPMANTPIL
Sbjct  346  LATLANESNPWWPAFQQAIIASGGKLARPEILASTTDARFMRQMGIPALGFSPMANTPIL  405

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LH+HNEFL    +L+GI+VYE +I A +SF
Sbjct  406  LHEHNEFLKDTVFLRGIKVYEHVISALSSF  435



>gb|ACN33832.1| unknown [Zea mays]
 gb|AFW76694.1| aminoacylase-1 [Zea mays]
Length=439

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD+R+PP  D   ++RR+ EEWAP+ +N+T+EL Q   K    D  GRP
Sbjct  291  MNMQPSEAEVGFDLRLPPTEDIEQIKRRVEEEWAPSHKNLTYELVQ---KGPATDVSGRP  347

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              T+ ++SN WW   E+A+  A G+L KPEI  ++TD+R+ R+ G+PA+GFSPM  TPIL
Sbjct  348  VSTATNASNPWWLTFERAIASAGGELSKPEILSSTTDSRFARQLGIPALGFSPMTRTPIL  407

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    +L+GI+VYE +I+A +SF
Sbjct  408  LHDHNEFLEDRVFLRGIQVYEHVIRALSSF  437



>ref|XP_009774989.1| PREDICTED: aminoacylase-1 [Nicotiana sylvestris]
 ref|XP_009774996.1| PREDICTED: aminoacylase-1 [Nicotiana sylvestris]
Length=447

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIR+PP AD   + + I E+WAPA RNMT+E+ +   K  + D  G P
Sbjct  287  MNMQPSEAEAGFDIRMPPTADPQIMRKIIEEQWAPAWRNMTYEITE---KGFLRDNMGCP  343

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T    SN WW++  +AV  A GKL KPEI  ++TDAR+ R  G+P  GFSPM NTPIL
Sbjct  344  LMTLTSDSNPWWSVFNEAVTRAGGKLSKPEILASTTDARFMRRLGIPTFGFSPMKNTPIL  403

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFL    YL+GI+VYE IIK  +SF
Sbjct  404  LHDHNEFLKDTVYLEGIKVYEYIIKLLSSF  433



>ref|XP_006655902.1| PREDICTED: aminoacylase-1-like [Oryza brachyantha]
Length=453

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAE GFD R+PP  D   + RRI EEW PA +N+T++L +   K  ++D  GR 
Sbjct  305  MNMQPSEAEVGFDFRLPPTEDIEDIIRRIKEEWVPAHKNLTYKLMK---KGPMHDLAGRS  361

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  ++SN WW++ E+A+  A GKLGKPEI  ++TD+R+ R+ G+PA+GFSPM NTPIL
Sbjct  362  MVTPTNASNPWWSVFEQAIISAGGKLGKPEILSSTTDSRFVRQLGIPALGFSPMTNTPIL  421

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHD+NEFL    +L+GI VYE II+A +SF
Sbjct  422  LHDNNEFLEDKVFLRGIEVYEHIIRALSSF  451



>ref|XP_004250324.1| PREDICTED: aminoacylase-1 [Solanum lycopersicum]
Length=447

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIR+PP AD   + + I E+WAPA RNMT+++ +   K  + D  GRP
Sbjct  290  MNMQPSEAEAGFDIRMPPTADPELMRKIIEEQWAPAWRNMTYKITE---KGFLRDIMGRP  346

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T    SN WW++  +AV  A GKL KPEI  ++TDAR+ R  G+P  GFSPM NTPIL
Sbjct  347  LMTLASDSNPWWSVFNEAVTRAGGKLSKPEILASTTDARFMRRLGIPTFGFSPMKNTPIL  406

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE L    YL+GI+VYE IIK+ +SF
Sbjct  407  LHDHNENLKDTVYLEGIKVYECIIKSLSSF  436



>dbj|BAH56753.1| AT4G38220 [Arabidopsis thaliana]
Length=400

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 99/126 (79%), Gaps = 8/126 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MNLQPSEAEAGFDIRVPP  D  +LERR+VEEWAPA+RNM+FE   FK K +     G+ 
Sbjct  279  MNLQPSEAEAGFDIRVPPSVDAEALERRLVEEWAPAARNMSFE---FKQKLT-----GKQ  330

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             LT+ D SN WW LLE AVK+A G+  KPEIFPASTDARYFR+ G+PA GFSP++NTP L
Sbjct  331  FLTAADDSNPWWGLLENAVKEAGGRTSKPEIFPASTDARYFRKAGVPAFGFSPISNTPSL  390

Query  376  LHDHNE  359
            LHDHNE
Sbjct  391  LHDHNE  396



>ref|XP_006351890.1| PREDICTED: aminoacylase-1-like isoform X1 [Solanum tuberosum]
 ref|XP_006351891.1| PREDICTED: aminoacylase-1-like isoform X2 [Solanum tuberosum]
 ref|XP_006351892.1| PREDICTED: aminoacylase-1-like isoform X3 [Solanum tuberosum]
Length=444

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFDIR+PP AD   + + I E+WAPA RNMT+++ +   K  + D  GRP
Sbjct  292  MNMQPSEAEAGFDIRMPPTADPELMRKIIEEQWAPAWRNMTYKITE---KGFLRDIMGRP  348

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T    SN WW++  +AV  A GKL KPEI  ++TDAR+ R  G+P  GFSPM NTPIL
Sbjct  349  LMTLASDSNPWWSVFNEAVTRAGGKLSKPEILASTTDARFMRRLGIPTFGFSPMKNTPIL  408

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNE L    YL+GI+VYE IIK+ +SF
Sbjct  409  LHDHNENLKDTVYLEGIKVYECIIKSLSSF  438



>ref|XP_010063989.1| PREDICTED: aminoacylase-1 isoform X3 [Eucalyptus grandis]
Length=434

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPS+AEAGFD+R+PP AD   +++RI EEWAPA RNMT+++ Q      I D  GRP
Sbjct  295  MNVQPSDAEAGFDVRLPPTADPDLVKKRIAEEWAPAIRNMTYQITQ---TGPIRDYEGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN+WW+   +AV  A GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  352  LMTRTDDSNLWWSAFNQAVAAAGGKLAKPEILSSTTDARFIRQLGIPALGFSPMINTPIL  411

Query  376  LHDHNEFLNKDEYLKGIRV  320
            LHDHNEFL    +L+GI+V
Sbjct  412  LHDHNEFLEDKVFLRGIKV  430



>gb|KJB79748.1| hypothetical protein B456_013G064900 [Gossypium raimondii]
Length=408

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  598  FKVKASIYDKFGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGL  419
            FK K S  D +GRP +T+ D SN WWALL +AVK ANGK+GKPEIFPA+TD+RYFR+ GL
Sbjct  292  FKQKGSTQDFWGRPLITATDRSNPWWALLVEAVKKANGKIGKPEIFPAATDSRYFRQQGL  351

Query  418  PAIGFSPMANTPILLHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRDDESKAEL  248
             AIGFSPMANTP+LLHDHNEFLN+ EYLKGI VYESIIKAY S++   RD  S+ EL
Sbjct  352  RAIGFSPMANTPVLLHDHNEFLNQAEYLKGIDVYESIIKAYTSYIPPGRDSLSRDEL  408



>ref|XP_010063986.1| PREDICTED: aminoacylase-1 isoform X1 [Eucalyptus grandis]
 ref|XP_010063987.1| PREDICTED: aminoacylase-1 isoform X1 [Eucalyptus grandis]
Length=457

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 3/138 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPS+AEAGFD+R+PP AD   +++RI EEWAPA RNMT+++ Q      I D  GRP
Sbjct  295  MNVQPSDAEAGFDVRLPPTADPDLVKKRIAEEWAPAIRNMTYQITQ---TGPIRDYEGRP  351

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN+WW+   +AV  A GKL KPEI  ++TDAR+ R+ G+PA+GFSPM NTPIL
Sbjct  352  LMTRTDDSNLWWSAFNQAVAAAGGKLAKPEILSSTTDARFIRQLGIPALGFSPMINTPIL  411

Query  376  LHDHNEFLNKDEYLKGIR  323
            LHDHNEFL    +L+GI+
Sbjct  412  LHDHNEFLEDKVFLRGIK  429



>ref|XP_003614736.1| Aminoacylase-1 [Medicago truncatula]
 gb|AES97694.1| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=355

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 100/141 (71%), Gaps = 3/141 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+ P  D   ++RRI  EWAP+ RNM+FE+ +   K  + D  G P
Sbjct  204  MNVQPSEAEAGFDLRLTPTTDPDEMKRRIAAEWAPSVRNMSFEIIE---KGPLRDCLGHP  260

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ + SN WW + ++A+  A  KL +PEI  ++TDARY R+ G+P +GFSPM NTPIL
Sbjct  261  LMTATNDSNPWWLVFKQAIASAGEKLSRPEILASTTDARYIRQKGIPVLGFSPMKNTPIL  320

Query  376  LHDHNEFLNKDEYLKGIRVYE  314
            LHDHNE L    Y+KGI+VYE
Sbjct  321  LHDHNEHLRDTVYMKGIQVYE  341



>ref|XP_010091376.1| hypothetical protein L484_020178 [Morus notabilis]
 gb|EXB44366.1| hypothetical protein L484_020178 [Morus notabilis]
Length=425

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            MN+QPSEAEAGFD+R+PP AD   L ++I EEWAPA RNMT+E+ +   K    D  GRP
Sbjct  302  MNMQPSEAEAGFDVRLPPTADPDILRKKISEEWAPAVRNMTYEVIE---KGPSRDYLGRP  358

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  + SN WW +  KA+    GKL KPEI P++TDARY R+ G+PA+GFSPM NTPIL
Sbjct  359  LMTLTNDSNPWWPVFNKAIAAVGGKLAKPEILPSTTDARYIRQLGIPALGFSPMTNTPIL  418

Query  376  LHDHNE  359
            LHDHNE
Sbjct  419  LHDHNE  424



>ref|XP_010690576.1| PREDICTED: aminoacylase-1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=406

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = -3

Query  631  ASRNMTF-----ELGQFKVKASIYDKFGRPALTSPDSSNIWWALLEKAVKDANGKLGKPE  467
             S NM F     +   F  K  + DKFG+P LT  DSSN WW L E+A++ A+GK+GK E
Sbjct  274  VSVNMVFLKAGTQTPTFIQKDPLLDKFGKPILTVADSSNPWWFLFEEAIRSADGKVGKAE  333

Query  466  IFPASTDARYFRENGLPAIGFSPMANTPILLHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            I   STDA +FR+ GLPAIGFS +ANTP  +HDHNEFLN++EYLKG+ +YESIIKAYAS+
Sbjct  334  ILLGSTDASFFRQRGLPAIGFSAIANTPERVHDHNEFLNQEEYLKGVDIYESIIKAYASY  393

Query  286  VEHTRDDESKAEL  248
              HT  + SK EL
Sbjct  394  AAHTEAEASKYEL  406



>ref|XP_001752334.1| predicted protein [Physcomitrella patens]
 gb|EDQ83067.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 101/155 (65%), Gaps = 9/155 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQF-KVKASIYDKFGR  560
            MNLQPSEAEAGFD+RVPP+ D   LE  I       ++N+   L Q  +++    D    
Sbjct  286  MNLQPSEAEAGFDVRVPPLVDIADLETEI------RTKNVESCLLQLTRLQPQPSDGLRL  339

Query  559  PALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPI  380
            P  TS D    WW LL+ AV+   GKLG P I P++TD+RY R   +PA GFSP++NTP 
Sbjct  340  P--TSADDMYPWWDLLQVAVQKVGGKLGAPMIRPSATDSRYIRNVNIPAFGFSPISNTPS  397

Query  379  LLHDHNEFLNKDEYLKGIRVYESIIKAYASFVEHT  275
            LLHDH+EFLN  EYLKGI+VY  IIKA++S V+ T
Sbjct  398  LLHDHDEFLNAKEYLKGIKVYSEIIKAFSSHVDIT  432



>ref|XP_002879551.1| hypothetical protein ARALYDRAFT_902649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55810.1| hypothetical protein ARALYDRAFT_902649 [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 104/187 (56%), Gaps = 48/187 (26%)
 Frame = -3

Query  727  QPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPAL-  551
            QP++A AGF IR+PP AD   L RRI++EWAPA+RNM+F+L +        +   R  L 
Sbjct  263  QPTQAVAGFAIRLPPFADSDELRRRILKEWAPATRNMSFQLSRAD------EGIAREKLV  316

Query  550  TSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILLH  371
            T+ D SN WW LL+ AVK A G    PEIFPAST++ +FR+ GLPAIGFSP++NTP L H
Sbjct  317  TATDDSNPWWGLLQNAVKQAGGVTSGPEIFPASTNSWFFRKAGLPAIGFSPISNTPSLRH  376

Query  370  DHNE-----------------------------------------FLNKDEYLKGIRVYE  314
            D+NE                                         +L++ EYLKGI +Y 
Sbjct  377  DNNEVLSPLQILHFIVVEHPSVLLIMWWIITSQEQFLTPHLTFLQYLSRSEYLKGIDMYV  436

Query  313  SIIKAYA  293
            SI+ AY 
Sbjct  437  SILMAYT  443



>ref|NP_001086906.1| aminoacylase 1, gene 1 [Xenopus laevis]
 gb|AAH77639.1| Acy1-prov protein [Xenopus laevis]
Length=407

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 12/151 (8%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWA-PASRNMTFELGQFKVKASIYDKFGRP  557
            N+ PSE  A FD+R+PP  +    ER++ E W   A  N+T+E  Q         K    
Sbjct  262  NVVPSEMTATFDLRIPPTVNLKEFERQL-EGWCREAGDNITWEYHQ---------KCMNE  311

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+PD SN WW       K+   KL KPEIFPA+TD+RY R  G  A+GFSPM NTPIL
Sbjct  312  RVTTPDDSNPWWKAFSTPCKEMGLKL-KPEIFPAATDSRYIRTAGYSALGFSPMNNTPIL  370

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASFV  284
            LHDHNE+LN+D +L+GI++Y  II + AS V
Sbjct  371  LHDHNEYLNEDVFLRGIQIYTKIIASLASVV  401



>ref|XP_006783382.1| PREDICTED: aminoacylase-1A-like [Neolamprologus brichardi]
Length=419

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 92/148 (62%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    ER+I +    A  ++T++  Q  +  +I        
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQEFERQIKQWCKEAGEDVTYDFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D S+ WW     + KD N  L K EIFPA+TD+R+ RE G+PAIGFSPM  TPILL
Sbjct  326  -TSTDESDPWWNAFSASCKDMNMTL-KKEIFPAATDSRFIREVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI VYE II A AS
Sbjct  384  HDHNEYLNEQVFLKGISVYERIIPALAS  411



>ref|XP_004068561.1| PREDICTED: aminoacylase-1 [Oryzias latipes]
Length=419

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 93/148 (63%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    ER+I E  A A +++T+E  Q  +  +I        
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQDFERQIQEWCAEAGQDITYEFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D ++ WW+    A K  N  L K EIFPA+TD+R+ R  G+PAIGFSPM  TPILL
Sbjct  326  -TSTDDTDPWWSAFSAACKSLNMTLEK-EIFPAATDSRFIRAVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN++ +LKGI VYE +I A  S
Sbjct  384  HDHNEYLNEEVFLKGIGVYERLIPALTS  411



>gb|KJE95881.1| aminoacylase-1A, variant [Capsaspora owczarzaki ATCC 30864]
Length=341

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 11/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ P+EA AGFDIR+PP  D    E+++   W  +   +TFE            KF   
Sbjct  200  FNIVPAEASAGFDIRIPPTVDLVEFEKQL-GVWTSSEEGVTFEF---------VSKFENN  249

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D +N+WW   + A  DA       EIFPA+TD+RY R+  +PA+GFSP+ NTPIL
Sbjct  250  QMTVLDDNNVWWKAFKTAC-DAQALTLVTEIFPAATDSRYIRQKSIPALGFSPINNTPIL  308

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +++G+ VYE ++K+  +
Sbjct  309  LHDHNEFLNEAVFVRGVTVYEHVLKSIGN  337



>ref|XP_003217685.1| PREDICTED: aminoacylase-1 [Anolis carolinensis]
 ref|XP_008103309.1| PREDICTED: aminoacylase-1 [Anolis carolinensis]
 ref|XP_008103310.1| PREDICTED: aminoacylase-1 [Anolis carolinensis]
 ref|XP_008103312.1| PREDICTED: aminoacylase-1 [Anolis carolinensis]
Length=416

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 10/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ PSE  A FDIR+PP  D  + E ++      A   +T+E  Q         K+   
Sbjct  270  FNVVPSEMSAAFDIRIPPTVDLKAFEEQVTAWCRAAGEGVTYEFHQ---------KYTDQ  320

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
            ++TS + S+ WW       ++ N KL K EIFPA+TD+RY R  G PAIGFSPM  TP+L
Sbjct  321  SMTSTEESDPWWKAFSTTCRNMNMKL-KCEIFPAATDSRYIRAAGHPAIGFSPMNRTPVL  379

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +L+GI +Y  +I A A+
Sbjct  380  LHDHNEFLNEQVFLRGIEIYAQLISALAN  408



>ref|XP_004345032.2| aminoacylase-1A [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95880.1| aminoacylase-1A [Capsaspora owczarzaki ATCC 30864]
Length=462

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 11/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ P+EA AGFDIR+PP  D    E+++   W  +   +TFE            KF   
Sbjct  321  FNIVPAEASAGFDIRIPPTVDLVEFEKQL-GVWTSSEEGVTFEF---------VSKFENN  370

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D +N+WW   + A  DA       EIFPA+TD+RY R+  +PA+GFSP+ NTPIL
Sbjct  371  QMTVLDDNNVWWKAFKTAC-DAQALTLVTEIFPAATDSRYIRQKSIPALGFSPINNTPIL  429

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +++G+ VYE ++K+  +
Sbjct  430  LHDHNEFLNEAVFVRGVTVYEHVLKSIGN  458



>ref|XP_004548571.1| PREDICTED: aminoacylase-1A-like [Maylandia zebra]
Length=419

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 91/148 (61%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    ER+I +    A  ++T++  Q  +  +I        
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQEFERQIKQWCKEAGEDVTYDFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D S+ WW     + K+ N  L K EIFPA+TD+R+ R  G+PAIGFSPM  TPILL
Sbjct  326  -TSTDESDPWWNAFSASCKEMNMTL-KKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI VYE II A AS
Sbjct  384  HDHNEYLNEQVFLKGISVYERIIPALAS  411



>ref|XP_003454610.1| PREDICTED: aminoacylase-1A-like [Oreochromis niloticus]
Length=419

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 91/148 (61%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    ER+I +    A  ++T++  Q  +  +I        
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQEFERQIKQWCKEAGEDVTYDFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D S+ WW     + K+ N  L K EIFPA+TD+R+ R  G+PAIGFSPM  TPILL
Sbjct  326  -TSTDESDPWWNAFSASCKEMNMTL-KKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI VYE II A AS
Sbjct  384  HDHNEYLNEQVFLKGISVYERIIPALAS  411



>ref|XP_008654127.1| PREDICTED: uncharacterized protein LOC103634365 [Zea mays]
Length=218

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -3

Query  688  PPIADQTSLERRIVEEWAPASRNM---TFELGQFKVKASIYDKFGRPALTSPDSSNIWWA  518
            PP + ++    R+   W P         + L Q   K    D  GRP  T+ ++SN WW 
Sbjct  80   PPASLRSPPPVRLYRRWPPPRLKCGPCCWPLLQLVQKGPATDVAGRPVSTATNASNPWWL  139

Query  517  LLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILLHDHNEFLNKDEY  338
              EKA+  A G+L KPEI  ++TD+R+ R+ G+PA+GFSPM +TPILLHDHNEFL    +
Sbjct  140  TFEKAIASAGGELSKPEILSSTTDSRFARQLGIPALGFSPMTSTPILLHDHNEFLEDRVF  199

Query  337  LKGIRVYESIIKAYASF  287
            L+GI+VYE +I+A +SF
Sbjct  200  LRGIQVYEHVIRALSSF  216



>ref|NP_001083594.1| aminoacylase 1, gene 2 [Xenopus laevis]
 gb|AAH61653.1| MGC68640 protein [Xenopus laevis]
Length=407

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 88/151 (58%), Gaps = 10/151 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PS+  A FD R+P   D    E ++      A +N+T            Y K    +
Sbjct  262  NVVPSDMTASFDFRIPHTVDFKEFESQLKSWCQAAGKNVTLRF---------YSKTMIQS  312

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +TS D SN WW      +K+   KL KPEIFPA TD+RY R  G PA+GFSPM NTPILL
Sbjct  313  VTSTDDSNPWWKAFSAPLKELGLKL-KPEIFPAGTDSRYVRGAGYPALGFSPMNNTPILL  371

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            HDHNE+LN+D +L+GI++Y  II + AS  E
Sbjct  372  HDHNEYLNEDVFLRGIQIYTQIISSLASVPE  402



>ref|XP_007888691.1| PREDICTED: aminoacylase-1 [Callorhinchus milii]
Length=406

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 86/148 (58%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E  AGFDIR+PP  D    E +I      A   + +E  Q  +   +        
Sbjct  261  NVVPNEMTAGFDIRIPPTVDLKVFEEQISTWCQEAGDGVGYEFHQKTMDQQV--------  312

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D SN WW       +  N KL + EIFPA+TD R+ RE G PAIGFSPM++TPILL
Sbjct  313  -TSIDKSNPWWNAFYTTCQQMNLKL-QCEIFPAATDIRFIREIGCPAIGFSPMSHTPILL  370

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +LKGI VY  +I A AS
Sbjct  371  HDHNEFLNEKVFLKGIDVYTELIPALAS  398



>ref|XP_007425958.1| PREDICTED: aminoacylase-1 [Python bivittatus]
Length=415

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 10/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ PS+    FDIR+PP  D  + E ++      A   +T+E  Q         K+   
Sbjct  269  FNVVPSQLSVAFDIRIPPTVDLEAFEEQLTSWCKAAGEGVTYEFHQ---------KYMDQ  319

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +TS + S+ WW       KD N KL K EIFPA+TD+RY R  G PAIGFSPM  TP+L
Sbjct  320  TVTSTEESDPWWNAFSGTCKDMNMKL-KCEIFPAATDSRYIRAAGRPAIGFSPMNYTPVL  378

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +L+GI +Y  +I A AS
Sbjct  379  LHDHNEFLNEQVFLRGIEIYARLIPALAS  407



>ref|XP_009597815.1| PREDICTED: aminoacylase-1-like [Nicotiana tomentosiformis]
Length=108

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  568  FGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMAN  389
             G P +T    SN WW++  +AV  A GKL KPEI  ++TDAR+ R  G+P  GFSPM N
Sbjct  1    MGCPLMTLTSDSNPWWSVFNEAVTSAGGKLSKPEILASTTDARFMRRLGIPTFGFSPMKN  60

Query  388  TPILLHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            TPILLHDHNEFL    YL+GI+VYESIIK+ +SF
Sbjct  61   TPILLHDHNEFLKDTVYLEGIKVYESIIKSLSSF  94



>ref|XP_005724765.1| PREDICTED: aminoacylase-1A-like [Pundamilia nyererei]
Length=419

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    ER+I +    A  ++T++  Q  +  +I        
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQEFERQIKQWCKEAGEDVTYDFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D S+ WW     + K+ +  L K EIFPA+TD+R+ R  G+PAIGFSPM  TPILL
Sbjct  326  -TSTDESDPWWNAFSASCKEMSMTL-KKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI VYE II A AS
Sbjct  384  HDHNEYLNEQVFLKGISVYERIIPALAS  411



>ref|XP_002594432.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae]
 gb|EEN50443.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae]
Length=411

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P E  AGFDIR+ P  D    E++I    A A   +T+E  Q         KF    
Sbjct  270  NVVPMEMYAGFDIRIAPTEDFEEFEKKIQSWLAAAGEGITYEFIQ---------KFDDQT  320

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D S+ WW     A ++ + KL K EIFPA+TD+R  R+ GLPAIGFSPM  TPILL
Sbjct  321  CTSTDKSDPWWNAFSTACENMDMKL-KLEIFPAATDSRLLRKIGLPAIGFSPMNLTPILL  379

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+D +LKGI +Y +I+ A  +
Sbjct  380  HDHNEFLNEDVFLKGIGIYCNILPALGN  407



>ref|NP_001011406.1| aminoacylase-1 [Xenopus (Silurana) tropicalis]
 gb|AAH88775.1| aminoacylase 1 [Xenopus (Silurana) tropicalis]
Length=407

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 12/150 (8%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWA-PASRNMTFELGQFKVKASIYDKFGR  560
             N+ PSE  A FD+R+PP  +    ER++ E W   A  N+T+E  Q         K   
Sbjct  261  FNVVPSEMTATFDLRIPPTVNLKEFERQL-EGWCRAAGDNVTWEYHQ---------KCMN  310

Query  559  PALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPI  380
              +T+PD SN WW       K+   KL KPEIFPA+TD+R+ R  G  A+GFSPM NTPI
Sbjct  311  ERVTTPDDSNPWWKAFSAPCKEMRLKL-KPEIFPAATDSRFIRAAGYSALGFSPMNNTPI  369

Query  379  LLHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LLHDHNE+LN+  +L+GI++Y  II + AS
Sbjct  370  LLHDHNEYLNESIFLRGIQIYTKIIASLAS  399



>ref|XP_009597816.1| PREDICTED: aminoacylase-1-like [Nicotiana tomentosiformis]
 ref|XP_009601624.1| PREDICTED: aminoacylase-1-like [Nicotiana tomentosiformis]
Length=108

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  568  FGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMAN  389
             G P +T    SN WW++  +AV  A GKL KPEI  ++TDAR+ R  G+P  GFSPM N
Sbjct  1    MGCPLMTLTSDSNPWWSVFNEAVTRAGGKLSKPEILASTTDARFMRRLGIPTFGFSPMKN  60

Query  388  TPILLHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            TPILLHDHNEFL    YL+GI+VYESIIK+ +SF
Sbjct  61   TPILLHDHNEFLKDTVYLEGIKVYESIIKSLSSF  94



>ref|XP_005074915.1| PREDICTED: aminoacylase-1A-like isoform X4 [Mesocricetus auratus]
Length=336

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FDIRV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  191  NVVPAAMSASFDIRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  241

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  242  MTHIDDSDPWWAAFNGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  300

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  301  HDHNERLHEAVFLRGVDIYMHLISALAS  328



>gb|ERE76105.1| aminoacylase-1A-like protein [Cricetulus griseus]
Length=366

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 88/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  221  NVVPAAMSASFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  271

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D SN WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  272  ITPTDDSNPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  330

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  331  HDHNERLHEAVFLRGVDIYTRLISALAS  358



>ref|XP_009601623.1| PREDICTED: aminoacylase-1-like [Nicotiana tomentosiformis]
Length=108

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  568  FGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMAN  389
             G P +T    SN WW++  +AV  A GKL KPEI  ++TDAR+ R  G+P  GFSPM N
Sbjct  1    MGCPLMTLTSDSNPWWSVFNEAVTRAGGKLSKPEILASTTDARFMRRLGIPTFGFSPMKN  60

Query  388  TPILLHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            TPILLHDHNEFL    YL+GI+VYESIIK+ +SF
Sbjct  61   TPILLHDHNEFLKDTVYLEGIKVYESIIKSISSF  94



>ref|XP_005932307.1| PREDICTED: aminoacylase-1A-like [Haplochromis burtoni]
Length=419

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    ER+I +    A  ++T++  Q  +  +I        
Sbjct  274  NVIPAEMDISFDLRIPPTVNLQEFERQIKQWCKEAGEDVTYDFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D S+ WW     + K+ +  L K EIFPA+TD+R+ R  G+PAIGFSPM  TPILL
Sbjct  326  -TSTDESDPWWNAFSASCKEMSMTL-KKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI VYE II A AS
Sbjct  384  HDHNEYLNEQVFLKGISVYERIIPALAS  411



>ref|XP_007617622.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1 isoform X2 [Cricetulus 
griseus]
Length=384

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 88/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  239  NVVPAAMSASFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  289

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D SN WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  290  ITPTDDSNPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  348

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  349  HDHNERLHEAVFLRGVDIYTRLISALAS  376



>ref|XP_005142319.1| PREDICTED: aminoacylase-1 [Melopsittacus undulatus]
Length=413

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 86/148 (58%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PSE  AGFDIR+PP  D  + E +I      A   +T+E  Q  +   I        
Sbjct  268  NVVPSEMAAGFDIRIPPTMDLKAFEEKIAAWCRDAGDGVTYEFLQKCMDQHI--------  319

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS + SN WW       +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+LL
Sbjct  320  -TSTEESNPWWKAFSGVCRDLKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVLL  377

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  378  HDHNEFLNEQVFLRGIEIYACLLPALAS  405



>gb|EGW08874.1| Aminoacylase-1A [Cricetulus griseus]
Length=392

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 88/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  247  NVVPAAMSASFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  297

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D SN WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  298  ITPTDDSNPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  356

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  357  HDHNERLHEAVFLRGVDIYTRLISALAS  384



>ref|XP_005074913.1| PREDICTED: aminoacylase-1A-like isoform X2 [Mesocricetus auratus]
Length=373

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FDIRV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  228  NVVPAAMSASFDIRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  278

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  279  MTHIDDSDPWWAAFNGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  337

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  338  HDHNERLHEAVFLRGVDIYMHLISALAS  365



>ref|XP_007639263.1| PREDICTED: aminoacylase-1 isoform X1 [Cricetulus griseus]
Length=408

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 88/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  263  NVVPAAMSASFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  313

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D SN WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  314  ITPTDDSNPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  372

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  373  HDHNERLHEAVFLRGVDIYTRLISALAS  400



>ref|XP_005522205.1| PREDICTED: aminoacylase-1 [Pseudopodoces humilis]
Length=413

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 86/148 (58%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PSE  AGFDIR+PP  D  + E ++      A   +T+E  Q         K     
Sbjct  268  NVVPSEMAAGFDIRIPPTVDLKAFEEQVATWCRGAGDGVTYEFHQ---------KCMDQH  318

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +TS + S+ WW       KD   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+LL
Sbjct  319  ITSTEESDPWWKAFSGVCKDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVLL  377

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  378  HDHNEFLNEQVFLRGIEIYARLLTALAS  405



>ref|XP_005074912.1| PREDICTED: aminoacylase-1A-like isoform X1 [Mesocricetus auratus]
Length=408

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FDIRV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  263  NVVPAAMSASFDIRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  313

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  314  MTHIDDSDPWWAAFNGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNHTPVLL  372

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  373  HDHNERLHEAVFLRGVDIYMHLISALAS  400



>emb|CDQ73988.1| unnamed protein product [Oncorhynchus mykiss]
Length=419

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 88/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    E +I +    A   +T+E  Q         K     
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQEFEEQIKKWCKEAGEGITYEFAQ---------KHMNQN  324

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            LTS D S+ WW       K  N  L K EIFPA+TD+R+ R  GLPAIGFSPM  TPILL
Sbjct  325  LTSTDDSDPWWKAFSTTCKAMNMTLEK-EIFPAATDSRFIRAVGLPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI+VYE+++ A A+
Sbjct  384  HDHNEYLNEQVFLKGIQVYENLVPALAN  411



>ref|NP_001133433.1| aminoacylase-1 [Salmo salar]
 gb|ACI33224.1| Aminoacylase-1 [Salmo salar]
 gb|ACN11392.1| Aminoacylase-1 [Salmo salar]
Length=419

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 88/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    E +I +    A   +T+E  Q         K     
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQEFEEQIKKWCKEAGEGITYEFAQ---------KHMNQN  324

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            LTS D S+ WW       K  N  L K EIFPA+TD+R+ R  GLPAIGFSPM  TPILL
Sbjct  325  LTSTDESDPWWNTFSTTCKAMNMTLEK-EIFPAATDSRFIRAVGLPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI+VYE+++ A A+
Sbjct  384  HDHNEYLNEQVFLKGIQVYENLVPALAN  411



>ref|XP_001506809.2| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
 ref|XP_007670495.1| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
 ref|XP_007670497.1| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
 ref|XP_007670498.1| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
 ref|XP_007670499.1| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
 ref|XP_007670500.1| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
 ref|XP_007670501.1| PREDICTED: aminoacylase-1 [Ornithorhynchus anatinus]
Length=414

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (61%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P++ +A FD R+ P  +  + E ++      A   +T+E  Q         K+  P 
Sbjct  269  NVVPADMDASFDFRIAPDVNLEAFEEQLRGWCQAAGDGVTYEFHQ---------KWTEPR  319

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T+ D+S+ WWA    A  D N  L KPEIFPA+TD+RY R  G+PA+GFSPM  TPILL
Sbjct  320  MTATDTSDPWWAAFSGACSDMNMTL-KPEIFPAATDSRYLRAKGVPALGFSPMNQTPILL  378

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  379  HDHNEFLNEAVFLRGIDIYTRLLPALAS  406



>ref|XP_010898926.1| PREDICTED: aminoacylase-1 [Esox lucius]
Length=418

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    E +I +    A   +T++  Q         K     
Sbjct  273  NVIPAEMDVSFDLRIPPTVNLQEFEEQIKQWCKEAGEGITYDFAQ---------KHMNQN  323

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +TS D S+ WW       K  N  L K EIFPA+TD+R+ R  GLPAIGFSPM  TPILL
Sbjct  324  MTSTDESDPWWNAFSTTCKAMNMTLEK-EIFPAATDSRFIRAVGLPAIGFSPMNRTPILL  382

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYASFVEHTRD  269
            HDHNEFLN+  +LKGI+VYE ++ A A+    T D
Sbjct  383  HDHNEFLNEQVFLKGIQVYERLVVALANVPAMTCD  417



>ref|XP_003762644.1| PREDICTED: aminoacylase-1A-like [Sarcophilus harrisii]
Length=412

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ P+   A FD RV P  D  + E +I      A   +T+E  Q         K+  P
Sbjct  266  FNVVPATMSASFDFRVAPDVDLKAFEEQIQGWCQEAGEGVTYEFHQ---------KWTEP  316

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T+ D SN WWA   +  ++ N  + KPEIFPA+TD+RY R  G+PA+GFSPM +TP+L
Sbjct  317  RITATDDSNPWWAEFSRVCREMNLSV-KPEIFPAATDSRYLRAAGVPALGFSPMNHTPVL  375

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYASF  287
            LHDHNEFLN+  +L+GI +Y  ++ A AS 
Sbjct  376  LHDHNEFLNEAVFLRGIDIYAHLLPALASL  405



>gb|EDL21135.1| aminoacylase 1 [Mus musculus]
Length=374

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  229  NVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQ---------KFTEPR  279

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K  N  L +PEIFPA+TD+RY R  G+PA+GFSPM  TP+LL
Sbjct  280  MTPTDDSDPWWAAFSGACKAMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLL  338

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++D +L+G+ +Y  ++ A AS
Sbjct  339  HDHNERLHEDIFLRGVDIYTGLLSALAS  366



>ref|XP_005485543.1| PREDICTED: aminoacylase-1 isoform X4 [Zonotrichia albicollis]
Length=341

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 86/149 (58%), Gaps = 10/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ PSE  A FDIR+PP  D  + E+++      A   +TFE  Q         K    
Sbjct  195  FNVVPSEMAASFDIRIPPTVDLKAFEKQVATWCRDAGEGVTFEFHQ---------KCMDQ  245

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +TS + S+ WW       +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+L
Sbjct  246  HITSTEESDPWWKAFSGVCRDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVL  304

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  305  LHDHNEFLNEQIFLRGIEIYARLLTALAS  333



>sp|Q99JW2.1|ACY1_MOUSE RecName: Full=Aminoacylase-1; Short=ACY-1; AltName: Full=N-acyl-L-amino-acid 
amidohydrolase [Mus musculus]
 gb|AAH05631.1| Aminoacylase 1 [Mus musculus]
Length=408

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  263  NVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQ---------KFTEPR  313

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K  N  L +PEIFPA+TD+RY R  G+PA+GFSPM  TP+LL
Sbjct  314  MTPTDDSDPWWAAFSGACKAMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLL  372

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++D +L+G+ +Y  ++ A AS
Sbjct  373  HDHNERLHEDIFLRGVDIYTGLLSALAS  400



>ref|XP_008945704.1| PREDICTED: aminoacylase-1 [Merops nubicus]
Length=413

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 10/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ PSE  AGFDIR+PP  D  + E ++      A   +T+E  Q  +   I       
Sbjct  267  FNVVPSEMVAGFDIRIPPTVDLKAFEEQVAAWCRGAGDGVTYEFHQKCMDQHI-------  319

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              TS D S+ WW       +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+L
Sbjct  320  --TSTDESDPWWKAFSGVCRDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNCTPVL  376

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  377  LHDHNEFLNEQVFLRGIDIYARLLPALAS  405



>ref|XP_005485540.1| PREDICTED: aminoacylase-1 isoform X1 [Zonotrichia albicollis]
Length=413

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 86/148 (58%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PSE  A FDIR+PP  D  + E+++      A   +TFE  Q         K     
Sbjct  268  NVVPSEMAASFDIRIPPTVDLKAFEKQVATWCRDAGEGVTFEFHQ---------KCMDQH  318

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +TS + S+ WW       +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+LL
Sbjct  319  ITSTEESDPWWKAFSGVCRDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVLL  377

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  378  HDHNEFLNEQIFLRGIEIYARLLTALAS  405



>ref|XP_008283525.1| PREDICTED: aminoacylase-1 [Stegastes partitus]
Length=419

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+E +  FD+R+PP  +    E++I +    A  ++T+E  Q  +  +I        
Sbjct  274  NVIPAEMDVSFDLRIPPTVNLQDFEKQIKQWCKEAGDDITYEFAQKHMNQNI--------  325

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS D  + WW+    A K  N  L K EIFPA+TD+R+ R  G+PAIGFSPM  TPILL
Sbjct  326  -TSTDEKDPWWSAFSDACKAMNMTLEK-EIFPAATDSRFIRAVGIPAIGFSPMNRTPILL  383

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE+LN+  +LKGI VYE +I A A 
Sbjct  384  HDHNEYLNEHVFLKGITVYERLIPALAG  411



>ref|XP_005485541.1| PREDICTED: aminoacylase-1 isoform X2 [Zonotrichia albicollis]
Length=378

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 86/148 (58%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PSE  A FDIR+PP  D  + E+++      A   +TFE  Q  +   I        
Sbjct  233  NVVPSEMAASFDIRIPPTVDLKAFEKQVATWCRDAGEGVTFEFHQKCMDQHI--------  284

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
             TS + S+ WW       +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+LL
Sbjct  285  -TSTEESDPWWKAFSGVCRDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVLL  342

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  343  HDHNEFLNEQIFLRGIEIYARLLTALAS  370



>ref|XP_007141070.1| hypothetical protein PHAVU_008G164900g [Phaseolus vulgaris]
 gb|ESW13064.1| hypothetical protein PHAVU_008G164900g [Phaseolus vulgaris]
Length=102

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -3

Query  568  FGRPALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMAN  389
             GRP +T+ + SN WW++ ++A+     KL  PEI  ++TDAR+ R+ G+P +GFSPM N
Sbjct  1    MGRPLMTATNDSNPWWSVFKQAITSVKEKLSSPEILGSTTDARFLRQKGIPVLGFSPMKN  60

Query  388  TPILLHDHNEFLNKDEYLKGIRVYESIIKAYASFVE  281
            TPILLHDHNE L    +LKGI+VYES+I + ++F E
Sbjct  61   TPILLHDHNEHLKDTVFLKGIQVYESLISSLSTFTE  96



>ref|XP_009519815.1| ACY1-like metalloprotease [Phytophthora sojae]
 gb|EGZ24527.1| ACY1-like metalloprotease [Phytophthora sojae]
Length=418

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 95/145 (66%), Gaps = 9/145 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
            +N+ P+EA AGFDIR+ P  D +++ +++ +EW  A+  +++E       AS        
Sbjct  277  LNVIPTEAIAGFDIRISPEMDISAMGKKL-DEWC-AAEGVSWEF------ASWTKPMHEH  328

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              TS DS N+WW L +K+      KL + EIFPA+TD+RY R+ G+ AIGFSPM  T IL
Sbjct  329  YTTSLDSGNVWWQLFQKSCARVGEKL-ETEIFPAATDSRYLRKAGVQAIGFSPMKKTEIL  387

Query  376  LHDHNEFLNKDEYLKGIRVYESIIK  302
            LH+HNE+L+KD +L GI+VYE+I +
Sbjct  388  LHEHNEYLHKDTFLHGIKVYETIFR  412



>gb|ETE70763.1| Aminoacylase-1 [Ophiophagus hannah]
Length=380

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 85/148 (57%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PSE    FDIR+PP  D  + E ++      A   +T+E  Q         K+    
Sbjct  235  NVVPSELSVAFDIRLPPTEDLKAFEEQLKSWCKAAGEGVTYEFQQ---------KYMDQT  285

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +TS + S+ WW       KD N KL K EIFPA+TD+R+ R  G PAIGFSPM  TP+LL
Sbjct  286  VTSTEESDPWWKAFSDTCKDMNMKL-KCEIFPAATDSRFIRAAGHPAIGFSPMNYTPVLL  344

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L GI +Y  +I A AS
Sbjct  345  HDHNEFLNEQIFLHGIEIYAHLIPALAS  372



>ref|XP_008497203.1| PREDICTED: aminoacylase-1 [Calypte anna]
Length=413

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ PSE  AGFDIR+PP  D  + E ++      A   +T+E  Q         K     
Sbjct  268  NVVPSEMAAGFDIRIPPTVDLKAFEDQVAAWCRDAGDGVTYEFHQ---------KCMDQH  318

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +TS + S+ WW     A +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+LL
Sbjct  319  VTSTEESDPWWKAFSGAFRDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVLL  377

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  378  HDHNEFLNEQVFLRGIDIYARLLSALAS  405



>ref|XP_006978456.1| PREDICTED: aminoacylase-1A-like isoform X1 [Peromyscus maniculatus 
bairdii]
 ref|XP_006978457.1| PREDICTED: aminoacylase-1A-like isoform X2 [Peromyscus maniculatus 
bairdii]
Length=408

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 90/149 (60%), Gaps = 12/149 (8%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWA-PASRNMTFELGQFKVKASIYDKFGRP  557
            N+ P+   A FD RV P  D  + E+++ E W   A   +TFE  Q         KF  P
Sbjct  263  NVVPAAMSASFDFRVAPDVDMKAFEKQL-ETWCREAGEGVTFEFAQ---------KFTEP  312

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +T  D SN WWA    A K+ N  L +P+IFPA+TD+RY R  G+PA+GFSPM +TP+L
Sbjct  313  RMTRTDDSNPWWAAFSGACKEMNLTL-EPQIFPAATDSRYVRAVGIPALGFSPMNHTPVL  371

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNE L++  +L+G+ +Y  ++ A AS
Sbjct  372  LHDHNERLHEAVFLRGVDIYTRLLSALAS  400



>ref|XP_003936643.1| PREDICTED: aminoacylase-1 [Saimiri boliviensis boliviensis]
 ref|XP_010345371.1| PREDICTED: aminoacylase-1 [Saimiri boliviensis boliviensis]
 ref|XP_010345372.1| PREDICTED: aminoacylase-1 [Saimiri boliviensis boliviensis]
Length=408

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E ++      A   +TFE GQ         K+ +P 
Sbjct  263  NVVPATMSASFDFRVAPDVDLKAFEEQLQSWCQAAGEGVTFEFGQ---------KWTQPQ  313

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D SN WWA   +  KD N  L +PEIFPA+TD+RY R  G+PA+GFSPM +TP+LL
Sbjct  314  VTPTDDSNPWWAAFSRVCKDMNLTL-EPEIFPAATDSRYLRAVGVPALGFSPMNHTPVLL  372

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDH+E L++  +L+G+ +Y  ++ A AS
Sbjct  373  HDHDERLHEAVFLRGVDIYTRLLPALAS  400



>ref|XP_008511306.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1 [Equus przewalskii]
Length=409

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 87/149 (58%), Gaps = 9/149 (6%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ P+   A FD R+ P  D  + E ++      A   +TFE  Q         KF  P
Sbjct  262  FNVVPATMSASFDFRLAPDMDLKAFEEQLQSWCQAAGEGVTFEFVQ---------KFMEP  312

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
             +TS D S+ WWA   +  KD N  L +PEIFPA+TD+RY R+ G+PA+GFSPM  TP L
Sbjct  313  RVTSIDDSDPWWAAFSRVCKDMNLTLEQPEIFPAATDSRYLRKVGVPALGFSPMNRTPRL  372

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDH+E L++D +L G+ +Y  ++ A AS
Sbjct  373  LHDHDERLHEDMFLHGVDIYTQLLPALAS  401



>ref|XP_005368552.1| PREDICTED: aminoacylase-1A-like isoform X5 [Microtus ochrogaster]
Length=336

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  191  NVVPAAMSASFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  241

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM  TP+LL
Sbjct  242  MTRTDDSDPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNLTPVLL  300

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  301  HDHNERLHEAVFLRGVDIYTRLISALAS  328



>ref|XP_010141195.1| PREDICTED: aminoacylase-1 [Buceros rhinoceros silvestris]
Length=413

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 86/149 (58%), Gaps = 10/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ PSE  AGFDIR+PP  D  + E ++      A   +T+E  Q  +   I       
Sbjct  267  FNVVPSEMAAGFDIRIPPTVDLQAFEEQVAAWCRGAGDGVTYEFHQKCMDQHI-------  319

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              TS + S+ WW       +D   +L K EIFPA+TD+RY R  G PAIGFSPM  TP+L
Sbjct  320  --TSTEESDPWWKAFSGVFRDMKLQL-KLEIFPAATDSRYIRAAGHPAIGFSPMNRTPVL  376

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+  +L+GI +Y  ++ A AS
Sbjct  377  LHDHNEFLNEQVFLRGIDIYAHLLSALAS  405



>ref|XP_004944533.1| PREDICTED: aminoacylase-1 isoform X10 [Gallus gallus]
Length=341

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 85/149 (57%), Gaps = 10/149 (7%)
 Frame = -3

Query  736  MNLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRP  557
             N+ PSE   GFDIR+PP  D  + E ++      A   +T+E  Q  +   I       
Sbjct  195  FNVVPSEMAVGFDIRIPPTVDLKAFEEQVAAWCRAAGDGVTYEFHQKCMDQQI-------  247

Query  556  ALTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPIL  377
              TS + S+ WW       +D    L K EIFPA+TD+RY R  G PA+GFSPM  TP+L
Sbjct  248  --TSTEESDPWWKAFSGVCRDMKLPL-KLEIFPAATDSRYIRAAGYPALGFSPMNRTPVL  304

Query  376  LHDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            LHDHNEFLN+D +L+GI +Y  ++ A AS
Sbjct  305  LHDHNEFLNEDVFLRGIDIYARLLPALAS  333



>ref|NP_079647.1| aminoacylase-1 [Mus musculus]
 ref|NP_001263371.1| aminoacylase-1 [Mus musculus]
 dbj|BAB22090.1| unnamed protein product [Mus musculus]
 dbj|BAB22948.1| unnamed protein product [Mus musculus]
Length=408

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  263  NVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQ---------KFTEPR  313

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K  N  L +PEIFPA+TD+R+ R  G+PA+GFSPM  TP+LL
Sbjct  314  MTPTDDSDPWWAAFSGACKAMNLTL-EPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLL  372

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++D +L+G+ +Y  ++ A AS
Sbjct  373  HDHNERLHEDIFLRGVDIYTGLLSALAS  400



>ref|XP_005368550.1| PREDICTED: aminoacylase-1A-like isoform X3 [Microtus ochrogaster]
Length=373

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = -3

Query  733  NLQPSEAEAGFDIRVPPIADQTSLERRIVEEWAPASRNMTFELGQFKVKASIYDKFGRPA  554
            N+ P+   A FD RV P  D  + E+++      A   +TFE  Q         KF  P 
Sbjct  228  NVVPAAMSASFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQ---------KFTEPR  278

Query  553  LTSPDSSNIWWALLEKAVKDANGKLGKPEIFPASTDARYFRENGLPAIGFSPMANTPILL  374
            +T  D S+ WWA    A K+ N  L +PEIFPA+TD+RY R  G+PA+GFSPM  TP+LL
Sbjct  279  MTRTDDSDPWWAAFSGACKEMNLTL-EPEIFPAATDSRYIRAVGIPALGFSPMNLTPVLL  337

Query  373  HDHNEFLNKDEYLKGIRVYESIIKAYAS  290
            HDHNE L++  +L+G+ +Y  +I A AS
Sbjct  338  HDHNERLHEAVFLRGVDIYTRLISALAS  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515