BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035J24

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010672172.1|  PREDICTED: probable leucine-rich repeat rece...  76.6    8e-13   
ref|XP_008226203.1|  PREDICTED: receptor-like protein 12              73.6    1e-11   Prunus mume [ume]
ref|XP_007031845.1|  Serine/threonine-protein kinase bri1, putative   73.2    1e-11   
ref|XP_007214009.1|  hypothetical protein PRUPE_ppa014796mg           73.2    1e-11   Prunus persica
ref|XP_008371982.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-11   
emb|CAN71149.1|  hypothetical protein VITISV_040339                   72.8    1e-11   Vitis vinifera
ref|XP_002273824.2|  PREDICTED: probable leucine-rich repeat rece...  72.8    2e-11   Vitis vinifera
ref|XP_007212689.1|  hypothetical protein PRUPE_ppa018526m1g          69.3    2e-11   
ref|XP_009368629.1|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_006447088.1|  hypothetical protein CICLE_v10017744mg           72.4    2e-11   Citrus clementina [clementine]
ref|XP_008383306.1|  PREDICTED: serine/threonine-protein kinase B...  71.6    2e-11   Malus domestica [apple tree]
ref|XP_003633782.1|  PREDICTED: receptor-like protein 12              72.0    3e-11   Vitis vinifera
gb|KEH25178.1|  LRR receptor-like kinase family protein               71.6    3e-11   Medicago truncatula
ref|XP_009365385.1|  PREDICTED: LRR receptor-like serine/threonin...  71.6    4e-11   
ref|XP_009365382.1|  PREDICTED: LRR receptor-like serine/threonin...  71.6    4e-11   
ref|XP_007024895.1|  Disease resistance family protein / LRR fami...  71.6    4e-11   
gb|KEH16825.1|  LRR receptor-like kinase family protein               71.2    5e-11   Medicago truncatula
ref|XP_008349126.1|  PREDICTED: probable LRR receptor-like serine...  70.1    5e-11   
ref|XP_011462013.1|  PREDICTED: leucine-rich repeat receptor prot...  71.2    5e-11   Fragaria vesca subsp. vesca
ref|XP_008364270.1|  PREDICTED: probable leucine-rich repeat rece...  70.9    6e-11   
ref|XP_008364263.1|  PREDICTED: leucine-rich repeat receptor prot...  71.2    6e-11   
ref|XP_008372144.1|  PREDICTED: uncharacterized protein LOC103435527  67.8    6e-11   
ref|XP_008354989.1|  PREDICTED: probable LRR receptor-like serine...  70.9    6e-11   
ref|XP_008372146.1|  PREDICTED: LRR receptor-like serine/threonin...  70.9    6e-11   
ref|XP_007214101.1|  hypothetical protein PRUPE_ppa016834mg           70.9    8e-11   
ref|XP_009363245.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    8e-11   
ref|XP_009363373.1|  PREDICTED: uncharacterized protein LOC103953355  67.4    8e-11   
ref|XP_008225907.1|  PREDICTED: probable leucine-rich repeat rece...  70.5    9e-11   
ref|XP_009363343.1|  PREDICTED: leucine-rich repeat receptor prot...  70.5    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_002270042.1|  PREDICTED: receptor-like protein 12              70.5    9e-11   Vitis vinifera
ref|XP_008365987.1|  PREDICTED: DNA-damage-repair/toleration prot...  69.7    1e-10   
ref|XP_011462208.1|  PREDICTED: leucine-rich repeat receptor prot...  70.1    1e-10   Fragaria vesca subsp. vesca
gb|KDO43313.1|  hypothetical protein CISIN_1g0376511mg                66.6    1e-10   Citrus sinensis [apfelsine]
ref|XP_006470464.1|  PREDICTED: LRR receptor-like serine/threonin...  70.1    1e-10   Citrus sinensis [apfelsine]
ref|XP_009351266.1|  PREDICTED: LRR receptor-like serine/threonin...  69.3    1e-10   
ref|XP_008349122.1|  PREDICTED: LRR receptor-like serine/threonin...  69.7    1e-10   
ref|XP_009365387.1|  PREDICTED: receptor-like protein 12              69.7    1e-10   
ref|XP_009365390.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  67.0    1e-10   
ref|XP_007214523.1|  hypothetical protein PRUPE_ppa015660mg           69.7    2e-10   
ref|XP_008383307.1|  PREDICTED: LRR receptor-like serine/threonin...  69.7    2e-10   
ref|XP_008349123.1|  PREDICTED: LRR receptor-like serine/threonin...  69.3    2e-10   
gb|KEH25184.1|  LRR receptor-like kinase family protein               69.3    2e-10   Medicago truncatula
ref|XP_004295536.2|  PREDICTED: receptor-like protein 12              69.3    2e-10   Fragaria vesca subsp. vesca
ref|XP_009335211.1|  PREDICTED: receptor-like protein 2               68.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_010662440.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    3e-10   
ref|XP_009368581.1|  PREDICTED: receptor-like protein 12              68.9    3e-10   
ref|XP_002268910.2|  PREDICTED: LRR receptor-like serine/threonin...  68.9    3e-10   
ref|XP_006446689.1|  hypothetical protein CICLE_v10017769mg           68.9    3e-10   Citrus clementina [clementine]
ref|XP_009365374.1|  PREDICTED: leucine-rich repeat receptor prot...  68.9    3e-10   
gb|KEH16823.1|  leucine-rich receptor-like kinase family protein,...  68.6    3e-10   Medicago truncatula
ref|XP_010046667.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   Eucalyptus grandis [rose gum]
ref|XP_008226588.1|  PREDICTED: receptor-like protein 2               68.2    4e-10   
ref|XP_007220272.1|  hypothetical protein PRUPE_ppa000998mg           68.6    4e-10   
ref|XP_009363364.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_007214150.1|  hypothetical protein PRUPE_ppa018847mg           68.2    4e-10   
ref|XP_011463260.1|  PREDICTED: receptor-like protein 12              68.2    5e-10   Fragaria vesca subsp. vesca
ref|XP_007212880.1|  hypothetical protein PRUPE_ppa021661mg           68.2    5e-10   
ref|XP_008226022.1|  PREDICTED: probable leucine-rich repeat rece...  68.2    6e-10   
ref|XP_008226021.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  68.2    6e-10   
ref|XP_008382520.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    6e-10   
ref|XP_006480247.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    6e-10   Citrus sinensis [apfelsine]
ref|XP_007031844.1|  Serine/threonine-protein kinase bri1, putative   67.8    7e-10   
ref|XP_008383310.1|  PREDICTED: probable LRR receptor-like serine...  67.8    7e-10   
gb|KJB50165.1|  hypothetical protein B456_008G156800                  67.8    7e-10   Gossypium raimondii
ref|XP_008226031.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    7e-10   
ref|XP_004507279.1|  PREDICTED: probable leucine-rich repeat rece...  67.8    7e-10   Cicer arietinum [garbanzo]
ref|XP_008393401.1|  PREDICTED: probable LRR receptor-like serine...  67.8    8e-10   
gb|KEH16824.1|  leucine-rich receptor-like kinase family protein,...  67.4    8e-10   Medicago truncatula
ref|XP_008225908.1|  PREDICTED: LRR receptor-like serine/threonin...  67.4    9e-10   Prunus mume [ume]
emb|CAN76220.1|  hypothetical protein VITISV_020133                   67.4    9e-10   Vitis vinifera
ref|XP_008226571.1|  PREDICTED: receptor-like protein 2               67.4    9e-10   
ref|XP_010655653.1|  PREDICTED: receptor-like protein 12              67.4    9e-10   Vitis vinifera
ref|XP_002273399.2|  PREDICTED: probable leucine-rich repeat rece...  67.4    9e-10   
ref|XP_009342313.1|  PREDICTED: receptor-like protein 2               67.0    9e-10   Pyrus x bretschneideri [bai li]
ref|XP_009352122.1|  PREDICTED: probable leucine-rich repeat rece...  67.4    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_008343845.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-09   
ref|XP_004295535.1|  PREDICTED: receptor-like protein 2               64.3    1e-09   Fragaria vesca subsp. vesca
ref|XP_009375566.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    1e-09   Pyrus x bretschneideri [bai li]
emb|CAN63562.1|  hypothetical protein VITISV_037178                   63.5    1e-09   Vitis vinifera
ref|XP_008346112.1|  PREDICTED: probable leucine-rich repeat rece...  67.0    1e-09   
ref|XP_008362830.1|  PREDICTED: receptor-like protein 12              66.6    1e-09   
ref|XP_008383232.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
emb|CAN63882.1|  hypothetical protein VITISV_002032                   66.6    2e-09   Vitis vinifera
ref|XP_011460509.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    2e-09   Fragaria vesca subsp. vesca
ref|XP_008366594.1|  PREDICTED: receptor-like protein 2               66.2    2e-09   Malus domestica [apple tree]
ref|XP_010677155.1|  PREDICTED: receptor-like protein kinase isof...  66.2    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010655798.1|  PREDICTED: probable leucine-rich repeat rece...  66.2    2e-09   
ref|XP_007213197.1|  hypothetical protein PRUPE_ppa026674mg           66.2    2e-09   
ref|XP_009368772.1|  PREDICTED: DNA-damage-repair/toleration prot...  63.5    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_004301719.2|  PREDICTED: LRR receptor-like serine/threonin...  66.2    2e-09   Fragaria vesca subsp. vesca
ref|XP_010662626.1|  PREDICTED: LRR receptor-like serine/threonin...  66.2    2e-09   
ref|XP_010646952.1|  PREDICTED: receptor-like protein 12              64.3    2e-09   
ref|XP_008368209.1|  PREDICTED: receptor-like protein 2               65.9    2e-09   
ref|XP_008346104.1|  PREDICTED: probable LRR receptor-like serine...  65.1    3e-09   
ref|XP_008376669.1|  PREDICTED: probable leucine-rich repeat rece...  65.9    3e-09   Malus domestica [apple tree]
ref|XP_007214021.1|  hypothetical protein PRUPE_ppa016515mg           65.9    3e-09   
ref|XP_010672176.1|  PREDICTED: LRR receptor-like serine/threonin...  65.9    3e-09   
ref|XP_008362832.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-09   
ref|XP_002265946.1|  PREDICTED: receptor-like protein kinase 2        65.9    3e-09   Vitis vinifera
ref|XP_008364570.1|  PREDICTED: DNA-damage-repair/toleration prot...  63.2    3e-09   
ref|XP_008372137.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    3e-09   
ref|XP_007214755.1|  hypothetical protein PRUPE_ppa024905mg           65.5    3e-09   
ref|XP_010656643.1|  PREDICTED: uncharacterized protein LOC104880714  65.9    3e-09   
ref|XP_010662437.1|  PREDICTED: receptor-like protein 12 isoform X2   65.1    4e-09   Vitis vinifera
ref|XP_010046668.1|  PREDICTED: leucine-rich repeat receptor-like...  65.5    4e-09   Eucalyptus grandis [rose gum]
ref|XP_003631330.1|  PREDICTED: leucine-rich repeat receptor prot...  65.1    4e-09   
ref|XP_008372118.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    5e-09   
ref|XP_007214106.1|  hypothetical protein PRUPE_ppa017047mg           65.1    5e-09   
emb|CAN79130.1|  hypothetical protein VITISV_029207                   65.1    5e-09   Vitis vinifera
ref|XP_010662436.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    5e-09   Vitis vinifera
ref|XP_008349105.1|  PREDICTED: receptor-like protein 2               62.8    5e-09   
gb|KEH25176.1|  LRR receptor-like kinase family protein               65.1    5e-09   Medicago truncatula
ref|XP_008378408.1|  PREDICTED: DNA-damage-repair/toleration prot...  63.9    5e-09   
ref|XP_006493510.1|  PREDICTED: probable LRR receptor-like serine...  65.1    5e-09   
ref|XP_007021415.1|  Disease resistance family protein / LRR fami...  65.1    5e-09   
gb|KDO38052.1|  hypothetical protein CISIN_1g002556mg                 65.1    5e-09   Citrus sinensis [apfelsine]
ref|XP_008365985.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    5e-09   
ref|XP_009368583.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    5e-09   Pyrus x bretschneideri [bai li]
ref|XP_008372136.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    5e-09   
ref|XP_002264037.2|  PREDICTED: LRR receptor-like serine/threonin...  64.7    6e-09   Vitis vinifera
ref|XP_003631326.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    6e-09   Vitis vinifera
emb|CAN78838.1|  hypothetical protein VITISV_037334                   64.7    6e-09   Vitis vinifera
ref|XP_011463258.1|  PREDICTED: leucine-rich repeat receptor prot...  64.7    6e-09   Fragaria vesca subsp. vesca
ref|XP_010662638.1|  PREDICTED: probable leucine-rich repeat rece...  64.7    7e-09   
ref|XP_008349124.1|  PREDICTED: receptor-like protein kinase 5        64.7    7e-09   
ref|XP_009342322.1|  PREDICTED: receptor-like protein 2               64.3    8e-09   Pyrus x bretschneideri [bai li]
ref|XP_006493513.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    8e-09   
ref|XP_010671924.1|  PREDICTED: probable leucine-rich repeat rece...  64.3    8e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007212434.1|  hypothetical protein PRUPE_ppa017185mg           64.3    8e-09   
ref|XP_008350455.1|  PREDICTED: probable LRR receptor-like serine...  64.3    8e-09   
ref|XP_010105709.1|  LRR receptor-like serine/threonine-protein k...  64.3    8e-09   
ref|XP_009341489.1|  PREDICTED: receptor-like protein 2               64.3    9e-09   
ref|XP_008226024.1|  PREDICTED: probable leucine-rich repeat rece...  64.3    9e-09   
ref|XP_009376584.1|  PREDICTED: receptor-like protein 2               64.3    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_009376560.1|  PREDICTED: receptor-like protein 2               64.3    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_008355014.1|  PREDICTED: receptor-like protein 2               64.3    9e-09   
ref|XP_008352735.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  64.3    9e-09   
ref|XP_010671925.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    9e-09   
ref|XP_009376551.1|  PREDICTED: receptor-like protein 2               63.9    1e-08   
ref|XP_010266617.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   
ref|XP_008345134.1|  PREDICTED: receptor-like protein 2               63.5    1e-08   
ref|XP_009340288.1|  PREDICTED: receptor-like protein 12              63.9    1e-08   
ref|XP_008347020.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   
ref|XP_008358880.1|  PREDICTED: receptor-like protein 2               63.9    1e-08   
ref|XP_008365984.1|  PREDICTED: receptor-like protein 12              62.8    1e-08   
ref|XP_009375609.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   
ref|XP_008375503.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   
ref|XP_008365880.1|  PREDICTED: receptor-like protein 2               63.5    1e-08   
ref|XP_002264905.3|  PREDICTED: LRR receptor-like serine/threonin...  63.9    1e-08   
ref|XP_004295505.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    1e-08   Fragaria vesca subsp. vesca
ref|XP_009342316.1|  PREDICTED: receptor-like protein 2               63.5    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_002514937.1|  serine/threonine-protein kinase bri1, putative   63.5    1e-08   
ref|XP_010671582.1|  PREDICTED: receptor-like protein 12              63.5    1e-08   
ref|XP_002273469.1|  PREDICTED: receptor-like protein 12              63.5    2e-08   Vitis vinifera
ref|XP_007151422.1|  hypothetical protein PHAVU_004G044900g           63.5    2e-08   Phaseolus vulgaris [French bean]
ref|XP_006493493.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...  63.2    2e-08   Citrus sinensis [apfelsine]
ref|XP_007045054.1|  Disease resistance family protein / LRR fami...  63.5    2e-08   
ref|XP_007203166.1|  hypothetical protein PRUPE_ppa025019mg           63.5    2e-08   
ref|XP_009375612.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_008372019.1|  PREDICTED: serine/threonine-protein kinase B...  63.2    2e-08   
gb|KEH16822.1|  LRR receptor-like kinase family protein               63.2    2e-08   Medicago truncatula
ref|XP_011462017.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-08   Fragaria vesca subsp. vesca
gb|KDO56839.1|  hypothetical protein CISIN_1g0483511mg                62.8    2e-08   Citrus sinensis [apfelsine]
gb|KCW86892.1|  hypothetical protein EUGRSUZ_B03475                   63.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_003633783.1|  PREDICTED: probable leucine-rich repeat rece...  63.2    2e-08   Vitis vinifera
ref|XP_010660821.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   
ref|XP_003633794.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   Vitis vinifera
ref|XP_008382164.1|  PREDICTED: receptor-like protein 2               62.8    2e-08   
ref|XP_008383312.1|  PREDICTED: leucine-rich repeat receptor prot...  60.8    2e-08   
emb|CAN64227.1|  hypothetical protein VITISV_011552                   63.2    2e-08   Vitis vinifera
emb|CBI40045.3|  unnamed protein product                              63.2    2e-08   Vitis vinifera
ref|XP_009335210.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  62.8    2e-08   
ref|XP_009335214.1|  PREDICTED: receptor-like protein 2               62.8    2e-08   
ref|XP_009363369.1|  PREDICTED: leucine-rich repeat receptor prot...  62.8    3e-08   Pyrus x bretschneideri [bai li]
gb|KCW86893.1|  hypothetical protein EUGRSUZ_B03476                   62.8    3e-08   Eucalyptus grandis [rose gum]
ref|XP_007013647.1|  Disease resistance family protein / LRR fami...  62.8    3e-08   
ref|XP_009354002.1|  PREDICTED: receptor-like protein 12              62.4    3e-08   
ref|XP_010046670.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  61.2    3e-08   
ref|XP_010662799.1|  PREDICTED: receptor-like protein 12              62.8    3e-08   Vitis vinifera
ref|XP_006421142.1|  hypothetical protein CICLE_v10004251mg           62.4    3e-08   
ref|XP_010662639.1|  PREDICTED: probable leucine-rich repeat rece...  62.4    4e-08   Vitis vinifera
ref|XP_003636154.1|  Receptor-like protein kinase                     61.6    4e-08   
emb|CAN64389.1|  hypothetical protein VITISV_018647                   62.4    4e-08   Vitis vinifera
ref|XP_006422087.1|  hypothetical protein CICLE_v10007014mg           62.4    4e-08   
ref|XP_008231133.1|  PREDICTED: LRR receptor-like serine/threonin...  62.4    4e-08   
ref|XP_006421147.1|  hypothetical protein CICLE_v10006774mg           62.4    4e-08   Citrus clementina [clementine]
ref|XP_007212428.1|  hypothetical protein PRUPE_ppa016649mg           58.5    4e-08   
ref|XP_011080440.1|  PREDICTED: probable LRR receptor-like serine...  62.4    4e-08   Sesamum indicum [beniseed]
gb|KEH25183.1|  leucine-rich receptor-like kinase family protein      61.6    4e-08   Medicago truncatula
ref|XP_010662782.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   Vitis vinifera
ref|XP_003593778.1|  Receptor-like protein kinase                     62.0    5e-08   
ref|XP_010671566.1|  PREDICTED: receptor-like protein 12              62.0    5e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009335209.1|  PREDICTED: receptor-like protein 2               62.0    5e-08   
ref|XP_008358578.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    5e-08   
ref|XP_006494168.1|  PREDICTED: leucine-rich repeat receptor prot...  62.0    5e-08   
ref|XP_011460511.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    5e-08   Fragaria vesca subsp. vesca
ref|XP_004295508.2|  PREDICTED: LRR receptor-like serine/threonin...  62.0    5e-08   Fragaria vesca subsp. vesca
ref|XP_002509533.1|  serine-threonine protein kinase, plant-type,...  61.2    5e-08   
ref|XP_011460553.1|  PREDICTED: probable LRR receptor-like serine...  61.6    6e-08   Fragaria vesca subsp. vesca
ref|XP_010660819.1|  PREDICTED: receptor-like protein 12              62.0    6e-08   
ref|XP_009378505.1|  PREDICTED: receptor-like protein 2               61.2    6e-08   
ref|XP_002514939.1|  serine-threonine protein kinase, plant-type,...  61.6    6e-08   Ricinus communis
ref|XP_007212841.1|  hypothetical protein PRUPE_ppa020791mg           61.6    6e-08   
ref|XP_007214083.1|  hypothetical protein PRUPE_ppa015322mg           61.6    6e-08   
ref|XP_006420957.1|  hypothetical protein CICLE_v10006412mg           61.6    6e-08   
ref|XP_009389815.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    6e-08   
gb|KEH16826.1|  LRR receptor-like kinase                              61.6    6e-08   Medicago truncatula
gb|KDO41677.1|  hypothetical protein CISIN_1g047190mg                 61.6    6e-08   Citrus sinensis [apfelsine]
ref|XP_006470121.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    7e-08   
ref|XP_008383284.1|  PREDICTED: receptor-like protein 12              61.6    7e-08   
ref|XP_009361867.1|  PREDICTED: LRR receptor-like serine/threonin...  60.8    7e-08   Pyrus x bretschneideri [bai li]
gb|KEH25182.1|  LRR receptor-like kinase family protein               61.6    7e-08   Medicago truncatula
gb|AES64031.2|  LRR receptor-like kinase                              61.6    7e-08   Medicago truncatula
ref|XP_008444420.1|  PREDICTED: leucine-rich repeat receptor prot...  61.6    7e-08   Cucumis melo [Oriental melon]
ref|XP_006493087.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    7e-08   
ref|XP_006422085.1|  hypothetical protein CICLE_v10006573mg           61.6    7e-08   
ref|XP_010266618.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006421144.1|  hypothetical protein CICLE_v10007027mg           61.2    8e-08   Citrus clementina [clementine]
ref|XP_003631328.1|  PREDICTED: probable leucine-rich repeat rece...  61.2    8e-08   Vitis vinifera
ref|XP_006378288.1|  hypothetical protein POPTR_0010s06880g           60.8    8e-08   
ref|XP_009363290.1|  PREDICTED: receptor-like protein 12              60.8    8e-08   
ref|XP_008226566.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  60.8    9e-08   Prunus mume [ume]
ref|XP_003631327.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    9e-08   Vitis vinifera
ref|XP_010671922.1|  PREDICTED: receptor-like protein 12              61.2    9e-08   
ref|XP_006490687.1|  PREDICTED: probable LRR receptor-like serine...  61.2    9e-08   Citrus sinensis [apfelsine]
ref|XP_008226025.1|  PREDICTED: receptor-like protein 12              60.8    9e-08   
ref|XP_006421146.1|  hypothetical protein CICLE_v10006889mg           61.2    9e-08   
ref|XP_007214258.1|  hypothetical protein PRUPE_ppa024554mg           61.2    9e-08   
ref|XP_006421141.1|  hypothetical protein CICLE_v10004374mg           60.8    9e-08   
ref|XP_002514847.1|  serine/threonine-protein kinase bri1, putative   61.2    9e-08   
ref|XP_009365386.1|  PREDICTED: receptor-like protein kinase 5        58.2    9e-08   
ref|XP_007021418.1|  Disease resistance family protein / LRR fami...  61.2    1e-07   
ref|XP_008383308.1|  PREDICTED: receptor-like protein 12              60.5    1e-07   
emb|CAN75075.1|  hypothetical protein VITISV_026260                   60.8    1e-07   Vitis vinifera
ref|XP_010662622.1|  PREDICTED: putative leucine-rich repeat rece...  60.5    1e-07   Vitis vinifera
ref|XP_007045051.1|  Serine-threonine protein kinase, plant-type,...  57.4    1e-07   
ref|XP_008355404.1|  PREDICTED: receptor-like protein 2               59.3    1e-07   
ref|XP_009364149.1|  PREDICTED: receptor-like protein 2               60.8    1e-07   
emb|CBI22585.3|  unnamed protein product                              60.5    1e-07   Vitis vinifera
ref|XP_008346107.1|  PREDICTED: probable leucine-rich repeat rece...  60.1    1e-07   
ref|XP_006348987.1|  PREDICTED: LRR receptor-like serine/threonin...  60.8    1e-07   Solanum tuberosum [potatoes]
ref|XP_008355013.1|  PREDICTED: receptor-like protein 2               60.1    1e-07   
gb|KCW86891.1|  hypothetical protein EUGRSUZ_B03474                   60.5    1e-07   Eucalyptus grandis [rose gum]
ref|XP_010087193.1|  Receptor-like protein 12                         60.1    1e-07   
ref|XP_002268246.1|  PREDICTED: LRR receptor-like serine/threonin...  60.5    2e-07   
ref|XP_009389813.1|  PREDICTED: receptor-like protein 12              60.5    2e-07   
ref|XP_009389812.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
ref|XP_007212603.1|  hypothetical protein PRUPE_ppa016919mg           60.1    2e-07   
ref|XP_010646953.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   Vitis vinifera
ref|XP_006421149.1|  hypothetical protein CICLE_v10004252mg           60.1    2e-07   
ref|XP_007151421.1|  hypothetical protein PHAVU_004G044800g           60.1    2e-07   Phaseolus vulgaris [French bean]
ref|XP_006493495.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    2e-07   Citrus sinensis [apfelsine]
ref|XP_006421133.1|  hypothetical protein CICLE_v10006997mg           59.7    2e-07   
gb|KHN06925.1|  Probably inactive leucine-rich repeat receptor-li...  59.7    2e-07   Glycine soja [wild soybean]
ref|XP_006421143.1|  hypothetical protein CICLE_v10004253mg           59.7    2e-07   Citrus clementina [clementine]
ref|XP_009366031.1|  PREDICTED: probable LRR receptor-like serine...  59.3    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_007045500.1|  Serine-threonine protein kinase, plant-type,...  59.7    3e-07   
emb|CBI22612.3|  unnamed protein product                              59.3    3e-07   Vitis vinifera
emb|CBI22716.3|  unnamed protein product                              59.7    3e-07   Vitis vinifera
ref|XP_006490598.1|  PREDICTED: probable LRR receptor-like serine...  59.7    3e-07   
ref|XP_009613131.1|  PREDICTED: probable leucine-rich repeat rece...  59.7    3e-07   Nicotiana tomentosiformis
ref|XP_006490597.1|  PREDICTED: probable LRR receptor-like serine...  59.7    3e-07   
ref|XP_006493507.1|  PREDICTED: probable LRR receptor-like serine...  59.3    3e-07   Citrus sinensis [apfelsine]
ref|XP_002268170.2|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   Vitis vinifera
ref|XP_008226570.1|  PREDICTED: receptor-like protein 2               58.9    4e-07   
ref|XP_003593776.1|  Receptor protein kinase-like protein             59.3    4e-07   
gb|AES64027.2|  LRR kinase family protein                             59.3    4e-07   Medicago truncatula
ref|XP_007045057.1|  Disease resistance family protein / LRR fami...  58.9    4e-07   
ref|XP_011462011.1|  PREDICTED: probable leucine-rich repeat rece...  59.3    4e-07   Fragaria vesca subsp. vesca
gb|KDO56861.1|  hypothetical protein CISIN_1g039964mg                 56.6    4e-07   Citrus sinensis [apfelsine]
ref|XP_006421134.1|  hypothetical protein CICLE_v10006453mg           58.9    4e-07   Citrus clementina [clementine]
gb|KDO41706.1|  hypothetical protein CISIN_1g0098352mg                55.5    4e-07   Citrus sinensis [apfelsine]
ref|XP_008226593.1|  PREDICTED: receptor-like protein 2               58.9    4e-07   Prunus mume [ume]
gb|KCW53035.1|  hypothetical protein EUGRSUZ_J02327                   58.9    4e-07   Eucalyptus grandis [rose gum]
ref|XP_010034664.1|  PREDICTED: LRR receptor-like serine/threonin...  58.9    5e-07   Eucalyptus grandis [rose gum]
emb|CBI21366.3|  unnamed protein product                              58.9    5e-07   Vitis vinifera
emb|CAN80087.1|  hypothetical protein VITISV_011297                   58.9    5e-07   Vitis vinifera
ref|XP_007021416.1|  Disease resistance family protein / LRR fami...  58.5    5e-07   
ref|XP_002273126.2|  PREDICTED: leucine-rich repeat receptor prot...  58.9    5e-07   
ref|XP_007212605.1|  hypothetical protein PRUPE_ppa016939mg           58.5    5e-07   
ref|XP_009356800.1|  PREDICTED: receptor-like protein 2               58.5    5e-07   
emb|CBI17238.3|  unnamed protein product                              58.5    5e-07   
emb|CAN67736.1|  hypothetical protein VITISV_022720                   58.9    6e-07   
ref|XP_008226590.1|  PREDICTED: receptor-like protein 2               58.5    6e-07   
ref|XP_008338509.1|  PREDICTED: receptor-like protein 2               58.5    6e-07   
ref|XP_010650299.1|  PREDICTED: probable LRR receptor-like serine...  58.5    6e-07   
ref|XP_009389222.1|  PREDICTED: probable leucine-rich repeat rece...  58.5    6e-07   
gb|KDO41143.1|  hypothetical protein CISIN_1g0401091mg                56.6    7e-07   
ref|XP_009389817.1|  PREDICTED: receptor-like protein 12              58.5    7e-07   
ref|XP_008384512.1|  PREDICTED: receptor-like protein 2               58.2    7e-07   
ref|XP_008226514.1|  PREDICTED: receptor-like protein 2               58.2    7e-07   
ref|XP_008367532.1|  PREDICTED: probable LRR receptor-like serine...  58.5    7e-07   
ref|XP_008226568.1|  PREDICTED: receptor-like protein 2               58.2    7e-07   
emb|CAN71913.1|  hypothetical protein VITISV_032859                   58.2    8e-07   
ref|XP_011462014.1|  PREDICTED: receptor-like protein kinase 2        57.4    8e-07   
emb|CAN78140.1|  hypothetical protein VITISV_019846                   58.2    8e-07   
ref|XP_010650298.1|  PREDICTED: LRR receptor-like serine/threonin...  58.2    8e-07   
ref|XP_007021417.1|  Disease resistance family protein / LRR fami...  58.2    8e-07   
ref|XP_007219202.1|  hypothetical protein PRUPE_ppa017031mg           58.2    8e-07   
ref|XP_009385349.1|  PREDICTED: LRR receptor-like serine/threonin...  58.2    8e-07   
ref|XP_009350829.1|  PREDICTED: LRR receptor-like serine/threonin...  57.8    8e-07   
ref|XP_010662760.1|  PREDICTED: LRR receptor-like serine/threonin...  58.2    8e-07   
ref|XP_008226587.1|  PREDICTED: receptor-like protein 2               58.2    8e-07   
ref|XP_007226803.1|  hypothetical protein PRUPE_ppa017831mg           58.2    8e-07   
ref|XP_006362648.1|  PREDICTED: LRR receptor-like serine/threonin...  58.2    9e-07   
ref|XP_009378506.1|  PREDICTED: receptor-like protein 2               57.8    9e-07   
ref|XP_008232926.1|  PREDICTED: LRR receptor-like serine/threonin...  57.8    9e-07   
ref|XP_009342314.1|  PREDICTED: receptor-like protein 2               57.8    9e-07   
ref|XP_010675997.1|  PREDICTED: LRR receptor-like serine/threonin...  57.8    1e-06   
emb|CAN79880.1|  hypothetical protein VITISV_031344                   57.8    1e-06   
ref|XP_009349424.1|  PREDICTED: receptor-like protein 2               57.8    1e-06   
ref|XP_008231965.1|  PREDICTED: LRR receptor-like serine/threonin...  57.8    1e-06   
emb|CAN61668.1|  hypothetical protein VITISV_037018                   57.4    1e-06   
ref|XP_010034666.1|  PREDICTED: probable LRR receptor-like serine...  57.8    1e-06   
ref|XP_009352803.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  57.8    1e-06   
ref|XP_010111587.1|  LRR receptor-like serine/threonine-protein k...  57.8    1e-06   
ref|XP_010046665.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...  56.6    1e-06   
emb|CBI22742.3|  unnamed protein product                              57.8    1e-06   
ref|XP_008237614.1|  PREDICTED: receptor-like protein 2               57.0    1e-06   
ref|XP_011467703.1|  PREDICTED: probable leucine-rich repeat rece...  57.8    1e-06   
ref|XP_011467702.1|  PREDICTED: probable leucine-rich repeat rece...  57.8    1e-06   
ref|XP_011467701.1|  PREDICTED: probable leucine-rich repeat rece...  57.8    1e-06   
ref|XP_004296172.1|  PREDICTED: receptor-like protein 2               56.6    1e-06   
ref|XP_011468514.1|  PREDICTED: receptor-like protein kinase BRI1...  55.1    1e-06   
ref|XP_003593777.1|  LRR receptor-like serine/threonine-protein k...  57.8    1e-06   
ref|XP_006447093.1|  hypothetical protein CICLE_v10018317mg           57.8    1e-06   
gb|KCW53036.1|  hypothetical protein EUGRSUZ_J02330                   57.8    1e-06   
ref|XP_008227330.1|  PREDICTED: receptor-like protein 2               57.8    1e-06   
ref|XP_009346965.1|  PREDICTED: receptor-like protein 12              57.8    1e-06   
ref|XP_008226020.1|  PREDICTED: receptor-like protein 12              57.8    1e-06   
emb|CAN65307.1|  hypothetical protein VITISV_031879                   57.4    1e-06   
ref|XP_008226567.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  57.4    1e-06   
gb|KHN09274.1|  Putative LRR receptor-like serine/threonine-prote...  57.4    1e-06   
ref|XP_003634127.2|  PREDICTED: LRR receptor-like serine/threonin...  57.4    1e-06   
ref|XP_002514938.1|  serine-threonine protein kinase, plant-type,...  56.2    1e-06   
ref|XP_011461673.1|  PREDICTED: receptor-like protein 2               57.4    1e-06   
ref|XP_003593773.1|  Receptor protein kinase-like protein             57.4    1e-06   
ref|XP_010646995.1|  PREDICTED: LRR receptor-like serine/threonin...  57.4    1e-06   
ref|XP_003635305.2|  PREDICTED: leucine-rich repeat receptor prot...  57.4    1e-06   
ref|XP_003635304.1|  PREDICTED: LRR receptor-like serine/threonin...  57.4    1e-06   
gb|AES64024.2|  Serine/Threonine kinase, plant-type protein           57.4    1e-06   
ref|XP_010660777.1|  PREDICTED: leucine-rich repeat receptor prot...  57.4    1e-06   
gb|KCW53034.1|  hypothetical protein EUGRSUZ_J02326                   57.4    1e-06   
emb|CBI40046.3|  unnamed protein product                              57.4    1e-06   
gb|KCW45179.1|  hypothetical protein EUGRSUZ_L01193                   57.4    1e-06   
ref|XP_010040481.1|  PREDICTED: probable LRR receptor-like serine...  57.4    1e-06   
ref|XP_010033401.1|  PREDICTED: receptor-like protein 12              57.4    1e-06   
ref|XP_008384510.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  55.8    1e-06   
ref|XP_003593779.1|  Receptor-like protein kinase                     57.4    2e-06   
ref|XP_010646798.1|  PREDICTED: leucine-rich repeat receptor prot...  57.4    2e-06   
ref|XP_008226027.1|  PREDICTED: receptor-like protein 12              57.0    2e-06   
ref|XP_008226592.1|  PREDICTED: receptor-like protein 2               57.0    2e-06   
ref|XP_007021422.1|  Disease resistance family protein / LRR fami...  57.0    2e-06   
ref|XP_006362649.1|  PREDICTED: uncharacterized protein LOC102598021  57.4    2e-06   
gb|KDO50394.1|  hypothetical protein CISIN_1g0477971mg                56.6    2e-06   
ref|XP_010662758.1|  PREDICTED: receptor-like protein 12 isoform X2   57.0    2e-06   
ref|XP_004301069.1|  PREDICTED: receptor-like protein 2               57.0    2e-06   
ref|XP_009758235.1|  PREDICTED: probable leucine-rich repeat rece...  57.0    2e-06   
ref|XP_011001954.1|  PREDICTED: probable LRR receptor-like serine...  57.0    2e-06   
ref|XP_011001953.1|  PREDICTED: probable LRR receptor-like serine...  57.0    2e-06   
ref|XP_008232801.1|  PREDICTED: probable LRR receptor-like serine...  57.0    2e-06   
ref|XP_007221190.1|  hypothetical protein PRUPE_ppa021712mg           57.0    2e-06   
ref|XP_003635312.1|  PREDICTED: leucine-rich repeat receptor prot...  57.0    2e-06   
ref|XP_003635224.1|  PREDICTED: leucine-rich repeat receptor prot...  57.0    2e-06   
ref|XP_010662757.1|  PREDICTED: receptor-like protein 12 isoform X1   57.0    2e-06   
ref|XP_010662750.1|  PREDICTED: receptor-like protein 2               55.5    2e-06   
ref|XP_010040482.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  56.6    2e-06   
ref|XP_008232130.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  56.6    2e-06   
ref|XP_010087568.1|  LRR receptor-like serine/threonine-protein k...  56.6    2e-06   
ref|XP_008384509.1|  PREDICTED: receptor-like protein 2               56.2    2e-06   
ref|XP_006362639.1|  PREDICTED: LRR receptor-like serine/threonin...  56.6    2e-06   
ref|XP_006493499.1|  PREDICTED: probable LRR receptor-like serine...  55.5    2e-06   
gb|KEH25989.1|  receptor-like protein, putative                       56.6    3e-06   
ref|XP_007219665.1|  hypothetical protein PRUPE_ppa025228mg           56.2    3e-06   
gb|KHN02657.1|  LRR receptor-like serine/threonine-protein kinase...  56.6    3e-06   
emb|CAN82211.1|  hypothetical protein VITISV_027552                   56.2    3e-06   
ref|XP_007219249.1|  hypothetical protein PRUPE_ppa018051mg           56.2    3e-06   
ref|XP_009629931.1|  PREDICTED: receptor-like protein 12              56.2    3e-06   
emb|CBI22583.3|  unnamed protein product                              56.2    3e-06   
emb|CDP19196.1|  unnamed protein product                              56.2    3e-06   
ref|XP_010662805.1|  PREDICTED: LRR receptor-like serine/threonin...  56.2    3e-06   
ref|XP_010106115.1|  LRR receptor-like serine/threonine-protein k...  56.2    3e-06   
ref|XP_010646994.1|  PREDICTED: probable LRR receptor-like serine...  56.2    3e-06   
gb|KEH25977.1|  receptor-like protein                                 56.2    3e-06   
ref|XP_007214066.1|  hypothetical protein PRUPE_ppa017609mg           56.2    3e-06   
ref|XP_006422068.1|  hypothetical protein CICLE_v10007021mg           55.8    4e-06   
emb|CAN77037.1|  hypothetical protein VITISV_012666                   56.2    4e-06   
gb|KEH25922.1|  receptor-like protein                                 56.2    4e-06   
ref|XP_007212410.1|  hypothetical protein PRUPE_ppa016435mg           56.2    4e-06   
ref|XP_004296307.1|  PREDICTED: receptor-like protein 2               55.8    4e-06   
ref|XP_009591631.1|  PREDICTED: LRR receptor-like serine/threonin...  55.8    4e-06   
gb|KEH25979.1|  receptor-like protein                                 56.2    4e-06   
emb|CDP20968.1|  unnamed protein product                              55.8    4e-06   
ref|XP_008393125.1|  PREDICTED: receptor-like protein kinase 2        55.8    4e-06   
gb|KEH25981.1|  disease resistance family protein/LRR protein, pu...  55.8    4e-06   
gb|KEH25986.1|  leucine-rich receptor-like kinase family protein,...  55.8    4e-06   
ref|XP_004243038.2|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-06   
ref|XP_011457601.1|  PREDICTED: receptor-like protein 2               55.5    5e-06   
ref|XP_008351469.1|  PREDICTED: receptor-like protein 2               55.5    5e-06   
ref|XP_009367876.1|  PREDICTED: probable LRR receptor-like serine...  55.8    5e-06   
gb|KEH25999.1|  receptor-like protein                                 55.8    5e-06   
gb|AAR28378.1|  EIX receptor 2                                        55.8    5e-06   
ref|XP_010646797.1|  PREDICTED: receptor-like protein 12              55.1    5e-06   
ref|XP_004296198.1|  PREDICTED: probable leucine-rich repeat rece...  55.8    5e-06   
ref|XP_008245522.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  55.5    5e-06   
ref|XP_009398838.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    5e-06   
gb|KEH25985.1|  leucine-rich receptor-like kinase family protein,...  55.5    5e-06   
ref|XP_009367845.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    5e-06   
ref|XP_010662623.1|  PREDICTED: receptor-like protein 12 isoform X1   55.5    5e-06   
ref|XP_009355165.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    5e-06   
ref|XP_009786972.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    6e-06   
ref|XP_009610906.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    6e-06   
gb|KEH36653.1|  LRR receptor-like kinase                              55.1    6e-06   
ref|XP_009367822.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    6e-06   
emb|CBI22713.3|  unnamed protein product                              55.1    6e-06   
ref|XP_009786971.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    6e-06   
ref|XP_006493496.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    6e-06   
ref|XP_009367839.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    7e-06   
ref|XP_002514777.1|  serine-threonine protein kinase, plant-type,...  55.1    7e-06   
ref|XP_009364147.1|  PREDICTED: receptor-like protein 2               55.1    7e-06   
ref|XP_002526134.1|  serine-threonine protein kinase, plant-type,...  54.3    7e-06   
ref|XP_008384515.1|  PREDICTED: receptor-like protein 2               55.1    7e-06   
ref|XP_008232191.1|  PREDICTED: receptor-like protein 2               55.1    7e-06   
ref|XP_002318355.2|  hypothetical protein POPTR_0012s01080g           55.1    7e-06   
ref|XP_008442166.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    7e-06   
emb|CAN78141.1|  hypothetical protein VITISV_019847                   55.1    8e-06   
ref|XP_009340165.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    8e-06   
ref|XP_006421148.1|  hypothetical protein CICLE_v10006496mg           55.1    8e-06   
ref|XP_002267411.3|  PREDICTED: polygalacturonase inhibitor-like      54.7    8e-06   
ref|XP_008344707.1|  PREDICTED: receptor-like protein 2               53.1    8e-06   
ref|XP_009601230.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    8e-06   
ref|XP_009340164.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    8e-06   
ref|XP_008353997.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    9e-06   
ref|XP_002276171.1|  PREDICTED: receptor-like protein 12              55.1    9e-06   
gb|KEH25993.1|  receptor-like protein, putative                       54.7    9e-06   
ref|XP_006599543.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    9e-06   
ref|XP_006599542.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    9e-06   
ref|XP_006599541.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    9e-06   
ref|XP_008226594.1|  PREDICTED: receptor-like protein 2               54.7    9e-06   
gb|KDO56862.1|  hypothetical protein CISIN_1g0025142mg                54.7    9e-06   
ref|XP_009352118.1|  PREDICTED: LRR receptor-like serine/threonin...  54.7    9e-06   
ref|XP_006599537.1|  PREDICTED: LRR receptor-like serine/threonin...  54.7    9e-06   
ref|XP_008348860.1|  PREDICTED: receptor-like protein 2               54.7    9e-06   
ref|XP_007213308.1|  hypothetical protein PRUPE_ppb023904mg           54.7    9e-06   
emb|CAN61943.1|  hypothetical protein VITISV_017886                   54.7    9e-06   
ref|XP_006599536.1|  PREDICTED: LRR receptor-like serine/threonin...  54.7    9e-06   
ref|XP_006599535.1|  PREDICTED: LRR receptor-like serine/threonin...  54.7    1e-05   
ref|XP_006600027.1|  PREDICTED: probable LRR receptor-like serine...  54.7    1e-05   
ref|XP_011462085.1|  PREDICTED: receptor-like protein 2               52.4    1e-05   
ref|XP_010662800.1|  PREDICTED: leucine-rich repeat receptor prot...  54.7    1e-05   
ref|XP_009367863.1|  PREDICTED: receptor-like protein 12              54.7    1e-05   
ref|XP_008226510.1|  PREDICTED: receptor-like protein 2               54.7    1e-05   
ref|XP_010662747.1|  PREDICTED: leucine-rich repeat receptor-like...  54.3    1e-05   
ref|XP_004143731.1|  PREDICTED: receptor-like protein 12-like         54.7    1e-05   
ref|XP_007214181.1|  hypothetical protein PRUPE_ppa019611mg           54.3    1e-05   
ref|XP_009389801.1|  PREDICTED: receptor-like protein 12              54.3    1e-05   
ref|XP_007144181.1|  hypothetical protein PHAVU_007G135200g           54.3    1e-05   
ref|XP_006599971.1|  PREDICTED: LRR receptor-like serine/threonin...  54.3    1e-05   
ref|XP_006422088.1|  hypothetical protein CICLE_v10007102mg           54.3    1e-05   
gb|KEH25992.1|  receptor-like protein                                 54.3    1e-05   
emb|CBI26541.3|  unnamed protein product                              54.3    1e-05   
ref|XP_006600020.1|  PREDICTED: LRR receptor-like serine/threonin...  54.3    1e-05   
ref|XP_007214288.1|  hypothetical protein PRUPE_ppb000367mg           54.3    1e-05   
ref|XP_011469026.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    1e-05   
ref|XP_008345386.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  54.3    1e-05   
ref|XP_004308368.2|  PREDICTED: probable LRR receptor-like serine...  54.3    1e-05   
ref|XP_007204120.1|  hypothetical protein PRUPE_ppa026039mg           54.3    1e-05   
ref|XP_006490686.1|  PREDICTED: LRR receptor-like serine/threonin...  54.3    1e-05   
ref|XP_006490685.1|  PREDICTED: probable LRR receptor-like serine...  54.3    1e-05   
ref|XP_009340411.1|  PREDICTED: probable leucine-rich repeat rece...  54.3    1e-05   
ref|XP_008343401.1|  PREDICTED: putative leucine-rich repeat rece...  53.9    2e-05   
ref|XP_008226573.1|  PREDICTED: receptor-like protein 2               53.9    2e-05   
ref|XP_010024307.1|  PREDICTED: leucine-rich repeat receptor-like...  53.9    2e-05   
ref|XP_008358807.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  53.9    2e-05   
ref|XP_008349355.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  53.9    2e-05   
ref|XP_010650302.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    2e-05   
ref|XP_008245082.1|  PREDICTED: receptor-like protein 2               53.9    2e-05   
ref|XP_009357573.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  53.5    2e-05   
ref|XP_009357575.1|  PREDICTED: receptor-like protein 2               53.9    2e-05   
ref|XP_008240708.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  53.9    2e-05   
ref|XP_011460550.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-05   
ref|XP_009340406.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    2e-05   
ref|XP_008226578.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  53.9    2e-05   
ref|XP_008244851.1|  PREDICTED: receptor-like protein 2               53.9    2e-05   
gb|KHN14053.1|  LRR receptor-like serine/threonine-protein kinase...  53.5    2e-05   
ref|XP_007220047.1|  hypothetical protein PRUPE_ppa026338mg           53.9    2e-05   
ref|XP_006600026.1|  PREDICTED: leucine-rich repeat receptor prot...  53.9    2e-05   
ref|XP_006590112.1|  PREDICTED: leucine-rich repeat receptor prot...  53.5    2e-05   
emb|CDO98515.1|  unnamed protein product                              53.5    2e-05   
gb|KDO38587.1|  hypothetical protein CISIN_1g043041mg                 53.1    2e-05   
ref|XP_009367835.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-05   
ref|XP_008382158.1|  PREDICTED: receptor-like protein 2               53.1    2e-05   
ref|XP_004308379.1|  PREDICTED: receptor-like protein 12              53.1    2e-05   
gb|KCW45178.1|  hypothetical protein EUGRSUZ_L011921                  52.8    2e-05   
ref|XP_011462204.1|  PREDICTED: receptor-like protein 2               51.2    2e-05   
ref|XP_009367821.1|  PREDICTED: probable LRR receptor-like serine...  53.1    2e-05   
ref|XP_009371763.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    2e-05   
ref|XP_009389805.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    2e-05   
gb|KJB61907.1|  hypothetical protein B456_009G390200                  53.5    2e-05   
ref|XP_009389814.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    2e-05   



>ref|XP_010672172.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672173.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672174.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672175.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
Length=997

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             ++S+TLGFI+G WGVCG+L+LK SWR A+FQF +D ++KLC  + V  A+ +R
Sbjct  941  LYISVTLGFIIGFWGVCGSLVLKTSWRHAFFQFFDDMRDKLCVMVSVKKARVQR  994



>ref|XP_008226203.1| PREDICTED: receptor-like protein 12 [Prunus mume]
Length=982

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGF+LG WGVCGTL++K SWR AYF+F ++ K+K+   IV+  A+ +R
Sbjct  924  FYVSMALGFVLGFWGVCGTLLVKKSWRYAYFRFFDNTKDKVTLAIVLKVARLQR  977



>ref|XP_007031845.1| Serine/threonine-protein kinase bri1, putative [Theobroma cacao]
 gb|EOY02771.1| Serine/threonine-protein kinase bri1, putative [Theobroma cacao]
Length=1025

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             F++S+  GF++G WGVCG LILK SWR  YFQFL+DKKE++   + +  A+ +R M
Sbjct  963   FYISMGPGFVVGFWGVCGPLILKKSWRRVYFQFLDDKKERVMVCVSLKLARLRRSM  1018



>ref|XP_007214009.1| hypothetical protein PRUPE_ppa014796mg [Prunus persica]
 gb|EMJ15208.1| hypothetical protein PRUPE_ppa014796mg [Prunus persica]
Length=1013

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F+VS+ LGF++G WGVCGTL+LK SWR AYFQF +D K+K+   I +  A  +R
Sbjct  958   FYVSMVLGFVVGFWGVCGTLLLKKSWRYAYFQFFDDIKDKVSLAIALKLAHLQR  1011



>ref|XP_008371982.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=891

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WGVCG+LILK SWR AYFQF ++ K+K+   I +  A+ +R
Sbjct  833  FYVSMVLGFIVGFWGVCGSLILKTSWRYAYFQFFDNIKDKVALAIALKVARFQR  886



>emb|CAN71149.1| hypothetical protein VITISV_040339 [Vitis vinifera]
Length=925

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FFVS+ LGFI+G WGVCGTLI+K+SWR AYF+F+E  K++L   + +  A+  R
Sbjct  870  FFVSMGLGFIIGFWGVCGTLIIKNSWRYAYFRFVEKMKDRLLLAVALNVARRTR  923



>ref|XP_002273824.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=990

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FFVS+ LGFI+G WGVCGTLI+K+SWR AYF+F+E  K++L   + +  A+  R
Sbjct  935  FFVSMGLGFIIGFWGVCGTLIIKNSWRYAYFRFVEKMKDRLLLAVALNVARRTR  988



>ref|XP_007212689.1| hypothetical protein PRUPE_ppa018526m1g, partial [Prunus persica]
 gb|EMJ13888.1| hypothetical protein PRUPE_ppa018526m1g, partial [Prunus persica]
Length=214

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WGVCGTL+LK SWR AYF+F +D K+K+   I +  A+ +R
Sbjct  156  FYVSMILGFIVGFWGVCGTLLLKKSWRYAYFRFFDDTKDKVTLAIALKVARLQR  209



>ref|XP_009368629.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=893

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI G WGVCGTLI+K SWR AYF+F +D K+K+   I +  A+ +R
Sbjct  838  LYVSITLGFITGFWGVCGTLIIKKSWRYAYFRFFDDMKDKVALAIALKVAQLQR  891



>ref|XP_006447088.1| hypothetical protein CICLE_v10017744mg [Citrus clementina]
 ref|XP_006470122.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Citrus sinensis]
 gb|ESR60328.1| hypothetical protein CICLE_v10017744mg [Citrus clementina]
Length=917

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             FVS+ LGFI+G WGVCGTLI+K SWR AYFQF +  K++L T + +   + KR M
Sbjct  853  LFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKM  908



>ref|XP_008383306.1| PREDICTED: serine/threonine-protein kinase BRI1-like 1 [Malus 
domestica]
Length=537

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAK  322
            F  +VS+TLGFI G WGVCGTLI+K SWR AYF+F +D K+K+   I +  AK
Sbjct  482  FWLYVSITLGFITGFWGVCGTLIVKKSWRYAYFRFFDDMKDKVALAIALKVAK  534



>ref|XP_003633782.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=958

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FFVS+ LGFI+G WGVCGTLI+K SWR AYF+F+E  K++L   + +  A+  R
Sbjct  903  FFVSMGLGFIIGFWGVCGTLIIKTSWRYAYFRFVEKMKDRLLLAVALNVARLTR  956



>gb|KEH25178.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=946

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VSL LGFI+G WGVCGTL++K SWR AYF+F  + K+ +  T+ V+  + K+
Sbjct  885  FGFYVSLVLGFIIGFWGVCGTLVIKTSWRRAYFKFFNNMKDWIYVTLAVFVNRLKK  940



>ref|XP_009365385.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=767

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
             +VS+ LGFI+G WGVCGTLILK SWR AYFQF +D K+K+   I +  A+ K
Sbjct  711  LYVSVILGFIVGFWGVCGTLILKTSWRYAYFQFFDDIKDKVALAIALKVARFK  763



>ref|XP_009365382.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=1047

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
              +VS+ LGFI+G WGVCGTLILK SWR AYFQF +D K+K+   I +  A+ K
Sbjct  991   LYVSVILGFIVGFWGVCGTLILKTSWRYAYFQFFDDIKDKVALAIALKVARFK  1043



>ref|XP_007024895.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY27517.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=992

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGVS  298
            F++ + +GF+LG WGVCGTL+LK SWR AYFQF+++ KEK    I V  A+ +R +  S
Sbjct  930  FYIGILVGFLLGFWGVCGTLLLKKSWRLAYFQFIDEGKEKASMFIAVSLARWQRKLDSS  988



>gb|KEH16825.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=876

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VSL LGFI+G WGVCGTL++K SWR AYF+F  + K+ +  T+ V+  + K+
Sbjct  815  FGFYVSLVLGFIIGFWGVCGTLVIKTSWRRAYFKFFNNMKDWIYVTLAVFVNRLKK  870



>ref|XP_008349126.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=376

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI G WGVCGTLI+K SWR AYF F +D K+K+   IV+  A+ +R
Sbjct  321  LYVSITLGFITGFWGVCGTLIVKKSWRYAYFHFFDDMKDKVALAIVLKMARLQR  374



>ref|XP_011462013.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Fragaria vesca subsp. vesca]
Length=1093

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
              +VS+ LGFI+G WGVCGTL++K SWR AYF+F +D K K+   I V  A+ +R
Sbjct  1037  LYVSIALGFIIGFWGVCGTLLVKKSWRHAYFRFFDDNKVKIIVAIAVKVARLRR  1090



>ref|XP_008364270.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=741

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WGVCGTLILK SWR AYFQF ++ K+ +   I +   + +R
Sbjct  683  FYVSMVLGFIVGFWGVCGTLILKTSWRYAYFQFFDNIKDNVALAIALKVTRFRR  736



>ref|XP_008364263.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Malus domestica]
Length=1032

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F+VS+ LGFI+G WG+CGTLILK SWR AYFQF ++ ++K+   I +  A  KR
Sbjct  974   FYVSVVLGFIVGFWGICGTLILKTSWRYAYFQFFDNIEDKIALAIALKVACFKR  1027



>ref|XP_008372144.1| PREDICTED: uncharacterized protein LOC103435527 [Malus domestica]
Length=205

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFILG WGVCGTLILK SWR AYFQF  + K+K+  TI +  A+ + 
Sbjct  147  FYVSVVLGFILGFWGVCGTLILKTSWRYAYFQFFNNIKDKVELTIALSMARFRN  200



>ref|XP_008354989.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=1004

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WG+CGTLILK SWR AY+QF ++ K+K+   I +  A  KR
Sbjct  946  FYVSVVLGFIVGFWGICGTLILKTSWRYAYYQFFDNIKDKVALAIALKVACFKR  999



>ref|XP_008372146.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=1011

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F+ ++ LGFI+G WGVCGTLILK SWR AYFQF ++ K+K+   I +  A+ +R
Sbjct  948   FYATVVLGFIVGFWGVCGTLILKTSWRYAYFQFFDNIKDKVALAIALKVARFQR  1001



>ref|XP_007214101.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica]
 gb|EMJ15300.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica]
Length=977

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WGVCGTL+LK SWR AYF+F ++ K+K+   I +  A+ ++
Sbjct  919  FYVSMILGFIVGFWGVCGTLLLKKSWRYAYFRFFDNTKDKVTLAIALKVARLQK  972



>ref|XP_009363245.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=991

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WG+CGTLILK SWR AYF+F ++ K+K+   I +     KR
Sbjct  935  FYVSVVLGFIVGFWGICGTLILKTSWRYAYFEFFDNIKDKVALAIALKATCFKR  988



>ref|XP_009363373.1| PREDICTED: uncharacterized protein LOC103953355 [Pyrus x bretschneideri]
Length=204

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAK  322
            F+VS+ LGFILG WGVCGTLILK SWR AYFQF  + K+K+  TI +  A+
Sbjct  146  FYVSVVLGFILGFWGVCGTLILKTSWRYAYFQFFNNIKDKVELTIALSMAR  196



>ref|XP_008225907.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=1079

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGA  325
             F+ S TLGFI+G WGVCGTL++K SWR AYFQF ++ +EK   T+ +  A
Sbjct  1024  FYASTTLGFIIGFWGVCGTLVVKKSWRYAYFQFFDNVREKATLTVALKAA  1073



>ref|XP_009363343.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Pyrus x bretschneideri]
Length=897

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            F+VS+ LGFI+G WGVCGTLILK SWR AYFQF ++ K+K+   I +
Sbjct  839  FYVSMVLGFIVGFWGVCGTLILKTSWRYAYFQFFDNIKDKVALAIAL  885



>ref|XP_002270042.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1024

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             F+VS+ LGFI+G WGVCGTL+L +SWR AYFQFL   K+ L   I +  A+ +R +
Sbjct  967   FYVSVALGFIVGFWGVCGTLLLNNSWRYAYFQFLNKIKDWLYVIIAINMARLQRSL  1022



>ref|XP_008365987.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
Length=540

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI   WGVCGTLI+K SWR AYF F +D K+K+   I +  A+ +R
Sbjct  485  LYVSITLGFITSFWGVCGTLIVKKSWRYAYFHFFDDMKDKVALAIALKVARLQR  538



>ref|XP_011462208.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Fragaria vesca subsp. vesca]
Length=601

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+ S  LGFI+G W VCGTLILK SWR AYFQF +  K+K+  +I +  A+ +R
Sbjct  546  FYTSAVLGFIVGFWSVCGTLILKKSWRYAYFQFFDHIKDKVTLSIALRAARLQR  599



>gb|KDO43313.1| hypothetical protein CISIN_1g0376511mg, partial [Citrus sinensis]
Length=172

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             FVS+ LGFI+G WGVCGTLI+K SWR AYFQF +  K++L T + +   + KR M
Sbjct  108  LFVSVGLGFIMGFWGVCGTLIIKKSWRYAYFQFFDKIKDQLLTFLALSVVRLKRKM  163



>ref|XP_006470464.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=807

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WG  G+L+L  SWR AY+QFL+  KE+LCT  V   AK +R
Sbjct  754  FYVSVALGFIVGFWGFVGSLLLNRSWRRAYWQFLDHTKERLCTNTVPNVAKRQR  807



>ref|XP_009351266.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=431

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGFI+G WGVCGTLILK SWR AYFQF ++ K+K+   I +  A+ +R
Sbjct  373  FYISMVLGFIVGFWGVCGTLILKTSWRYAYFQFFDNIKDKVALAIALKVARFQR  426



>ref|XP_008349122.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Malus domestica]
Length=844

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI   WGVCGTLI+K SWR AYF F +D K+K+   I +  A+ +R
Sbjct  789  LYVSITLGFITSFWGVCGTLIVKKSWRYAYFHFFDDMKDKVALAIALKVARLQR  842



>ref|XP_009365387.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=674

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
             +VS+  GFI+G WGVCGT ILK SWR AYFQF +D K+K+   I +  A+ K
Sbjct  618  LYVSVVFGFIVGFWGVCGTFILKTSWRYAYFQFFDDIKDKVALAIALKMARFK  670



>ref|XP_009365390.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Pyrus 
x bretschneideri]
Length=224

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+ LGFI+G W VCGTLILK SWR AYFQF +D K+K+   I +  A  KR
Sbjct  168  LYVSMVLGFIVGFWAVCGTLILKTSWRYAYFQFFDDIKDKVALAIALKVAHFKR  221



>ref|XP_007214523.1| hypothetical protein PRUPE_ppa015660mg, partial [Prunus persica]
 gb|EMJ15722.1| hypothetical protein PRUPE_ppa015660mg, partial [Prunus persica]
Length=881

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI G WGVC TL+LK SWR AYFQF +D K+K+   I +  A+ ++
Sbjct  780  FYVSMILGFISGFWGVCITLLLKQSWRYAYFQFFDDTKDKVTLAIALKVARLQK  833



>ref|XP_008383307.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Malus domestica]
Length=898

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI G WGVCGTLI+K SWR AYF F +D K+K+     +  A+ +R
Sbjct  843  LYVSITLGFITGFWGVCGTLIVKKSWRYAYFXFFDDMKDKVALAXALKVARLQR  896



>ref|XP_008349123.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Malus domestica]
Length=889

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI G WGVCGTLI+K SWR AYF+F +  K+K+   I +  A+ +R
Sbjct  834  LYVSITLGFITGFWGVCGTLIVKKSWRYAYFRFFDGMKDKVALAIALKVARLQR  887



>gb|KEH25184.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=988

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F F+V+L LGFI+G WGVCGTL++K SWR  YFQF ++  + +  T+ V+  K K    V
Sbjct  927  FGFYVTLVLGFIIGFWGVCGTLVIKTSWRHVYFQFFKNMNDWIHVTLAVFINKFKNNFQV  986



>ref|XP_004295536.2| PREDICTED: receptor-like protein 12 [Fragaria vesca subsp. vesca]
Length=994

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F VS+ LGFI+G WGVCGTLI+K SWR AYF+F +D K+K    +V+  A  +R
Sbjct  939  FRVSMVLGFIVGFWGVCGTLIIKKSWRCAYFRFFDDIKDKAMHAVVLKLAHLRR  992



>ref|XP_009335211.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=737

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S  LGFI G WGVCG+LILK +WR AYFQF ++ +++L   + V+  + KR
Sbjct  681  FYISAVLGFIFGFWGVCGSLILKKTWRYAYFQFTDNVQDRLYVMLAVHMNRMKR  734



>ref|XP_010662440.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X2 [Vitis vinifera]
Length=1078

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F++S+ LGFI+G WGVCGTL+L +SWR AYFQFL   K+ L   I +  A+ +R
Sbjct  1021  FYISVALGFIVGFWGVCGTLLLNNSWRYAYFQFLNKIKDWLYMIIAINMARLQR  1074



>ref|XP_009368581.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=1048

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             F+VS+ LGF +G WGVCGTL++K SWR AYF+  +D K+K+   I V  A+ +R +
Sbjct  993   FYVSMVLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVARFQRKL  1048



>ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=1198

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F++S+ LGFI+G WGVCGTL+L +SWR AYFQFL   K+ L   I +  A+ +R
Sbjct  1141  FYISVALGFIVGFWGVCGTLLLNNSWRYAYFQFLNKIKDWLYMIIAINMARLQR  1194



>ref|XP_006446689.1| hypothetical protein CICLE_v10017769mg [Citrus clementina]
 gb|ESR59929.1| hypothetical protein CICLE_v10017769mg [Citrus clementina]
Length=996

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WG   +L+L  SWR AY+QFL+  KE+LCT  V   AK +R
Sbjct  943  FYVSVALGFIVGFWGFVSSLLLNRSWRRAYWQFLDHTKERLCTNTVPNAAKRQR  996



>ref|XP_009365374.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Pyrus x bretschneideri]
Length=1081

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
              +VS+ LGFI+G WGVCGTL LK SWR AYFQF ED K K+   I +   + K
Sbjct  1025  LYVSVVLGFIVGFWGVCGTLTLKTSWRYAYFQFFEDIKNKVALAIALKVVRFK  1077



>gb|KEH16823.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=661

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VSL LGF++G WGVCGTL++K SWR AYF+F ++  E +  T+ V+  + K+
Sbjct  600  FGFYVSLGLGFLIGFWGVCGTLVIKTSWRHAYFKFFKNINEWIHVTLEVFVNRLKK  655



>ref|XP_010046667.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
Length=990

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMG  304
            F+ S+ LGF++G W VCGTL++K SWR AYF+F E+ K+KL   + +  A+ +R  G
Sbjct  931  FYASIVLGFLVGFWSVCGTLVIKRSWRQAYFRFAENMKDKLYLAVQLKTARLRRNWG  987



>ref|XP_008226588.1| PREDICTED: receptor-like protein 2 [Prunus mume]
Length=675

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F++S+ LGFI+G WGVCG+L++K +WR AYF+F ++ ++++C  + V   + KR +
Sbjct  618  FYISVVLGFIVGFWGVCGSLVIKRTWRHAYFRFTDNVQDRVCVMMTVSVNRMKRKL  673



>ref|XP_007220272.1| hypothetical protein PRUPE_ppa000998mg [Prunus persica]
 gb|EMJ21471.1| hypothetical protein PRUPE_ppa000998mg [Prunus persica]
Length=936

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 4/56 (7%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VS+ LG I+G WGVCGTL+LK SWR AYF++L++ K++    I ++ AK +R
Sbjct  881  FGFYVSMVLGLIIGFWGVCGTLLLKSSWRYAYFRYLDNIKDR----ITMHKAKLQR  932



>ref|XP_009363364.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=1005

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
             F+VS+ LGFI+G WG+CGTL+LK SWR AYFQF ++ K+K+   I +
Sbjct  957   FYVSVVLGFIVGFWGICGTLVLKTSWRYAYFQFFDNIKDKVALAIAM  1003



>ref|XP_007214150.1| hypothetical protein PRUPE_ppa018847mg [Prunus persica]
 gb|EMJ15349.1| hypothetical protein PRUPE_ppa018847mg [Prunus persica]
Length=942

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGFI+G WGVCGTL++K +WR AYF++ +D K+K+   I +  A+ +R
Sbjct  887  FYISMALGFIVGFWGVCGTLLVKKAWRYAYFRWFDDIKDKVMLAIALKMARTQR  940



>ref|XP_011463260.1| PREDICTED: receptor-like protein 12 [Fragaria vesca subsp. vesca]
Length=979

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
             +VS+ LGFI+G WGVCGTL++K SWR AYF+F ++ KEK+   I V
Sbjct  924  LYVSVVLGFIIGFWGVCGTLLMKKSWRHAYFRFFDNIKEKIIVAIAV  970



>ref|XP_007212880.1| hypothetical protein PRUPE_ppa021661mg, partial [Prunus persica]
 gb|EMJ14079.1| hypothetical protein PRUPE_ppa021661mg, partial [Prunus persica]
Length=932

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAK  322
            F F+V + LGFI+G W VCGTL+LK SWR AYF+F ++ KEK+   I +  A+
Sbjct  875  FWFYVGMALGFIIGFWAVCGTLVLKKSWRYAYFKFFDNVKEKVALIIALKVAR  927



>ref|XP_008226022.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=967

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F VS  LGFI+G WGVCGTLI+K+SWR AYF++ +D K+K    I V  A  +R +
Sbjct  912  FCVSTALGFIVGFWGVCGTLIMKNSWRYAYFRWFDDIKDKAALAIAVKVATLQRKL  967



>ref|XP_008226021.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Prunus mume]
Length=1096

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
              +VS+ LGFI+G WGVCGTL++K SWR AYF+F +D K K+   I +  A+ +R
Sbjct  1041  LYVSMVLGFIVGFWGVCGTLLVKKSWRYAYFRFFDDIKNKVALAIELKLARLQR  1094


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWR  394
            F+VSL LGFI+G WGVCGTL+ K SWR
Sbjct  99   FYVSLGLGFIVGFWGVCGTLVQKKSWR  125



>ref|XP_008382520.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Malus domestica]
Length=963

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F F+VSL LGFI+G W VCGTL LK SWR AYFQF +D K ++
Sbjct  920  FGFYVSLVLGFIIGFWSVCGTLFLKTSWRYAYFQFFDDIKARI  962



>ref|XP_006480247.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=996

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  468  VSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            +S+ LGFI+G WGVCGTLI+K SWR  YFQF++  K++  T + V   + KR M
Sbjct  934  LSVALGFIVGFWGVCGTLIIKKSWRYTYFQFVDKIKDQFLTFLAVNAVRLKREM  987



>ref|XP_007031844.1| Serine/threonine-protein kinase bri1, putative [Theobroma cacao]
 gb|EOY02770.1| Serine/threonine-protein kinase bri1, putative [Theobroma cacao]
Length=997

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FF+SL LGF +G WGVCGTLI+K SWR AYF F++  K+K     +V   + +R
Sbjct  939  FFISLVLGFFVGFWGVCGTLIIKKSWRLAYFSFVDRTKDKFLAFFLVNVHRLRR  992



>ref|XP_008383310.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=1048

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             F+VS+ LGF +G WGVCGTL++K SWR AYF+  +D K+K+   I V  A  +R +
Sbjct  993   FYVSMVLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVAHFQRKL  1048



>gb|KJB50165.1| hypothetical protein B456_008G156800 [Gossypium raimondii]
Length=911

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             ++S+ +G+I+G WGVCGTL++K SWR AYF+++++ KEKL   I +  A+ +R
Sbjct  851  LYLSIAMGYIVGFWGVCGTLVMKESWRQAYFRYVDELKEKLLLWIALTSARSRR  904



>ref|XP_008226031.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Prunus mume]
Length=895

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S  LGFILG WGVCGTL++K SWR AYF++ +D K+K+     +  A+ +R
Sbjct  840  FYISTALGFILGFWGVCGTLLVKKSWRYAYFRWFDDIKDKVMLAFALKMARTQR  893



>ref|XP_004507279.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cicer arietinum]
Length=1017

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480   FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F F++SL LGF +G WGVCGTL++K SWR  YFQF  +  + +  T+VV+  + K+
Sbjct  953   FGFYISLWLGFFVGFWGVCGTLVIKTSWRHVYFQFFNNMSDWIHVTLVVFVIRMKK  1008



>ref|XP_008393401.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Malus domestica]
Length=975

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+VS+ LGFI+G WGVCGTL+LK SWR AYF+F +D K+K+
Sbjct  933  FYVSVILGFIVGFWGVCGTLVLKTSWRYAYFRFFDDIKDKV  973



>gb|KEH16824.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=992

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVY  331
            F F+VSL LGFI+G WGVCGTL+LK SWR AYF+F  +  + +  T+ V+
Sbjct  931  FGFYVSLGLGFIIGFWGVCGTLVLKTSWRHAYFKFFNNVNDWIHVTLAVF  980



>ref|XP_008225908.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Prunus mume]
Length=1024

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  480   FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAK  322
             F F VS+ LGFI+G W VCGTL+LK SWR AYF+F ++ KEK+   I +  A+
Sbjct  967   FWFHVSMALGFIVGFWAVCGTLVLKKSWRYAYFKFFDNVKEKVALIIALKVAR  1019



>emb|CAN76220.1| hypothetical protein VITISV_020133 [Vitis vinifera]
Length=939

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L+LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  877  FFISMGLGFPVGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  932



>ref|XP_008226571.1| PREDICTED: receptor-like protein 2 [Prunus mume]
Length=746

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F++ + LGFI+G WGVCG+L++K +WR AYFQF+++ +++L   I V  ++ KR +
Sbjct  689  FYIFVALGFIIGFWGVCGSLVIKKTWRYAYFQFIDNLQDRLYVMITVPLSRMKRKL  744



>ref|XP_010655653.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=993

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L+LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  931  FFISMGLGFPVGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  986



>ref|XP_002273399.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
 ref|XP_010655701.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=1007

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L+LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  945  FFISMGLGFPVGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  1000



>ref|XP_009342313.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=737

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S  LGFI G WGVCG+LILK +WR AYFQF ++ +++L   + V   + KR
Sbjct  681  FYISAVLGFIFGFWGVCGSLILKKTWRHAYFQFTDNVQDRLYVMLAVRMNRMKR  734



>ref|XP_009352122.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Pyrus x bretschneideri]
Length=964

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F F+VSL LGFI+G W VCGTL+LK SWR AYF+F +D K ++
Sbjct  921  FGFYVSLVLGFIIGFWSVCGTLVLKTSWRYAYFRFFDDIKARI  963



>ref|XP_008343845.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Malus domestica]
Length=916

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F F+VSL LGFI+G W VCGTL+LK SWR AYF+F +D K ++
Sbjct  873  FGFYVSLVLGFIIGFWSVCGTLVLKTSWRYAYFRFFDDIKARI  915



>ref|XP_004295535.1| PREDICTED: receptor-like protein 2 [Fragaria vesca subsp. vesca]
Length=236

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS  LGFI+G WGVCGTL++K+SWR AYFQF +  K+ +   I V  A+  R
Sbjct  180  FYVSSVLGFIIGFWGVCGTLLVKNSWRYAYFQFFDKIKDNVALAIAVTMARWHR  233



>ref|XP_009375566.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=964

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F F+VSL LGFI+G W VCGTL+LK SWR AYF+F +D K ++
Sbjct  921  FGFYVSLALGFIIGFWSVCGTLVLKTSWRYAYFRFFDDIKARI  963



>emb|CAN63562.1| hypothetical protein VITISV_037178 [Vitis vinifera]
Length=158

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+VS+ LGFI+G WGVCGTL+L +SWR AYF+FL   K+ L  T  +  A+  R +
Sbjct  101  FYVSIALGFIVGFWGVCGTLLLNNSWRYAYFRFLNKIKDWLYVTTTINMARLWRSL  156



>ref|XP_008346112.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=984

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            FFVSL LGFI+G WGVCGTL+LK SWR AYF++ +  K+K    I V
Sbjct  928  FFVSLVLGFIVGFWGVCGTLVLKKSWRYAYFRWFDTIKDKAKLAIAV  974



>ref|XP_008362830.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=863

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F F+VSL LGFI+G W VCGTL+LK SWR AYF+F +D K ++
Sbjct  820  FGFYVSLXLGFIIGFWSVCGTLVLKTSWRYAYFRFFDDIKARI  862



>ref|XP_008383232.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=985

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VS+ LGFI+G WGVCGTL++K +WR AYF + +  K+K+   I V  A+ +R
Sbjct  928  FWFYVSIALGFIVGFWGVCGTLVVKKTWRYAYFGWFDAIKDKVLLAIAVQMARCQR  983



>emb|CAN63882.1| hypothetical protein VITISV_002032 [Vitis vinifera]
Length=898

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L+LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  836  FFISMGLGFPVGFWXVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  891



>ref|XP_011460509.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Fragaria vesca subsp. vesca]
Length=314

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+ +GF++G WGVCGTLI+  SWR AYFQF ++ KEK+   I +  A+ +R
Sbjct  259  LYVSVVIGFVIGFWGVCGTLIMNKSWRYAYFQFFDNVKEKVVLAIALKVARVQR  312



>ref|XP_008366594.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=766

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++  TLGFI+G WGVCG+L LK +WR +YFQFL++ ++ L   + V   K KR
Sbjct  709  FYIFATLGFIVGFWGVCGSLFLKKTWRYSYFQFLDNVQDSLYVKMAVCMGKMKR  762



>ref|XP_010677155.1| PREDICTED: receptor-like protein kinase isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGF  G WGVCG+L LK +WR A+F FL+    K+  TI +Y A+ +R
Sbjct  570  FYVSMGLGFYFGFWGVCGSLYLKDAWRHAFFNFLDTIYNKIYVTIAIYVARYRR  623



>ref|XP_010655798.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=968

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L+LK SWR AYF+F+++ +++L     V  A  KR M
Sbjct  906  FFISMGLGFPVGFWAVCGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVASLKRKM  961



>ref|XP_007213197.1| hypothetical protein PRUPE_ppa026674mg [Prunus persica]
 gb|EMJ14396.1| hypothetical protein PRUPE_ppa026674mg [Prunus persica]
Length=807

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            F+VS+ LGFI+G WGVCGTL++K SWR AYF+F ++ K+K+   I +
Sbjct  752  FYVSIMLGFIVGFWGVCGTLLIKKSWRYAYFRFFDNIKDKVALAIAL  798



>ref|XP_009368772.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Pyrus 
x bretschneideri]
Length=219

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+VSL LGF++G W VCGTL+LK SWR AYFQFL+D K ++
Sbjct  178  FYVSLVLGFVIGFWSVCGTLVLKTSWRYAYFQFLDDIKGRI  218



>ref|XP_004301719.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Fragaria vesca subsp. vesca]
Length=818

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FF+S  LGF+ G W VCG+L+LK SWR AYF+FL+D ++ +     VY  K +R
Sbjct  761  FFISTVLGFVSGFWIVCGSLLLKSSWRYAYFKFLDDSRDWIHVKTAVYKEKMQR  814



>ref|XP_010662626.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
 ref|XP_010662627.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
 ref|XP_010662628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
Length=660

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+ ++ LGFI+G WGVCGTL+L  SWR AYFQFL   K+ L  T  V   K +R +
Sbjct  603  FYGNIVLGFIIGFWGVCGTLLLNSSWRYAYFQFLSKIKDWLYVTTTVNMNKVRRSL  658



>ref|XP_010646952.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=285

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FFV + LGFI+G WGVCGTL++K SWR AYF+F++  K++L   + +  A+  R
Sbjct  230  FFVRMGLGFIIGHWGVCGTLVIKKSWRYAYFRFVDKMKDRLLLAVALNVARLTR  283



>ref|XP_008368209.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=755

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S  LGFI G WGVCG+LI+K +WR AYFQF ++ +++L   + V   + KR
Sbjct  699  FYISAVLGFIFGFWGVCGSLIVKKTWRYAYFQFTDNVQDRLHVMLAVRMNRMKR  752



>ref|XP_008346104.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460 [Malus domestica]
Length=366

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WG+CGTLIL  SWR AYFQF ++ K+K+   I +  A  KR
Sbjct  308  FYVSVVLGFIVGFWGICGTLILXTSWRYAYFQFFDNIKDKVALAIALKVACFKR  361



>ref|XP_008376669.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Malus domestica]
Length=964

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+VSL LGF++G W VCGTL+LK +WR AYF+FL+D K+++
Sbjct  923  FYVSLVLGFVIGFWSVCGTLVLKTTWRYAYFRFLDDIKDRI  963



>ref|XP_007214021.1| hypothetical protein PRUPE_ppa016515mg [Prunus persica]
 gb|EMJ15220.1| hypothetical protein PRUPE_ppa016515mg [Prunus persica]
Length=936

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S+ LGFI+G WGVCGTLI+K SWR AYF++ +D KEK 
Sbjct  889  FYMSMALGFIVGFWGVCGTLIVKKSWRYAYFRWFDDIKEKF  929



>ref|XP_010672176.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Beta vulgaris subsp. vulgaris]
Length=1022

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  468   VSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRG  310
             +S+ LGF++G WGVCGTL+LK SWR A+FQF +D +++L    +    K +RG
Sbjct  965   ISVVLGFVIGFWGVCGTLVLKRSWRHAFFQFFDDMQDRLYGWCLFTRLKFRRG  1017



>ref|XP_008362832.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=964

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+VSL LGFI+G W VCGTL+LK SWR AYF+F++D K ++
Sbjct  923  FYVSLALGFIIGFWSVCGTLVLKTSWRYAYFRFIDDIKARI  963



>ref|XP_002265946.1| PREDICTED: receptor-like protein kinase 2 [Vitis vinifera]
Length=969

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  907  FFISMGLGFPVGFWAVCGSLALKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  962



>ref|XP_008364570.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
Length=220

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F F+VSL LGFI+G W VCGTL+LK SWR AYF+F +D K ++
Sbjct  177  FGFYVSLVLGFIIGFWSVCGTLVLKTSWRYAYFRFFDDIKARI  219



>ref|XP_008372137.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=399

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+V++ LGFI+G W VCGTLILK SWR AYFQF +D K+K+   I +   + +R
Sbjct  341  FYVNVILGFIVGFWSVCGTLILKTSWRYAYFQFFDDIKDKVALGIALEVGRFQR  394



>ref|XP_007214755.1| hypothetical protein PRUPE_ppa024905mg [Prunus persica]
 gb|EMJ15954.1| hypothetical protein PRUPE_ppa024905mg [Prunus persica]
Length=972

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G WGV GTL++K SWR AYF+F +D K K+   I +  A+ +R
Sbjct  917  FYVSMVLGFIVGFWGVWGTLLVKKSWRYAYFRFFDDIKNKVLLAIELKLARMQR  970



>ref|XP_010656643.1| PREDICTED: uncharacterized protein LOC104880714 [Vitis vinifera]
Length=1782

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             FF+S+ LGF +G W VCG+L LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  1720  FFISMGLGFPVGFWAVCGSLALKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  1775



>ref|XP_010662437.1| PREDICTED: receptor-like protein 12 isoform X2 [Vitis vinifera]
Length=665

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F++S+ LGFI+G WGVCGTL+L +S R AYF FL   K+    TI +  AK +R +
Sbjct  608  FYISIALGFIVGFWGVCGTLLLNNSLRYAYFHFLNKIKDWFYVTIAINMAKVRRSL  663



>ref|XP_010046668.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
[Eucalyptus grandis]
Length=1095

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F+ S+ LGF++G W VCGTL++K SWR AYF+F +  K+KL  T+ +  A+ +R
Sbjct  1036  FYASIVLGFLVGFWSVCGTLVIKRSWRQAYFRFADKIKDKLYLTVQLKIARLRR  1089



>ref|XP_003631330.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Vitis vinifera]
Length=780

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF S+ LGF +G W VCGTL LK SWR AYF+F+ + K+++   I V  A+ +R M
Sbjct  717  FFTSMGLGFPVGFWAVCGTLALKKSWRHAYFRFVGEAKDRMYVFIAVNVARFRRKM  772



>ref|XP_008372118.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Malus domestica]
Length=930

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LG I+G W +CGTLI K SWR AYFQF ++ K+K+   I +  A  KR
Sbjct  872  FYVSVVLGXIVGFWSICGTLIFKTSWRYAYFQFFDNIKDKVVLAIALKVACFKR  925



>ref|XP_007214106.1| hypothetical protein PRUPE_ppa017047mg, partial [Prunus persica]
 gb|EMJ15305.1| hypothetical protein PRUPE_ppa017047mg, partial [Prunus persica]
Length=983

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            F F+VS+ LGFI+G W VCGTL+LK SWR AYF F ++ KEK
Sbjct  902  FWFYVSMALGFIIGFWVVCGTLVLKKSWRYAYFNFFDNVKEK  943



>emb|CAN79130.1| hypothetical protein VITISV_029207 [Vitis vinifera]
Length=1107

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             F++S+ LGFI+G WGVCGTL+L +S R AYF FL   K+    TI +  AK +R +
Sbjct  1050  FYISIALGFIVGFWGVCGTLLLNNSLRYAYFHFLNKIKDWFYVTIAINMAKVRRSL  1105



>ref|XP_010662436.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X1 [Vitis vinifera]
Length=1117

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             F++S+ LGFI+G WGVCGTL+L +S R AYF FL   K+    TI +  AK +R +
Sbjct  1060  FYISIALGFIVGFWGVCGTLLLNNSLRYAYFHFLNKIKDWFYVTIAINMAKVRRSL  1115



>ref|XP_008349105.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=225

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+VS+ LGF +G WGVCGTL++K SWR AYF+  +D K+K+   I V  A  +R +
Sbjct  170  FYVSMXLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVAHFQRKL  225



>gb|KEH25176.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=871

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VSL +GF +G WGVCGTL++K SWR AYF+F  +  + +  T+ V+  + K+
Sbjct  810  FGFYVSLVIGFFVGFWGVCGTLVIKTSWRHAYFKFFNNLNDWIHVTLSVFVNRLKK  865



>ref|XP_008378408.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
Length=349

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G W VCGTLILK +WR AYFQF +D K+K+   I +   + +R
Sbjct  291  FYVSVVLGFIVGFWSVCGTLILKTTWRYAYFQFFDDIKDKVALGIALEVGRFQR  344



>ref|XP_006493510.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
Length=986

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAK  322
            F+VSLTLGFI+G WGVCGTL+L  SWR  YF FL + ++ L     V  AK
Sbjct  929  FYVSLTLGFIVGFWGVCGTLMLNRSWRYGYFNFLTNMRDWLYIVGAVNAAK  979



>ref|XP_007021415.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12940.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=882

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+  + LGFI+G WG+CG L+ K SWR AYF+FL+D K+ L    V+  A+ +R
Sbjct  825  FYAGMGLGFIVGFWGICGALLFKRSWRHAYFRFLDDMKDWLYVRFVLQKARLER  878



>gb|KDO38052.1| hypothetical protein CISIN_1g002556mg [Citrus sinensis]
Length=908

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAK  322
            F+VSLTLGFI+G WGVCGTL+L  SWR  YF FL + ++ L     V  AK
Sbjct  851  FYVSLTLGFIVGFWGVCGTLMLNRSWRYGYFNFLTNMRDWLYIVGAVNAAK  901



>ref|XP_008365985.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=892

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+ S+ LGFI+G WGVCGTL++K +WR AYF + +  K+K+   I V  A+ +R
Sbjct  835  FWFYXSIALGFIVGFWGVCGTLVVKKTWRYAYFGWFDAIKDKVLLAIAVQMARFQR  890



>ref|XP_009368583.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=985

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F++S+ LGFI+G WG+CGTL++K +WR AYF + +  K+K+   I V  A  +R
Sbjct  928  FWFYISMALGFIVGFWGICGTLVVKKTWRYAYFGWFDAIKDKVLLAIAVQMAHFQR  983



>ref|XP_008372136.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=982

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            FF+SL LGFI+G WGVCGTL+LK SWR AYF++ +  K+K+
Sbjct  930  FFISLVLGFIVGFWGVCGTLVLKKSWRHAYFRWFDAIKDKI  970



>ref|XP_002264037.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=777

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF S+ LGF +G W VCGTL LK SWR AYF+F+ + K+++   I V  A+ +R M
Sbjct  714  FFTSMGLGFPVGFWAVCGTLALKKSWRHAYFRFVGEAKDRMYVFIAVNVARFQRKM  769



>ref|XP_003631326.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=781

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF S+ LGF +G W VCGTL LK SWR AYF+F+ + K+++   I V  A+ +R M
Sbjct  718  FFTSMGLGFPVGFWAVCGTLALKKSWRHAYFRFVGEAKDRMYVFIAVNVARFQRKM  773



>emb|CAN78838.1| hypothetical protein VITISV_037334 [Vitis vinifera]
Length=781

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF S+ LGF +G W VCGTL LK SWR AYF+F+ + K+++   I V  A+ +R M
Sbjct  718  FFTSMGLGFPVGFWAVCGTLALKKSWRHAYFRFVGEAKDRMYVFIAVNVARFQRKM  773



>ref|XP_011463258.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Fragaria vesca subsp. vesca]
Length=826

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
             ++S+TLGFI+G WGVCGTL++K S R AYFQF  + KE +   I V  A+ +
Sbjct  771  LYISVTLGFIIGFWGVCGTLVVKKSLRHAYFQFFNNIKENIIVAIAVKVARLR  823



>ref|XP_010662638.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=988

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+ ++ LGFI+G WGVCGTL+   SWR AYFQFL   K+ L  T +V   + +R +
Sbjct  931  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQFLSKIKDWLYVTTIVNMNRIRRSL  986



>ref|XP_008349124.1| PREDICTED: receptor-like protein kinase 5 [Malus domestica]
Length=985

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+ S+ LGFI+G WGVCGTL++K +WR AYF + +  K+K+   I V  A+ +R
Sbjct  928  FWFYXSIALGFIVGFWGVCGTLVVKKTWRYAYFGWFDAIKDKVLLAIAVQMARCQR  983



>ref|XP_009342322.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=744

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S   GFI G WGVCG+LI+K +WR AYFQF+++ +++L   + V     KR
Sbjct  688  FYISAVFGFIFGFWGVCGSLIVKKTWRDAYFQFIDNVQDRLYVMLAVRMNTMKR  741



>ref|XP_006493513.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=978

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VSL LGF +G WGVCGTL+L  SWR  YF FL   K+ +  T  V  AK +R
Sbjct  921  FYVSLILGFFVGFWGVCGTLMLNRSWRHGYFNFLTSMKDWVYVTAAVNIAKLQR  974



>ref|XP_010671924.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
Length=645

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTT  343
             ++S+  GFI+G WGVCGTL++K SWR AYF+F ++ K+KL  T
Sbjct  596  LYISIVFGFIVGFWGVCGTLVIKTSWRRAYFRFFDETKDKLYRT  639



>ref|XP_007212434.1| hypothetical protein PRUPE_ppa017185mg [Prunus persica]
 gb|EMJ13633.1| hypothetical protein PRUPE_ppa017185mg [Prunus persica]
Length=983

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VS+ LGFI+G WGV GTLI+K SWR AYF++ +D K+K    + +  A  +R
Sbjct  926  FWFYVSMALGFIVGFWGVFGTLIVKKSWRYAYFRWFDDIKDKATLCVRLKAAPSQR  981



>ref|XP_008350455.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Malus domestica]
Length=985

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F++S+ LGFI+G WGVCG L++K +WR AYF + +  K+K+   I V  A+ +R
Sbjct  928  FWFYISIALGFIVGFWGVCGXLVVKKTWRYAYFGWFDAIKDKVLLAIAVQMARFQR  983



>ref|XP_010105709.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
 gb|EXC05929.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
Length=846

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 4/60 (7%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDK----KEKLCTTIVVYGAKXKR  313
            F F+VS  +GFI+G WGVCGTL+LK SWR AYFQF        K+    T  V+ A+  R
Sbjct  781  FGFYVSTAIGFIVGFWGVCGTLVLKSSWRRAYFQFWSHNSQMTKDYFYVTTKVFKARLLR  840



>ref|XP_009341489.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=728

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++  TLGFI+G WGVCG+L+LK +WR  YFQFL++ ++ L   + +   K KR
Sbjct  671  FYIFATLGFIVGFWGVCGSLLLKKTWRYKYFQFLDNVQDLLYVKMAICMRKMKR  724



>ref|XP_008226024.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=958

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTI  340
            F++S+ LGFI+G WGVCGTLI+K SWR AYF++ +D KE     +
Sbjct  901  FYMSMALGFIVGFWGVCGTLIVKKSWRYAYFRWFDDIKENFMVKV  945



>ref|XP_009376584.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=731

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S+ LGFI+G WGVCG+L L  SWR AYFQFL D K++ 
Sbjct  689  FYISVALGFIVGFWGVCGSLALITSWRYAYFQFLSDVKDRF  729



>ref|XP_009376560.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=731

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S+ LGFI+G WGVCG+L L  SWR AYFQFL D K++ 
Sbjct  689  FYISVALGFIVGFWGVCGSLALITSWRYAYFQFLSDVKDRF  729



>ref|XP_008355014.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=731

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S+ LGFI+G WGVCG+L L  SWR AYFQFL D K++ 
Sbjct  689  FYISVALGFIVGFWGVCGSLALITSWRYAYFQFLSDVKDRF  729



>ref|XP_008352735.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Malus 
domestica]
Length=731

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S+ LGFI+G WGVCG+L L  SWR AYFQFL D K++ 
Sbjct  689  FYISVALGFIVGFWGVCGSLALITSWRYAYFQFLSDVKDRF  729



>ref|XP_010671925.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Beta vulgaris subsp. vulgaris]
Length=975

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             ++S+ LGFI+G WGVCG+++LK SWR A+F+F ++ K+KL   + +  A+  R
Sbjct  920  LYISVVLGFIIGFWGVCGSIVLKRSWRHAFFRFFDNMKDKLYVMVFINVARVWR  973



>ref|XP_009376551.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=635

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S+ LGFI+G WGVCG+L L  SWR AYFQFL D K++ 
Sbjct  593  FYISVALGFIVGFWGVCGSLALITSWRHAYFQFLSDVKDRF  633



>ref|XP_010266617.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
Length=1000

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F++S+  GF++G WGVCGTL+LK SWR AYF FL D K+ +   I +   + +R +
Sbjct  940  FYISMLPGFVVGFWGVCGTLLLKKSWRHAYFNFLNDMKDWVFIVIALSVIRLQRKL  995



>ref|XP_008345134.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=582

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S  LGFI G WGVCG+LI+K +WR AYF+F ++  ++L   + V   + KR
Sbjct  526  FYISTALGFIFGFWGVCGSLIVKKTWRYAYFRFTDNVHDRLYVMLAVRMNRMKR  579



>ref|XP_009340288.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=1027

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKE  358
             F+VS+ LGF++G WGVCGTLI+K SWR AYF+F ++ K+
Sbjct  970   FYVSVILGFVVGFWGVCGTLIIKKSWRYAYFRFFDNIKD  1008



>ref|XP_008347020.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=953

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            FFVS+TLGFI+G W VCGTL LK SWR AYFQ+ +  K+K
Sbjct  909  FFVSMTLGFIVGFWSVCGTLFLKKSWRHAYFQWFDAIKDK  948



>ref|XP_008358880.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=721

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
             ++S+TLGFI+G WGVCG L L  SWR AYFQFL D K++ 
Sbjct  679  LYISVTLGFIVGFWGVCGPLALSTSWRFAYFQFLSDVKDRF  719



>ref|XP_008365984.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=324

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGF +G WGVCGTL++K SWR AYF+  +D K+K+   I V  A  +R
Sbjct  269  FYVSMVLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVAHFQR  322



>ref|XP_009375609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=961

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+VSL LGFI+G W VCGTL+L  SWR AYF+F +D K ++
Sbjct  920  FYVSLALGFIIGFWSVCGTLVLNASWRYAYFRFFDDIKARI  960



>ref|XP_008375503.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=969

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            FFVS+TLGFI+G W VCGTL LK SWR AYFQ+ +  K+K
Sbjct  925  FFVSMTLGFIVGFWSVCGTLFLKKSWRHAYFQWFDAIKDK  964



>ref|XP_008365880.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=740

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S  LGFI G WGVCG+LI+K +WR AYF+F ++  ++L   + V   + KR
Sbjct  684  FYISTALGFIFGFWGVCGSLIVKKTWRYAYFRFTDNVHDRLYVMLAVRMNRMKR  737



>ref|XP_002264905.3| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=997

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F+VS+  GF +G WGVCGTLI+K+SWR AYF+ + D KE L   I +  A+ +R + +
Sbjct  937  FYVSMGPGFAVGFWGVCGTLIVKNSWRHAYFRLVYDVKEWLLMVISLNVARLRRKLNL  994



>ref|XP_004295505.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Fragaria vesca subsp. vesca]
Length=901

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             + S+  GFI G WGVCGTL++  SWR AYF+F ++ KEK+   I V   + +R
Sbjct  845  LYASIAFGFITGFWGVCGTLLVNKSWRYAYFRFFDNIKEKIIVAIAVKVTRLRR  898



>ref|XP_009342316.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=744

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             ++S   GFI G WGVCG+LI+K +WR AYFQF+++ +++L   + V   + KR
Sbjct  688  LYISAVFGFIFGFWGVCGSLIVKKTWRYAYFQFIDNVQDRLYVMLAVRMNRMKR  741



>ref|XP_002514937.1| serine/threonine-protein kinase bri1, putative [Ricinus communis]
 gb|EEF47491.1| serine/threonine-protein kinase bri1, putative [Ricinus communis]
Length=987

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
            F F+VS+ +GFI+G W VCGTL++K +WR AYF+F+++ K++L   I +  A+ +
Sbjct  927  FWFYVSMGVGFIVGFWVVCGTLVIKKTWRHAYFKFIDEMKDRLFLVIFLNMARLR  981



>ref|XP_010671582.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=1007

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
             F++S+ LGFILG WGVCGTL++K +WR A+F+ L+D K K 
Sbjct  963   FYISVLLGFILGFWGVCGTLVIKTNWRHAFFKLLDDVKNKF  1003



>ref|XP_002273469.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=994

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F++S+  GF++G WGVCGTL++K SWR AYF+ + D KE L   I +  A+ +R +
Sbjct  930  FYMSMGTGFVVGFWGVCGTLVVKESWRHAYFRLVNDIKEWLLLVIQLNVARLQRKL  985



>ref|XP_007151422.1| hypothetical protein PHAVU_004G044900g [Phaseolus vulgaris]
 gb|ESW23416.1| hypothetical protein PHAVU_004G044900g [Phaseolus vulgaris]
Length=925

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
            F+F++SL LGF +G W VCGTL++K SWR AYFQ      + +  T+V++ A+ K
Sbjct  866  FEFYLSLGLGFCVGFWSVCGTLMVKSSWRRAYFQLFITVSDWMYATVVIFTARVK  920



>ref|XP_006493493.1| PREDICTED: protein BRASSINOSTEROID INSENSITIVE 1-like [Citrus 
sinensis]
Length=543

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VSL LGF +G WGVCGTL+L  SWR  Y+ FL   K+ L  T  V  AK ++
Sbjct  487  FYVSLILGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYVTAAVNIAKLQK  540



>ref|XP_007045054.1| Disease resistance family protein / LRR family protein isoform 
1 [Theobroma cacao]
 gb|EOY00886.1| Disease resistance family protein / LRR family protein isoform 
1 [Theobroma cacao]
Length=934

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+ S+ LGF +G W VCG+L++K SWR AYF+F+++ K++L   I V  A+ ++
Sbjct  875  FYASMALGFAIGFWVVCGSLVIKRSWRRAYFKFVDEMKDRLFVVIAVSIARFRK  928



>ref|XP_007203166.1| hypothetical protein PRUPE_ppa025019mg, partial [Prunus persica]
 gb|EMJ04365.1| hypothetical protein PRUPE_ppa025019mg, partial [Prunus persica]
Length=765

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+V + LGFI+G WGV GTL++K SWR AYF+F +D K+K+   I +   + +R
Sbjct  707  FYVGMGLGFIVGFWGVFGTLLVKKSWRYAYFRFFDDTKDKVTLAIELKVTRLQR  760



>ref|XP_009375612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=964

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+V L LGFI+G W VCGTL+LK SWR AYF+F +D K ++
Sbjct  923  FYVGLALGFIIGFWSVCGTLVLKTSWRYAYFRFFDDIKARI  963



>ref|XP_008372019.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 isoform 
X1 [Malus domestica]
Length=700

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            F+VS+ LGFI+G WGVCGTLIL  SWR AYFQF    KEK
Sbjct  661  FYVSVVLGFIVGFWGVCGTLILNISWRYAYFQFFXIFKEK  700



>gb|KEH16822.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=918

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VSL +GF +G WGVCGTL++K SWR AYF+F  +  + +  T  V+  + K+
Sbjct  857  FGFYVSLVIGFFIGFWGVCGTLVIKTSWRHAYFKFFNNINDWIHVTQEVFVNRLKK  912



>ref|XP_011462017.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Fragaria vesca subsp. vesca]
Length=991

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F  +VS  LGFI+G W VCGTL++K SWR AYF+F +  +E+    I V  A+ +R
Sbjct  934  FGMYVSGALGFIIGFWSVCGTLVMKKSWRYAYFRFFDKIQERAELVIAVRVARWQR  989



>gb|KDO56839.1| hypothetical protein CISIN_1g0483511mg, partial [Citrus sinensis]
Length=574

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FFV+L LGFI+G WGVCGTL+L +SW+  ++ FL   K+ L  T VV   K ++ M
Sbjct  517  FFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKM  572



>gb|KCW86892.1| hypothetical protein EUGRSUZ_B03475, partial [Eucalyptus grandis]
Length=934

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F+ S+ LGF++G W VCGTL++K SWR AYF+F E+ K+KL
Sbjct  891  FYASIVLGFLVGFWSVCGTLVIKRSWRQAYFRFAENMKDKL  931



>ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=981

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F+VS+  GF +G WGVCGTLI+K SWR AYF+ + D KE L   I +  A+ +R + +
Sbjct  921  FYVSMGPGFAVGFWGVCGTLIVKDSWRHAYFRLVYDVKEWLLMVISLNVARLRRKLNL  978



>ref|XP_010660821.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
Length=1015

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
             F+VS+  GF +G WGVCGTLI+K SWR AYF+ + D KE L   I +  A+ +R + +
Sbjct  955   FYVSMGPGFAVGFWGVCGTLIVKDSWRHAYFRLVYDVKEWLLMVISLNVARLRRKLNL  1012



>ref|XP_003633794.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=988

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F++S+  GF++G WGVCGTL++K SWR AYF+ + D KE L   I +  A+ +R + +
Sbjct  924  FYMSMGTGFVVGFWGVCGTLVVKESWRHAYFKLVYDIKEWLLLVIQLNVARLQRKLNL  981



>ref|XP_008382164.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=638

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+ S   GFI G WGVCG+LI+K +WR AYFQF ++ +++L   + V   + KR
Sbjct  585  FYTSAVFGFIFGFWGVCGSLIVKKTWRYAYFQFTDNVQDRLYFMLAVRMNRMKR  638



>ref|XP_008383312.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Malus domestica]
Length=225

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+VS+ LGF +  WGVCGTL++K SWR AYF+  +D K+K+   I V  A  +R +
Sbjct  170  FYVSMXLGFTVXFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKXAHFQRKL  225



>emb|CAN64227.1| hypothetical protein VITISV_011552 [Vitis vinifera]
Length=1270

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            F+ ++ LGFI+G WGVCGTL+L  SWR AYFQFL   K+ L  T  V
Sbjct  838  FYGNIVLGFIIGFWGVCGTLLLNSSWRYAYFQFLSKIKDWLYVTTTV  884



>emb|CBI40045.3| unnamed protein product [Vitis vinifera]
Length=1119

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
             F++S+  GF++G WGVCGTL++K SWR AYF+ + D KE L   I +  A+ +R + +
Sbjct  1021  FYMSMGTGFVVGFWGVCGTLVVKESWRHAYFKLVYDIKEWLLLVIQLNVARLQRKLNL  1078



>ref|XP_009335210.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1 [Pyrus x 
bretschneideri]
Length=559

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F++S  LGFI G WGVCG+LI+K +WR AYFQF ++ +++L
Sbjct  252  FYISAVLGFIFGFWGVCGSLIVKKTWRYAYFQFTDNVQDRL  292



>ref|XP_009335214.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=741

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+++  LGFI G WGVCG+LI+K +WR AYF+F ++ +++L   + V   + KR
Sbjct  685  FYIAAALGFICGFWGVCGSLIIKKTWRYAYFRFTDNVQDRLYVMLAVRMNRMKR  738



>ref|XP_009363369.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Pyrus x bretschneideri]
Length=984

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            FFVSL LGFI+G W VCGTL+LK SWR AYF++ +  K+K
Sbjct  928  FFVSLVLGFIVGFWSVCGTLVLKKSWRYAYFRWFDTIKDK  967



>gb|KCW86893.1| hypothetical protein EUGRSUZ_B03476, partial [Eucalyptus grandis]
Length=930

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTI  340
            F+ S+ LGF++G W VCGTL++K SWR AYF+F +  K+KL  T+
Sbjct  867  FYASIVLGFLVGFWSVCGTLVIKRSWRQAYFRFADKIKDKLYLTV  911



>ref|XP_007013647.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY31266.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=916

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMG  304
             ++S+  GF +G W VCGTL+LK SWR AYF+++++ KEK+   I +  A+ +R  G
Sbjct  856  LYLSIATGFAVGFWSVCGTLVLKESWRHAYFRYVDNLKEKMLLWISLKEARLRRKFG  912



>ref|XP_009354002.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=487

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+ LGF++G WGVCGTLI+K SWR  YF+F ++ K+K    I +  A+ +R
Sbjct  430  LYVSVILGFVVGFWGVCGTLIIKKSWRYTYFRFFDNIKDKTALAIALKAARWRR  483



>ref|XP_010046670.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Eucalyptus 
grandis]
Length=288

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRG  310
            F+ S+ LGF++G W VCGTL++K SWR AYF+F +  K+KL  T+ +  A+ +R 
Sbjct  217  FYASIVLGFLVGFWSVCGTLVIKRSWRQAYFRFADKIKDKLYLTVQLKIARLRRN  271



>ref|XP_010662799.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=777

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            F++S+ LGFI+G WGVCG L+LK SWR AYFQFL D ++ +   + +
Sbjct  434  FYISMGLGFIVGFWGVCGALLLKKSWRHAYFQFLYDIRDWVYVAVAI  480


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            F++S+ LGFI+G WGVCG L+ K SWR AYFQFL D ++ +   + +
Sbjct  599  FYISMGLGFIVGFWGVCGALLFKKSWRHAYFQFLYDIRDWVYVAVAI  645



>ref|XP_006421142.1| hypothetical protein CICLE_v10004251mg [Citrus clementina]
 gb|ESR34382.1| hypothetical protein CICLE_v10004251mg [Citrus clementina]
Length=963

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +F+VS  LGF +G WGVCGTL+L  SWR  YF FL   K+ +  T  V  AK +R
Sbjct  904  LEFYVSSILGFFVGFWGVCGTLMLNRSWRHGYFNFLTGMKDWVYVTAAVNIAKLQR  959



>ref|XP_010662639.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=941

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+ ++ LGFI+G WGVCGTL+   SWR AYFQ L   K+ L  T +V   + +R +
Sbjct  884  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYVTTIVNMNRIRRSL  939



>ref|XP_003636154.1| Receptor-like protein kinase [Medicago truncatula]
Length=371

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F F+VSL +GF +G WGVCGTL++K SWR AYF+F  +  + +  T+ V+  + K+ + V
Sbjct  310  FGFYVSLVIGFFIGFWGVCGTLVIKTSWRHAYFKFFNNINDWIHVTLSVFVNRLKKRLQV  369



>emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera]
Length=971

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+ ++ LGFI+G WGVCGTL+   SWR AYFQ L   K+ L  T +V   + +R +
Sbjct  914  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYVTTIVNMNRIRRSL  969



>ref|XP_006422087.1| hypothetical protein CICLE_v10007014mg [Citrus clementina]
 gb|ESR35327.1| hypothetical protein CICLE_v10007014mg [Citrus clementina]
Length=956

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VSL LGF++G WG CGTL++K SWR  Y+ FL   K     T VV  AK +R
Sbjct  899  FYVSLILGFVVGFWGFCGTLLVKSSWRHRYYNFLTGVKNWFYVTAVVNIAKLQR  952



>ref|XP_008231133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Prunus mume]
Length=999

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F +S+ +GFI+G WGVCG+L++K SWR AYF FL+  K+ L
Sbjct  944  FIISIVIGFIVGFWGVCGSLVIKKSWRYAYFHFLDKVKDAL  984



>ref|XP_006421147.1| hypothetical protein CICLE_v10006774mg [Citrus clementina]
 gb|ESR34387.1| hypothetical protein CICLE_v10006774mg [Citrus clementina]
Length=959

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VSL LGF +G WGVCGTL+L  SWR  Y+ FL   K+ L  T  V  AK ++
Sbjct  903  FYVSLFLGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAAVNIAKLQK  956



>ref|XP_007212428.1| hypothetical protein PRUPE_ppa016649mg, partial [Prunus persica]
 gb|EMJ13627.1| hypothetical protein PRUPE_ppa016649mg, partial [Prunus persica]
Length=132

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGFI+G WGVCG+LI+K +WR  YF+F ++ ++++   + V   + KR
Sbjct  75   FYISVVLGFIVGFWGVCGSLIIKGTWRHGYFRFTDNIQDRVYVMMTVSMNRMKR  128



>ref|XP_011080440.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Sesamum indicum]
Length=984

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTT  343
            F+VS+ LGFI+G WG CGTLI K SWR AYF+F+ +   K+C +
Sbjct  941  FYVSVALGFIVGFWGSCGTLIFKKSWRVAYFRFVVEMWRKVCDS  984



>gb|KEH25183.1| leucine-rich receptor-like kinase family protein, partial [Medicago 
truncatula]
Length=442

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMG  304
            F F+V+L LGF +G WGVCGTL++K SWR AYF+F ++  + +  T+ V+  + K+ + 
Sbjct  379  FGFYVTLGLGFFVGFWGVCGTLVIKTSWRHAYFKFFKNMNDWIHVTLAVFMKRLKKNIS  437



>ref|XP_010662782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Vitis vinifera]
Length=966

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F+ ++ LGFI+G WGVCGTL+   SWR AYFQ L   K+ L  T +V   + +R +
Sbjct  909  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYMTTIVNMNRIRRSL  964



>ref|XP_003593778.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES64029.1| LRR receptor-like kinase [Medicago truncatula]
Length=988

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F  + S+ +G+I G W VCG+L+LK SWR AYF F+ D ++KL   + +   + KR  G+
Sbjct  926  FGLYASIAVGYITGFWIVCGSLMLKRSWRHAYFNFVYDTRDKLLVLMAINLPRLKRKFGL  985



>ref|XP_010671566.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=995

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = -3

Query  477  DFF----VSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            DF+    +S+ LGFI+G WGVCG+++LK SWR A+F F +D K+KL
Sbjct  942  DFYLGLCISVVLGFIIGFWGVCGSIVLKRSWRHAFFHFFDDMKDKL  987



>ref|XP_009335209.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=743

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S   GFI G WGVCG+LI+K +WR  YFQF ++ +++L   + +   + KR
Sbjct  687  FYISAVFGFIFGFWGVCGSLIVKKTWRYTYFQFTDNVQDRLYVMLALRMNRMKR  740



>ref|XP_008358578.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Malus domestica]
Length=794

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+TLGFI G  GVCGTLI+K SW  AYF+F +D K+K+   I    A+ ++
Sbjct  716  LYVSITLGFITGFXGVCGTLIVKKSWMYAYFRFFDDMKDKVALAIASKVARLQK  769



>ref|XP_006494168.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
Length=1009

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGF +G WGVCGTL++K SWR  Y+ FL   K+ L    VV  AK +R
Sbjct  921  FYLSMILGFFVGFWGVCGTLLVKSSWRHGYYNFLTGVKDWLYVKAVVNIAKLQR  974



>ref|XP_011460511.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X2 [Fragaria vesca subsp. vesca]
Length=929

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+  GFI G WGVCGTL++   WR AYF+F ++ KEK+   I V  A+ ++
Sbjct  873  LYVSIVFGFITGFWGVCGTLLVMKLWRYAYFRFFDNIKEKIIVGIAVKVARFRK  926



>ref|XP_004295508.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Fragaria vesca subsp. vesca]
Length=929

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+  GFI G WGVCGTL++   WR AYF+F ++ KEK+   I V  A+ ++
Sbjct  873  LYVSIVFGFITGFWGVCGTLLVMKLWRYAYFRFFDNIKEKIIVGIAVKVARFRK  926



>ref|XP_002509533.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF50920.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=471

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCT  346
            FFV++ LGF++G WGVCG+LI+K SWR  YF+F+++KK+ + T
Sbjct  427  FFVTIGLGFLVGFWGVCGSLIIKTSWRVVYFRFIDEKKDAILT  469



>ref|XP_011460553.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Fragaria vesca subsp. vesca]
Length=946

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQ-FLEDKKEKLCTTIVVYGAKXKR  313
            F++S+  GF++G WGVCGTL++K SWR AY Q F +  K+K+   I +  A  +R
Sbjct  890  FYISMVFGFVIGFWGVCGTLLIKKSWRTAYLQIFFDTIKDKIAVAITLKIAGLRR  944



>ref|XP_010660819.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1312

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F++S+  GF++G WGVCGTL++K SWR AYF+ + D KE L   I +   + +R + +
Sbjct  929  FYMSMGTGFVVGFWGVCGTLVIKQSWRHAYFRLVYDIKEWLLLVIQLNVGRLQRKLNL  986


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
             F++S+  GF++G WGVCGTL++K SWR AYF+ + D KE L   I +   + +R + +
Sbjct  1248  FYMSMGTGFVVGFWGVCGTLVIKQSWRHAYFRLVYDIKEWLLLVIQLNVGRLQRKLNL  1305



>ref|XP_009378505.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=580

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  471  FVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            ++   LGFI+G WGVCG+L+L  +WR AYFQF ++ ++ L   + V  A+ KR
Sbjct  524  YIFAALGFIVGFWGVCGSLVLNKTWRYAYFQFFDNVQDSLYVKMAVCMARMKR  576



>ref|XP_002514939.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF47493.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=997

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMG  304
            F+++L  GF LG W VCGTLILK  WR AYF+F++  K++      V  A+ +R +G
Sbjct  940  FYIALAPGFSLGFWVVCGTLILKKRWRYAYFRFVDRVKDRTFVVFTVSKARLQRKLG  996



>ref|XP_007212841.1| hypothetical protein PRUPE_ppa020791mg [Prunus persica]
 gb|EMJ14040.1| hypothetical protein PRUPE_ppa020791mg [Prunus persica]
Length=941

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLED  367
            F VS+ LGFI+G WGVCGTLI+K SWR AYF++ +D
Sbjct  886  FCVSMALGFIVGFWGVCGTLIMKKSWRYAYFRWFDD  921



>ref|XP_007214083.1| hypothetical protein PRUPE_ppa015322mg, partial [Prunus persica]
 gb|EMJ15282.1| hypothetical protein PRUPE_ppa015322mg, partial [Prunus persica]
Length=978

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            F+VS+ LGF++G W VCGTLI+K SWR AYF+  +D K K
Sbjct  939  FYVSMVLGFLVGFWSVCGTLIVKKSWRYAYFRLFDDIKNK  978



>ref|XP_006420957.1| hypothetical protein CICLE_v10006412mg, partial [Citrus clementina]
 gb|ESR34197.1| hypothetical protein CICLE_v10006412mg, partial [Citrus clementina]
Length=956

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGF +G WGVCGTL++K SWR  Y+ FL   K+ L    VV  AK +R
Sbjct  902  FYMSMILGFFVGFWGVCGTLLVKSSWRHGYYNFLTRVKDWLYVEAVVNIAKLQR  955



>ref|XP_009389815.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=732

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
             + S+TLGFI+G W +CG+L+L  +WR AYF  +++  +KL   +VV  AK KR +
Sbjct  676  LYTSITLGFIIGFWAICGSLLLLQTWRIAYFHAIDNMFDKLYVVMVVTVAKYKRKL  731



>gb|KEH16826.1| LRR receptor-like kinase [Medicago truncatula]
Length=723

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVY  331
            F+VSL +GF +G WGVCGTL++K SWR AYF+F  +  + +  T+ V+
Sbjct  664  FYVSLVIGFFVGFWGVCGTLVIKTSWRHAYFKFFNNLNDWIHVTLSVF  711



>gb|KDO41677.1| hypothetical protein CISIN_1g047190mg [Citrus sinensis]
Length=1025

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGF +G WGVCGTL++K SWR  Y+ FL   K+ L    VV  AK +R
Sbjct  898  FYMSMILGFFVGFWGVCGTLLVKSSWRHGYYNFLTRVKDWLYVEAVVNIAKLQR  951



>ref|XP_006470121.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=978

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIV  337
            F+ S+ +GFI+G WGVCG+L LK SWR AYF+F +  K++L   ++
Sbjct  930  FYSSIAVGFIVGFWGVCGSLALKKSWRLAYFRFFDKVKDRLILLVI  975



>ref|XP_008383284.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=1027

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKE  358
              +VS+ LGF++G WGVCGTLI+K SWR AYF+F ++ K+
Sbjct  970   LYVSVILGFVVGFWGVCGTLIIKKSWRYAYFRFFDNIKD  1008



>ref|XP_009361867.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=371

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS+ LGFI+G W VCGTLI+K SWR AYF+F +  K+K+   I +   + +R
Sbjct  313  FYVSVILGFIVGFWSVCGTLIIKTSWRHAYFEFFDIIKDKVALAIALNVVRFRR  366



>gb|KEH25182.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1069

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F+VSL +GF +G WGVCGTL++K SWR AYF+F  +  + +   + V+  + K+
Sbjct  1010  FYVSLVIGFFVGFWGVCGTLVIKTSWRHAYFKFFNNLNDWIHVILSVFVNRLKK  1063



>gb|AES64031.2| LRR receptor-like kinase [Medicago truncatula]
Length=802

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
             + S+ +G+I G W VCG+L+LK SWR AYF F+ D ++KL   + V  A+ KR  G+
Sbjct  742  LYTSIVVGYITGFWIVCGSLVLKRSWRHAYFNFVYDLRDKLLILMAVNLARLKRVFGL  799



>ref|XP_008444420.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Cucumis melo]
Length=966

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXK  316
            F V +  G+ LG WGV GTLILK SWR AYF+F+++ K+K+   I+V  A+ K
Sbjct  914  FCVIVMAGYALGFWGVVGTLILKKSWRHAYFRFMDETKDKISVAILVNMARMK  966



>ref|XP_006493087.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=1457

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F++S+ LGF +G WGVCGTL++K SWR  Y+ FL   K+ L    VV  AK +R
Sbjct  1400  FYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQR  1453



>ref|XP_006422085.1| hypothetical protein CICLE_v10006573mg [Citrus clementina]
 gb|ESR35325.1| hypothetical protein CICLE_v10006573mg [Citrus clementina]
Length=875

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F F+VS+ LGF +G WGVCGTL++  SWR  YF+FL   K+ +     V  AK +R
Sbjct  816  FGFYVSVILGFFIGFWGVCGTLLVNTSWRHGYFKFLTSVKDWVYLITAVNIAKLQR  871



>ref|XP_010266618.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=700

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            F++S+  GF++G WGVCGTL+LK +WR AYF  L+D K+ +   I     + KR +
Sbjct  640  FYISILPGFVVGFWGVCGTLLLKKTWRHAYFNLLDDMKDWVFLVIASSVIRLKRKL  695



>ref|XP_006421144.1| hypothetical protein CICLE_v10007027mg [Citrus clementina]
 gb|ESR34384.1| hypothetical protein CICLE_v10007027mg [Citrus clementina]
Length=959

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+V L LGF +G WGVCGTL+L  SWR  Y+ FL   K+ L  T  V  AK ++
Sbjct  903  FYVGLILGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYVTAAVNIAKLQK  956



>ref|XP_003631328.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
 ref|XP_010655681.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
 ref|XP_010655689.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=1001

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W V G+L+LK SWR AYF+F+++ +++L     V  A+ KR M
Sbjct  939  FFISMGLGFPVGFWVVYGSLVLKKSWRQAYFRFIDETRDRLYVFTAVNVARLKRKM  994



>ref|XP_006378288.1| hypothetical protein POPTR_0010s06880g [Populus trichocarpa]
 gb|ERP56085.1| hypothetical protein POPTR_0010s06880g [Populus trichocarpa]
Length=436

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++ +  GF LG W VCGTLI+K SW+ AYFQF+++ K+K+   I V  A+ +R
Sbjct  383  FYIGMAAGFSLGFWVVCGTLIMKKSWKRAYFQFVDETKDKIFVAIAVCVARLRR  436



>ref|XP_009363290.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=525

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            FF+SL LGFILG WGVCGTL+LK SWR AYF++ +  K+K
Sbjct  473  FFISLVLGFILGFWGVCGTLVLKKSWRHAYFRWFDAIKDK  512



>ref|XP_008226566.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Prunus 
mume]
Length=571

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++ + LGFI+G WGVCG+L++ ++WR AYF+F+++ +++L   + V     KR
Sbjct  514  FYIFVVLGFIVGFWGVCGSLVINNTWRYAYFRFIDNVQDRLYVMVTVCINTMKR  567



>ref|XP_003631327.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=996

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
            FF+S+ LGF +G W VCG+L LK SWR A F+F+++ +++L     V  A+ KR M
Sbjct  934  FFISMGLGFPVGFWVVCGSLALKQSWRQANFRFIDETRDRLYVFTAVNVARLKRKM  989



>ref|XP_010671922.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=1271

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
              ++S+ LGFILG WGVCGTL++K +WR A+F+ L+D K K 
Sbjct  962   LYISVLLGFILGFWGVCGTLVIKTNWRHAFFKLLDDVKNKF  1002



>ref|XP_006490687.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
 gb|KDO56859.1| hypothetical protein CISIN_1g046848mg [Citrus sinensis]
Length=956

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VSL LGF +G WG CGTL++K SWR  Y+ FL   K     T VV  AK +R
Sbjct  899  FYVSLILGFFVGFWGFCGTLLVKSSWRHRYYNFLTGVKNWFYVTAVVNIAKLQR  952



>ref|XP_008226025.1| PREDICTED: receptor-like protein 12 [Prunus mume]
Length=588

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            F F+VS+ LGFI+G WGV GTLI+K SWR AYF++ +D K+K
Sbjct  535  FWFYVSMALGFIVGFWGVFGTLIVKKSWRYAYFRWFDDIKDK  576



>ref|XP_006421146.1| hypothetical protein CICLE_v10006889mg [Citrus clementina]
 gb|ESR34386.1| hypothetical protein CICLE_v10006889mg [Citrus clementina]
Length=959

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS  LGF +G WGVCGTL+L  SWR  Y+ FL   K+ L  T  V  AK ++
Sbjct  903  FYVSSILGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLSVTAAVNIAKLQK  956



>ref|XP_007214258.1| hypothetical protein PRUPE_ppa024554mg, partial [Prunus persica]
 gb|EMJ15457.1| hypothetical protein PRUPE_ppa024554mg, partial [Prunus persica]
Length=961

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK--LC  349
            F F+VS+ LGFI+G WGV GTLI+K SWR AYF++ +D K+K  LC
Sbjct  916  FWFYVSMALGFIVGFWGVFGTLIVKKSWRYAYFRWFDDIKDKATLC  961



>ref|XP_006421141.1| hypothetical protein CICLE_v10004374mg [Citrus clementina]
 gb|ESR34381.1| hypothetical protein CICLE_v10004374mg [Citrus clementina]
Length=773

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VSL LGF +G WGVCGTL+L  SWR  +F FL   K+ +     V  AK +R
Sbjct  716  FYVSLILGFFVGFWGVCGTLMLNRSWRYGFFNFLTGMKDWIYVIAAVNIAKLQR  769



>ref|XP_002514847.1| serine/threonine-protein kinase bri1, putative [Ricinus communis]
 gb|EEF47401.1| serine/threonine-protein kinase bri1, putative [Ricinus communis]
Length=1018

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  480   FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             F F++ +  GF +G W VCGTLI+K SWR AYF+F++DKK+       +  A+ ++
Sbjct  956   FWFYIGIAPGFAVGFWVVCGTLIIKKSWRQAYFRFIDDKKDSFLLIFSITLARLRK  1011



>ref|XP_009365386.1| PREDICTED: receptor-like protein kinase 5 [Pyrus x bretschneideri]
Length=155

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             +VS+ LGFI+G W  C TLILK SWR AYFQ  +D K+K+   I +     KR
Sbjct  99   LYVSMVLGFIVGFWDFCSTLILKTSWRYAYFQLFDDIKDKVALAIALKVTHFKR  152



>ref|XP_007021418.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12943.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=960

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+  + +GFI+G WG+CG L+ K SWR +YF+FL++ K+ L    V+  A+ +R
Sbjct  903  FYAGMGIGFIVGFWGICGALLFKRSWRHSYFRFLDNMKDWLYVRFVLQKARLER  956



>ref|XP_008383308.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=417

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++S+ LGFI+G WGVCGTL++K +WR AYF + +  K+K+   I V  A+ +R
Sbjct  362  FYISIALGFIVGFWGVCGTLVVKKTWRYAYFGWFDAIKDKVLLAIAVQMARFQR  415



>emb|CAN75075.1| hypothetical protein VITISV_026260 [Vitis vinifera]
Length=969

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGVS*  295
            F+VS+  GF +G WGVC TLI+K+SWR AYF+ + D KE L   I +  A+ +R + +  
Sbjct  884  FYVSMGPGFAVGFWGVCVTLIVKNSWRHAYFRLVYDVKEWLLMVISLIVARLRRKLNLGS  943

Query  294  IGI  286
            I I
Sbjct  944  IWI  946



>ref|XP_010662622.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Vitis vinifera]
Length=573

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTT  343
            F  S+ LGFI+G WGVCGTL+L  SWR AYFQFL   K++L  T
Sbjct  515  FSGSIVLGFIIGFWGVCGTLLLNSSWRHAYFQFLNKIKDRLYMT  558



>ref|XP_007045051.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY00883.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=134

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
             ++S  LGF++G W V GTL++K S R AYF++LE+ K+KL   I V  A+ +R M V
Sbjct  74   MYISAVLGFVIGFWAVFGTLVIKKSVRRAYFRYLENMKDKLFVLIAVKLARLQRKMEV  131



>ref|XP_008355404.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=275

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+++  LGFI G WGVCG+LI+K +WR AYF+F ++ +++L   + V   + KR
Sbjct  219  FYIAAALGFICGFWGVCGSLIIKKTWRYAYFRFTDNVQDRLYVMLAVRMNRMKR  272



>ref|XP_009364149.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=708

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKL  352
            F +S+ LGFI+G WGVCG L+   SWR AYFQFL + K++ 
Sbjct  666  FHISVALGFIVGFWGVCGPLVFSTSWRYAYFQFLSNVKDRF  706



>emb|CBI22585.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTT  343
            F  S+ LGFI+G WGVCGTL+L  SWR AYFQFL   K++L  T
Sbjct  488  FSGSIVLGFIIGFWGVCGTLLLNSSWRHAYFQFLNKIKDRLYMT  531



>ref|XP_008346107.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=387

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            F+VS+ LGFI+G WGVCGTLILK SWR  YFQFL    +K
Sbjct  348  FYVSVVLGFIVGFWGVCGTLILKASWRYVYFQFLYKINDK  387



>ref|XP_006348987.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=1000

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            FFVS+ +GF++G WGVC  LI+K SWR AYFQF+    +KL    ++  A  +R
Sbjct  944  FFVSIGVGFVVGFWGVCAILIIKSSWRHAYFQFVGYLGDKLFVIFILPWASWRR  997



>ref|XP_008355013.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=442

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEK  355
            F++S+ LGFI+G WGVCG+L L  SWR AYFQFL D K++
Sbjct  400  FYISVALGFIVGFWGVCGSLALITSWRYAYFQFLSDVKDR  439



>gb|KCW86891.1| hypothetical protein EUGRSUZ_B03474 [Eucalyptus grandis]
Length=992

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+ S+ LGF++G W VCGTL++K SWR AYF+F +  K+ L   + +  A  +R
Sbjct  919  FYTSIVLGFLVGFWSVCGTLVIKSSWRQAYFRFADKMKDNLYLAVQLKTAWLRR  972



>ref|XP_010087193.1| Receptor-like protein 12 [Morus notabilis]
 gb|EXB28474.1| Receptor-like protein 12 [Morus notabilis]
Length=416

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  480  FDFFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLC  349
            F F VS+ +GF +G WG+CG+L+L  SWR AYF+F +DKKE +C
Sbjct  358  FGFGVSVGIGFFVGFWGLCGSLLLNSSWRHAYFRFFDDKKELIC  401



>ref|XP_002268246.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=909

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVV  334
            F++S+ LGFI+G WGVCG L+ K +WR AYFQFL D ++ +   + +
Sbjct  844  FYISMGLGFIVGFWGVCGALLFKENWRYAYFQFLYDIRDWVYVAVAI  890



>ref|XP_009389813.1| PREDICTED: receptor-like protein 12 [Musa acuminata subsp. malaccensis]
Length=1096

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  474   FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGM  307
              + S+TLGFI+G W +CG+L+L  +WR AYF  +++  +KL   +VV  AK KR +
Sbjct  1041  LYTSITLGFIIGFWTICGSLLLLRTWRIAYFHAIDNMFDKLYVMMVVTMAKYKRKL  1096



>ref|XP_009389812.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Musa acuminata subsp. malaccensis]
Length=584

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
             + S+TLGFI G W +CG+L+L+ +WR  YF+ +++  +KL   +VV  AK KR
Sbjct  529  LYTSITLGFITGFWAICGSLLLRRTWRITYFRAIDNMFDKLYVMMVVTVAKYKR  582



>ref|XP_007212603.1| hypothetical protein PRUPE_ppa016919mg, partial [Prunus persica]
 gb|EMJ13802.1| hypothetical protein PRUPE_ppa016919mg, partial [Prunus persica]
Length=612

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F++   LGFI+G WGVCG+L++  +WR  YF+F+ + +E+L   +++   K KR
Sbjct  555  FYIFTVLGFIVGFWGVCGSLVVNKTWRYVYFRFINNVQERLYVMVIMSINKMKR  608



>ref|XP_010646953.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=667

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKRGMGV  301
            F+VS+  GF +G WGVC TLI+K+SWR AYF+ + D KE L   I +  A+ +R + +
Sbjct  607  FYVSMGPGFAVGFWGVCVTLIVKNSWRHAYFRLVYDVKEWLLMVISLNVARLRRKLNL  664



>ref|XP_006421149.1| hypothetical protein CICLE_v10004252mg [Citrus clementina]
 gb|ESR34389.1| hypothetical protein CICLE_v10004252mg [Citrus clementina]
Length=960

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  474  FFVSLTLGFILGXWGVCGTLILKHSWRXAYFQFLEDKKEKLCTTIVVYGAKXKR  313
            F+VS  LGF +G WGVCGTL+L  SWR  Y+ FL   K+ L  T  V  AK ++
Sbjct  904  FYVSSILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAAVNIAKLQK  957



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000