BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035H24

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620566.1|  PREDICTED: probable methyltransferase PMT13        251   7e-76   Nicotiana tomentosiformis
ref|XP_009782445.1|  PREDICTED: probable methyltransferase PMT13        250   1e-75   Nicotiana sylvestris
ref|XP_004229834.1|  PREDICTED: probable methyltransferase PMT13        246   5e-74   Solanum lycopersicum
ref|XP_006339458.1|  PREDICTED: probable methyltransferase PMT13-...    245   8e-74   Solanum tuberosum [potatoes]
ref|XP_011091711.1|  PREDICTED: probable methyltransferase PMT13        245   1e-73   Sesamum indicum [beniseed]
ref|XP_007051915.1|  S-adenosyl-L-methionine-dependent methyltran...    244   2e-73   
gb|EYU32065.1|  hypothetical protein MIMGU_mgv1a003241mg                240   6e-72   Erythranthe guttata [common monkey flower]
gb|KJB22349.1|  hypothetical protein B456_004G042500                    239   2e-71   Gossypium raimondii
gb|KJB41229.1|  hypothetical protein B456_007G095900                    239   2e-71   Gossypium raimondii
ref|XP_010278571.1|  PREDICTED: probable methyltransferase PMT13        237   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_010529254.1|  PREDICTED: probable methyltransferase PMT13        237   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_006396269.1|  hypothetical protein EUTSA_v10028525mg             236   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_002872932.1|  hypothetical protein ARALYDRAFT_490495             236   5e-70   
gb|KEH18952.1|  methyltransferase                                       235   6e-70   Medicago truncatula
gb|KDO86020.1|  hypothetical protein CISIN_1g007645mg                   229   6e-70   Citrus sinensis [apfelsine]
ref|XP_010419629.1|  PREDICTED: probable methyltransferase PMT13        234   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010427357.1|  PREDICTED: probable methyltransferase PMT13        234   2e-69   Camelina sativa [gold-of-pleasure]
ref|NP_567184.1|  type II membrane pectin methyltransferase             234   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010055223.1|  PREDICTED: probable methyltransferase PMT13        233   2e-69   Eucalyptus grandis [rose gum]
ref|XP_006491019.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    233   3e-69   
ref|XP_002272714.1|  PREDICTED: probable methyltransferase PMT13        233   3e-69   Vitis vinifera
ref|XP_010671696.1|  PREDICTED: probable methyltransferase PMT13 ...    229   7e-69   
gb|KHN27285.1|  Putative methyltransferase PMT13                        229   7e-69   Glycine soja [wild soybean]
ref|XP_011093168.1|  PREDICTED: probable methyltransferase PMT13        232   1e-68   Sesamum indicum [beniseed]
gb|AFK44386.1|  unknown                                                 226   3e-68   Medicago truncatula
gb|KDO86019.1|  hypothetical protein CISIN_1g007645mg                   229   3e-68   Citrus sinensis [apfelsine]
ref|XP_006286484.1|  hypothetical protein CARUB_v10000518mg             230   6e-68   Capsella rubella
ref|XP_003521295.1|  PREDICTED: probable methyltransferase PMT13-...    230   6e-68   Glycine max [soybeans]
gb|KEH23339.1|  methyltransferase PMT16, putative                       226   9e-68   Medicago truncatula
ref|XP_006445145.1|  hypothetical protein CICLE_v10019404mg             229   1e-67   Citrus clementina [clementine]
ref|XP_010671687.1|  PREDICTED: probable methyltransferase PMT13 ...    229   2e-67   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX91893.1|  BnaC03g31950D                                          229   2e-67   
ref|XP_003552360.1|  PREDICTED: probable methyltransferase PMT13-...    228   2e-67   Glycine max [soybeans]
gb|KHN29412.1|  Putative methyltransferase PMT13                        224   2e-67   Glycine soja [wild soybean]
ref|XP_004133879.1|  PREDICTED: probable methyltransferase PMT13-...    227   8e-67   Cucumis sativus [cucumbers]
gb|KHN04625.1|  Putative methyltransferase PMT13                        223   9e-67   Glycine soja [wild soybean]
ref|XP_010091551.1|  putative methyltransferase PMT13                   225   1e-66   
ref|XP_008438089.1|  PREDICTED: probable methyltransferase PMT13        226   2e-66   Cucumis melo [Oriental melon]
ref|XP_008232740.1|  PREDICTED: probable methyltransferase PMT13        226   2e-66   Prunus mume [ume]
emb|CDP08877.1|  unnamed protein product                                226   2e-66   Coffea canephora [robusta coffee]
ref|XP_009134532.1|  PREDICTED: probable methyltransferase PMT13        226   3e-66   Brassica rapa
ref|XP_004492679.1|  PREDICTED: probable methyltransferase PMT13-...    225   3e-66   Cicer arietinum [garbanzo]
ref|XP_007220546.1|  hypothetical protein PRUPE_ppa003145mg             225   3e-66   Prunus persica
ref|XP_008799525.1|  PREDICTED: probable methyltransferase PMT13        225   3e-66   
ref|XP_007139954.1|  hypothetical protein PHAVU_008G072600g             225   4e-66   Phaseolus vulgaris [French bean]
ref|XP_004306834.1|  PREDICTED: probable methyltransferase PMT13 ...    225   4e-66   Fragaria vesca subsp. vesca
emb|CDX74348.1|  BnaA03g26990D                                          225   4e-66   
ref|XP_003623833.1|  hypothetical protein MTR_7g076150                  224   6e-66   Medicago truncatula
gb|AIU48625.1|  quasimodo 3                                             222   6e-66   Solanum lycopersicum
gb|AIU48615.1|  quasimodo 3                                             222   7e-66   Solanum tuberosum [potatoes]
gb|AIU48592.1|  quasimodo 3                                             222   1e-65   Theobroma cacao [chocolate]
ref|XP_003534594.1|  PREDICTED: probable methyltransferase PMT13-...    224   1e-65   Glycine max [soybeans]
gb|AIU48585.1|  quasimodo 3                                             221   2e-65   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002511800.1|  conserved hypothetical protein                     221   2e-65   
ref|XP_002320756.1|  dehydration-responsive family protein              223   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_003528881.1|  PREDICTED: probable methyltransferase PMT13-...    223   2e-65   Glycine max [soybeans]
ref|XP_010919246.1|  PREDICTED: probable methyltransferase PMT13 ...    223   2e-65   Elaeis guineensis
ref|XP_011035117.1|  PREDICTED: probable methyltransferase PMT13        223   2e-65   Populus euphratica
ref|XP_009349940.1|  PREDICTED: probable methyltransferase PMT13        223   2e-65   Pyrus x bretschneideri [bai li]
gb|AIU48586.1|  quasimodo 3                                             219   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382296.1|  PREDICTED: probable methyltransferase PMT13        221   8e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU48597.1|  quasimodo 3                                             219   2e-64   Carica papaya [mamon]
ref|XP_008383241.1|  PREDICTED: probable methyltransferase PMT13        220   2e-64   
ref|XP_008385702.1|  PREDICTED: probable methyltransferase PMT13        220   4e-64   
ref|XP_009111460.1|  PREDICTED: probable methyltransferase PMT13        219   4e-64   Brassica rapa
emb|CDY51142.1|  BnaA09g51770D                                          220   6e-64   Brassica napus [oilseed rape]
gb|AIU48627.1|  quasimodo 3                                             217   7e-64   Schrenkiella parvula
emb|CDY07198.1|  BnaCnng02130D                                          219   9e-64   
gb|AIU48613.1|  quasimodo 3                                             216   1e-63   Erythranthe guttata [common monkey flower]
gb|AIU48632.1|  quasimodo 3                                             216   2e-63   Platanus x hispanica [London plane tree]
gb|AIU48598.1|  quasimodo 3                                             215   4e-63   Capsella rubella
ref|XP_009343540.1|  PREDICTED: probable methyltransferase PMT13        217   5e-63   Pyrus x bretschneideri [bai li]
gb|AIU48628.1|  quasimodo 3                                             214   7e-63   Vitis vinifera
gb|AIU48594.1|  quasimodo 3                                             214   7e-63   Sarcandra glabra
gb|KDP28683.1|  hypothetical protein JCGZ_14454                         215   2e-62   Jatropha curcas
ref|XP_006652660.1|  PREDICTED: probable methyltransferase PMT13-...    212   3e-62   
ref|XP_010255504.1|  PREDICTED: probable methyltransferase PMT13        214   3e-62   Nelumbo nucifera [Indian lotus]
gb|AIU48595.1|  quasimodo 3                                             212   4e-62   Citrus clementina [clementine]
dbj|BAJ96685.1|  predicted protein                                      214   5e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK25383.1|  unknown                                                 213   1e-61   Picea sitchensis
gb|AIU48609.1|  quasimodo 3                                             211   2e-61   Aristolochia tagala
gb|AIU48584.1|  quasimodo 3                                             210   4e-61   Aquilegia coerulea [Rocky Mountain columbine]
gb|KJB24669.1|  hypothetical protein B456_004G156600                    211   6e-61   Gossypium raimondii
gb|AIU48616.1|  quasimodo 3                                             209   7e-61   Populus trichocarpa [western balsam poplar]
gb|AIU48610.1|  quasimodo 3                                             208   1e-60   Medicago truncatula
ref|XP_002448358.1|  hypothetical protein SORBIDRAFT_06g025780          210   1e-60   
gb|AIU48619.1|  quasimodo 3                                             208   2e-60   Phaseolus vulgaris [French bean]
gb|AIU48588.1|  quasimodo 3                                             208   2e-60   Magnolia denudata [haku-mokuren]
gb|EEE61526.1|  hypothetical protein OsJ_15828                          207   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AIU48621.1|  quasimodo 3                                             207   3e-60   Ricinus communis
emb|CAH67036.1|  OSIGBa0139P06.9                                        209   5e-60   Oryza sativa [red rice]
gb|AIU48617.1|  quasimodo 3                                             207   6e-60   Prunus persica
emb|CAE02253.2|  OSJNBb0032E06.12                                       208   8e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AIU48637.1|  quasimodo 3                                             206   9e-60   Trachycarpus fortunei
ref|XP_009401770.1|  PREDICTED: probable methyltransferase PMT13        208   9e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU48601.1|  quasimodo 3                                             206   2e-59   Illicium henryi
ref|XP_007134962.1|  hypothetical protein PHAVU_010G090400g             207   2e-59   Phaseolus vulgaris [French bean]
dbj|BAJ98075.1|  predicted protein                                      206   2e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU48602.1|  quasimodo 3                                             205   2e-59   Buxus sinica
ref|XP_003580350.1|  PREDICTED: probable methyltransferase PMT13        206   4e-59   Brachypodium distachyon [annual false brome]
gb|AIU48622.1|  quasimodo 3                                             204   5e-59   Dioscorea oppositifolia
gb|AIU48612.1|  quasimodo 3                                             204   9e-59   Manihot esculenta [manioc]
ref|XP_010053663.1|  PREDICTED: probable methyltransferase PMT13        205   9e-59   Eucalyptus grandis [rose gum]
gb|AIU48606.1|  quasimodo 3                                             203   1e-58   Chimonanthus praecox [wintersweet]
ref|XP_004976531.1|  PREDICTED: probable methyltransferase PMT13-...    204   2e-58   Setaria italica
ref|XP_008669009.1|  PREDICTED: probable methyltransferase PMT13        203   4e-58   Zea mays [maize]
gb|AIU48589.1|  quasimodo 3                                             201   7e-58   Musa acuminata [banana]
gb|AIU48590.1|  quasimodo 3                                             201   9e-58   Pinellia ternata
gb|AIU48604.1|  quasimodo 3                                             201   9e-58   Chloranthus japonicus
gb|AIU48596.1|  quasimodo 3                                             200   2e-57   Gossypium raimondii
ref|XP_006857872.1|  hypothetical protein AMTR_s00069p00098800          201   5e-57   Amborella trichopoda
gb|AIU48608.1|  quasimodo 3                                             199   5e-57   Asparagus officinalis
gb|AIU48630.1|  quasimodo 3                                             199   7e-57   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48636.1|  quasimodo 3                                             199   8e-57   Alisma plantago-aquatica
gb|AIU48631.1|  quasimodo 3                                             197   2e-56   Cinnamomum camphora
gb|AIU48605.1|  quasimodo 3                                             197   3e-56   Ceratophyllum demersum [hornwort]
gb|AIU48593.1|  quasimodo 3                                             196   8e-56   Acorus calamus [flagroot]
gb|AIU48607.1|  quasimodo 3                                             194   2e-55   Pandanus utilis
gb|AIU48611.1|  quasimodo 3                                             194   3e-55   Canna indica [canna]
gb|AIU48603.1|  quasimodo 3                                             194   6e-55   Iris japonica
gb|AIU48629.1|  quasimodo 3                                             193   8e-55   Lactuca sativa [cultivated lettuce]
gb|AIU48626.1|  quasimodo 3                                             192   2e-54   Sorghum bicolor [broomcorn]
gb|AIU48591.1|  quasimodo 3                                             191   3e-54   Brachypodium distachyon [annual false brome]
gb|AIU48618.1|  quasimodo 3                                             191   4e-54   Panicum virgatum
gb|AIU48600.1|  quasimodo 3                                             191   8e-54   Eucalyptus grandis [rose gum]
gb|AIU48635.1|  quasimodo 3                                             189   2e-53   Zea mays [maize]
gb|AIU48633.1|  quasimodo 3                                             189   2e-53   Ginkgo biloba [ginkgo]
gb|AIU48634.1|  quasimodo 3                                             187   1e-52   Houttuynia cordata [chameleon-plant]
gb|AIU48623.1|  quasimodo 3                                             187   2e-52   Yucca filamentosa [Adam's-needle]
gb|AIU48624.1|  quasimodo 3                                             186   3e-52   Setaria italica
gb|AIU48614.1|  quasimodo 3                                             177   8e-52   Persea americana
gb|AIU48638.1|  quasimodo 3                                             184   2e-51   Cabomba caroliniana
ref|NP_001053597.1|  Os04g0569400                                       181   2e-50   
gb|EMT18939.1|  hypothetical protein F775_17795                         170   9e-47   
gb|AAD17338.1|  F15P23.2 gene product                                   168   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961169.1|  hypothetical protein SELMODRAFT_74065              164   2e-43   Selaginella moellendorffii
ref|XP_002966837.1|  hypothetical protein SELMODRAFT_168608             164   2e-43   Selaginella moellendorffii
ref|XP_001769468.1|  predicted protein                                  161   2e-42   
emb|CDY70936.1|  BnaAnng35600D                                          147   2e-40   Brassica napus [oilseed rape]
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             155   3e-40   
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             154   3e-40   Selaginella moellendorffii
ref|XP_010110847.1|  putative methyltransferase PMT18                   148   3e-40   
gb|KHN06856.1|  Putative methyltransferase PMT2                         147   5e-40   Glycine soja [wild soybean]
ref|NP_001056669.2|  Os06g0128100                                       147   1e-39   
ref|XP_001772854.1|  predicted protein                                  153   1e-39   
gb|KGN56550.1|  hypothetical protein Csa_3G123720                       150   2e-39   Cucumis sativus [cucumbers]
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        152   2e-39   Cucumis melo [Oriental melon]
gb|AEW70176.1|  early responsive to dehydration 3                       144   3e-39   Pinus densiflora var. densiflora
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like    146   3e-39   
ref|XP_001779831.1|  predicted protein                                  152   3e-39   
gb|AAL24268.1|  AT4g00750/F15P23_1                                      143   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AEW70177.1|  early responsive to dehydration 3                       144   3e-39   Pinus densiflora var. densiflora
gb|AIF75712.1|  early response to drought 3                             144   3e-39   Pinus hwangshanensis
gb|AEW70169.1|  early responsive to dehydration 3                       144   4e-39   Pinus sylvestris var. mongolica
gb|AEW70174.1|  early responsive to dehydration 3                       144   4e-39   Pinus densiflora var. ussuriensis
gb|AIF75714.1|  early response to drought 3                             144   4e-39   Pinus hwangshanensis
gb|ABS83492.1|  early response to drought 3                             144   4e-39   Pinus pinaster [cluster pine]
gb|KDO82912.1|  hypothetical protein CISIN_1g0105922mg                  148   4e-39   Citrus sinensis [apfelsine]
gb|AEW70168.1|  early responsive to dehydration 3                       144   5e-39   Pinus sylvestris var. mongolica
ref|XP_004979626.1|  PREDICTED: probable methyltransferase PMT2-like    151   5e-39   Setaria italica
gb|AEW70171.1|  early responsive to dehydration 3                       144   5e-39   Pinus sylvestris var. mongolica
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    151   5e-39   Cicer arietinum [garbanzo]
gb|KHN15675.1|  Putative methyltransferase PMT16                        149   6e-39   Glycine soja [wild soybean]
ref|XP_008392677.1|  PREDICTED: probable methyltransferase PMT18        142   6e-39   
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    150   7e-39   Oryza brachyantha
ref|XP_008660000.1|  PREDICTED: probable methyltransferase PMT2 i...    148   8e-39   Zea mays [maize]
gb|ACB59070.1|  early response to drought 3                             144   8e-39   Pinus elliottii [American pitch pine]
gb|AHY28778.1|  early response to drought 3                             142   8e-39   Pinus elliottii [American pitch pine]
gb|AIF75710.1|  early response to drought 3                             143   8e-39   Pinus massoniana [Chinese red pine]
gb|AHY28777.1|  early response to drought 3                             143   8e-39   Pinus echinata [shortleaf pine]
gb|ACO57101.1|  early responsive to dehydration 3                       143   9e-39   Pinus halepensis [Aleppo pine]
ref|XP_004133882.1|  PREDICTED: probable methyltransferase PMT15-...    150   1e-38   
ref|XP_004155808.1|  PREDICTED: probable methyltransferase PMT15-...    150   1e-38   
ref|NP_001050233.1|  Os03g0379100                                       150   2e-38   
ref|XP_010662513.1|  PREDICTED: probable methyltransferase PMT15 ...    147   2e-38   
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  149   2e-38   Medicago truncatula
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    149   2e-38   Glycine max [soybeans]
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        149   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001152056.1|  methyltransferase                                  149   2e-38   Zea mays [maize]
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                       149   3e-38   
gb|ACF86888.1|  unknown                                                 143   3e-38   Zea mays [maize]
gb|AAW72868.1|  early response to drought 3                             142   3e-38   Pinus taeda
gb|AAW72852.1|  early response to drought 3                             142   3e-38   Pinus taeda
ref|XP_008373610.1|  PREDICTED: probable methyltransferase PMT14        145   3e-38   
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    149   3e-38   
gb|AIF75711.1|  early response to drought 3                             141   3e-38   Pinus hwangshanensis
gb|ABR16934.1|  unknown                                                 149   4e-38   Picea sitchensis
ref|XP_008668148.1|  PREDICTED: methyltransferase isoform X1            149   4e-38   
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          149   4e-38   Sorghum bicolor [broomcorn]
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        149   4e-38   Populus euphratica
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    148   5e-38   Glycine max [soybeans]
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    148   5e-38   
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        148   5e-38   Phoenix dactylifera
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         148   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        148   6e-38   
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          151   7e-38   Medicago truncatula
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    148   7e-38   Setaria italica
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  147   7e-38   Citrus sinensis [apfelsine]
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    148   8e-38   
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        148   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             147   9e-38   
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         147   9e-38   Brachypodium distachyon [annual false brome]
emb|CDY03207.1|  BnaC09g19490D                                          147   1e-37   
gb|KDO43766.1|  hypothetical protein CISIN_1g026623mg                   142   1e-37   Citrus sinensis [apfelsine]
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    147   1e-37   Vitis vinifera
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         147   1e-37   Nicotiana sylvestris
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         147   1e-37   Nicotiana tomentosiformis
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  147   1e-37   Medicago truncatula
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             147   1e-37   Prunus persica
gb|KJB51709.1|  hypothetical protein B456_008G228900                    147   1e-37   Gossypium raimondii
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         147   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    147   1e-37   Glycine max [soybeans]
emb|CDX99539.1|  BnaC09g24530D                                          147   1e-37   
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    147   1e-37   Populus euphratica
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             147   1e-37   Citrus clementina [clementine]
emb|CDP12267.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             147   2e-37   
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             147   2e-37   Populus trichocarpa [western balsam poplar]
emb|CDP00327.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         147   2e-37   
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    147   2e-37   Elaeis guineensis
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    147   2e-37   
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    147   2e-37   Glycine max [soybeans]
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        147   2e-37   Sesamum indicum [beniseed]
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        147   2e-37   Nelumbo nucifera [Indian lotus]
gb|KHN17371.1|  Putative methyltransferase PMT2                         147   2e-37   Glycine soja [wild soybean]
gb|AAM67038.1|  unknown                                                 138   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAW72877.1|  early response to drought 3                             140   3e-37   Pinus taeda
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        146   3e-37   Cucumis melo [Oriental melon]
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    146   3e-37   Eucalyptus grandis [rose gum]
ref|NP_001170352.1|  uncharacterized protein LOC100384329               139   3e-37   
gb|EAY79581.1|  hypothetical protein OsI_34717                          146   3e-37   Oryza sativa Indica Group [Indian rice]
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          146   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010255519.1|  PREDICTED: probable methyltransferase PMT15 ...    144   3e-37   Nelumbo nucifera [Indian lotus]
ref|NP_001065447.2|  Os10g0569300                                       146   3e-37   
ref|XP_004169220.1|  PREDICTED: probable methyltransferase PMT18-...    146   3e-37   
gb|KHG27439.1|  hypothetical protein F383_15139                         146   3e-37   Gossypium arboreum [tree cotton]
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18-...    146   3e-37   Cucumis sativus [cucumbers]
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        146   3e-37   Brassica rapa
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    146   3e-37   Glycine max [soybeans]
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   146   3e-37   Citrus sinensis [apfelsine]
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                146   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_002528760.1|  ATP binding protein, putative                      146   3e-37   Ricinus communis
ref|XP_010091504.1|  putative methyltransferase PMT2                    146   3e-37   Morus notabilis
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    146   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL86466.1|AC077693_5  hypothetical protein                          147   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    146   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    146   4e-37   Solanum tuberosum [potatoes]
gb|EAZ09099.1|  hypothetical protein OsI_31366                          146   4e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    146   4e-37   Setaria italica
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14        146   4e-37   Fragaria vesca subsp. vesca
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    146   4e-37   Glycine max [soybeans]
gb|KHN21029.1|  Putative methyltransferase PMT14                        145   4e-37   Glycine soja [wild soybean]
gb|EAZ35683.1|  hypothetical protein OsJ_19971                          145   4e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KHG10506.1|  hypothetical protein F383_11349                         145   4e-37   Gossypium arboreum [tree cotton]
emb|CDP05238.1|  unnamed protein product                                146   4e-37   Coffea canephora [robusta coffee]
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        145   4e-37   Populus euphratica
gb|KJB60757.1|  hypothetical protein B456_009G324300                    145   5e-37   Gossypium raimondii
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         145   5e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        145   5e-37   Brassica rapa
gb|ACN26954.1|  unknown                                                 142   5e-37   Zea mays [maize]
gb|KDP25187.1|  hypothetical protein JCGZ_20343                         145   5e-37   Jatropha curcas
gb|KDP22915.1|  hypothetical protein JCGZ_01776                         145   5e-37   Jatropha curcas
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         145   5e-37   Populus euphratica
gb|ABK94953.1|  unknown                                                 144   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    145   5e-37   Oryza brachyantha
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         145   5e-37   Populus euphratica
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             145   5e-37   Phaseolus vulgaris [French bean]
ref|XP_010110495.1|  putative methyltransferase PMT14                   145   5e-37   Morus notabilis
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        145   6e-37   Prunus mume [ume]
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        145   6e-37   Sesamum indicum [beniseed]
ref|XP_006656589.1|  PREDICTED: probable methyltransferase PMT15-...    145   6e-37   
ref|XP_001778231.1|  predicted protein                                  145   6e-37   
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                145   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             145   6e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006857883.1|  hypothetical protein AMTR_s00069p00110310          145   6e-37   Amborella trichopoda
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    145   6e-37   Citrus sinensis [apfelsine]
ref|XP_002317647.1|  dehydration-responsive family protein              145   7e-37   Populus trichocarpa [western balsam poplar]
gb|AEX55231.1|  putative cold-regulated protein                         142   7e-37   Allium sativum
gb|ABO92980.1|  putative methyltransferase                              145   7e-37   
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        145   7e-37   
dbj|BAC24840.1|  dehydration-responsive protein-like                    145   7e-37   
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             145   7e-37   
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630          145   7e-37   
ref|XP_002511570.1|  ATP binding protein, putative                      145   8e-37   
gb|EPS68701.1|  hypothetical protein M569_06064                         145   8e-37   
gb|KJB80180.1|  hypothetical protein B456_013G084900                    145   8e-37   
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         145   8e-37   
gb|EPS61626.1|  hypothetical protein M569_13168                         143   8e-37   
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         145   8e-37   
ref|XP_010089758.1|  putative methyltransferase PMT2                    145   8e-37   
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    145   8e-37   
gb|KHG23981.1|  hypothetical protein F383_09020                         145   8e-37   
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             145   8e-37   
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    145   9e-37   
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    145   9e-37   
gb|EMS59423.1|  putative methyltransferase PMT2                         145   9e-37   
gb|KHN12213.1|  Putative methyltransferase PMT2                         144   1e-36   
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    145   1e-36   
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        145   1e-36   
gb|EMS63414.1|  putative methyltransferase PMT2                         144   1e-36   
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    145   1e-36   
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             144   1e-36   
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        145   1e-36   
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        145   1e-36   
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        144   1e-36   
gb|KDP31241.1|  hypothetical protein JCGZ_11617                         144   1e-36   
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         144   1e-36   
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             145   1e-36   
emb|CDX94256.1|  BnaC02g29160D                                          144   1e-36   
ref|XP_002298987.1|  dehydration-responsive family protein              144   1e-36   
ref|NP_001063174.1|  Os09g0415700                                       144   1e-36   
gb|AAX94055.2|  dehydration-induced protein                             144   1e-36   
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             144   1e-36   
gb|EPS64080.1|  hypothetical protein M569_10695                         144   1e-36   
gb|KJB09867.1|  hypothetical protein B456_001G171500                    144   1e-36   
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   144   1e-36   
ref|XP_006846537.1|  hypothetical protein AMTR_s00018p00198280          144   1e-36   
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         144   1e-36   
gb|EMT05545.1|  hypothetical protein F775_20122                         144   1e-36   
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         144   1e-36   
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        144   1e-36   
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        144   1e-36   
emb|CDP12320.1|  unnamed protein product                                147   1e-36   
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    144   1e-36   
gb|KHN01216.1|  Putative methyltransferase PMT2                         144   2e-36   
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        144   2e-36   
gb|KDP28686.1|  hypothetical protein JCGZ_14457                         144   2e-36   
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    144   2e-36   
ref|XP_002518966.1|  ATP binding protein, putative                      144   2e-36   
gb|KEH17379.1|  methyltransferase PMT16, putative                       144   2e-36   
gb|ABO93008.1|  putative methyltransferase                              143   2e-36   
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    144   2e-36   
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         144   2e-36   
ref|XP_007139953.1|  hypothetical protein PHAVU_008G072500g             142   2e-36   
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    144   2e-36   
gb|KJB24074.1|  hypothetical protein B456_004G127200                    144   2e-36   
gb|KJB18847.1|  hypothetical protein B456_003G072700                    142   2e-36   
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         144   2e-36   
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         144   2e-36   
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         144   2e-36   
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         144   2e-36   
gb|KDP22318.1|  hypothetical protein JCGZ_26149                         144   2e-36   
emb|CDY16198.1|  BnaA09g29320D                                          144   2e-36   
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         144   2e-36   
gb|KHN04623.1|  Putative methyltransferase PMT15                        142   2e-36   
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        144   2e-36   
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    144   2e-36   
emb|CDY50730.1|  BnaC05g50930D                                          143   3e-36   
emb|CBI34642.3|  unnamed protein product                                143   3e-36   
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    144   3e-36   
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        144   3e-36   
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        144   3e-36   
ref|XP_002511797.1|  ATP binding protein, putative                      144   3e-36   
emb|CBI33946.3|  unnamed protein product                                143   3e-36   
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        144   3e-36   
gb|KDP41191.1|  hypothetical protein JCGZ_15598                         143   3e-36   
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    144   3e-36   
emb|CAH18000.1|  Ankyrin protein kinase-like                            143   3e-36   
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         143   3e-36   
emb|CDY35169.1|  BnaA09g18060D                                          144   3e-36   
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        143   4e-36   
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    143   4e-36   
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        143   4e-36   
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         143   4e-36   
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    143   4e-36   
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                143   4e-36   
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        143   4e-36   
emb|CDY40268.1|  BnaA07g09320D                                          143   4e-36   
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         143   4e-36   
emb|CBI31965.3|  unnamed protein product                                142   4e-36   
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    143   5e-36   
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     143   5e-36   
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          143   5e-36   
ref|XP_004160003.1|  PREDICTED: probable methyltransferase PMT2-like    142   5e-36   
ref|XP_003628359.1|  hypothetical protein MTR_8g055840                  141   5e-36   
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        143   5e-36   
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        143   5e-36   
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    143   5e-36   
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    143   5e-36   
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    143   5e-36   
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        142   5e-36   
gb|ACB54686.1|  methyltransferase                                       142   5e-36   
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        143   5e-36   
gb|ACA66248.1|  putative methyltransferase                              142   5e-36   
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                143   6e-36   
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        143   6e-36   
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
ref|XP_007139952.1|  hypothetical protein PHAVU_008G072400g             143   6e-36   
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
gb|KJB18849.1|  hypothetical protein B456_003G072700                    142   6e-36   
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
emb|CDY46435.1|  BnaA08g19950D                                          142   6e-36   
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    142   6e-36   
gb|EMT27426.1|  hypothetical protein F775_29617                         142   6e-36   
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
emb|CDP08881.1|  unnamed protein product                                143   6e-36   
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
gb|KEH21299.1|  methyltransferase PMT16, putative                       142   6e-36   
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...    143   6e-36   
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         142   6e-36   
ref|NP_001152470.1|  ankyrin protein kinase-like                        142   6e-36   
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    142   6e-36   
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             142   6e-36   
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    143   6e-36   
emb|CDY45006.1|  BnaCnng12360D                                          142   6e-36   
gb|EMS49438.1|  putative methyltransferase PMT2                         142   7e-36   
ref|XP_004499422.1|  PREDICTED: probable methyltransferase PMT2-l...    142   7e-36   
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        142   7e-36   
gb|AFK42259.1|  unknown                                                 135   7e-36   
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g             142   7e-36   
ref|XP_002522425.1|  ATP binding protein, putative                      142   7e-36   
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         142   7e-36   
gb|KJB18848.1|  hypothetical protein B456_003G072700                    142   7e-36   
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    142   8e-36   
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    142   8e-36   
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             142   8e-36   
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         142   8e-36   
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    142   8e-36   
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    142   9e-36   
gb|KHM99141.1|  Putative methyltransferase PMT15                        140   9e-36   
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        142   9e-36   
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        142   9e-36   
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    142   9e-36   
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        142   9e-36   
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        142   9e-36   
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        142   9e-36   
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        142   9e-36   
gb|KJB18860.1|  hypothetical protein B456_003G072700                    142   9e-36   
ref|XP_002875017.1|  dehydration-responsive family protein              142   9e-36   
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    142   1e-35   
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        142   1e-35   
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    142   1e-35   
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    142   1e-35   
gb|EMS54302.1|  putative methyltransferase PMT17                        142   1e-35   
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        142   1e-35   
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        142   1e-35   
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    142   1e-35   
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2-like    142   1e-35   
ref|XP_004307681.1|  PREDICTED: probable methyltransferase PMT23        142   1e-35   
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    142   1e-35   
ref|XP_007160205.1|  hypothetical protein PHAVU_002G301800g             142   1e-35   
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14-...    142   1e-35   
ref|NP_191984.1|  putative methyltransferase PMT15                      142   1e-35   
ref|XP_004499421.1|  PREDICTED: probable methyltransferase PMT2-l...    142   1e-35   
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    142   1e-35   
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    142   1e-35   
dbj|BAH20410.1|  AT4G18030                                              140   1e-35   
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    142   1e-35   
ref|XP_009342549.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    141   1e-35   
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    142   1e-35   
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        141   1e-35   
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  141   1e-35   
ref|XP_010441570.1|  PREDICTED: probable methyltransferase PMT14        140   1e-35   
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    142   1e-35   
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    142   1e-35   
ref|XP_002893375.1|  dehydration-responsive family protein              141   1e-35   
ref|XP_003528883.1|  PREDICTED: probable methyltransferase PMT15-...    142   1e-35   
gb|EEE52366.1|  hypothetical protein OsJ_34430                          141   1e-35   
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         141   2e-35   
gb|EEC68449.1|  hypothetical protein OsI_36659                          141   2e-35   
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    141   2e-35   
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    141   2e-35   
ref|XP_010091548.1|  putative methyltransferase PMT15                   141   2e-35   
ref|NP_001280936.1|  uncharacterized protein LOC103402903               141   2e-35   
gb|KHN16709.1|  Putative methyltransferase PMT18                        141   2e-35   
ref|XP_003628358.1|  hypothetical protein MTR_8g055840                  140   2e-35   
gb|KEH33485.1|  methyltransferase PMT2-like protein                     141   2e-35   
gb|KHN29409.1|  Putative methyltransferase PMT15                        139   2e-35   
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         141   2e-35   
gb|KHG11272.1|  hypothetical protein F383_13094                         139   2e-35   
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             141   2e-35   
gb|EEE61530.1|  hypothetical protein OsJ_15834                          140   2e-35   
ref|NP_001068227.1|  Os11g0601600                                       141   2e-35   
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             141   2e-35   
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             141   2e-35   
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             141   2e-35   
gb|KHM99867.1|  Putative methyltransferase PMT18                        140   2e-35   
gb|EMT22301.1|  hypothetical protein F775_16518                         141   2e-35   
dbj|BAH19504.1|  AT1G26850                                              141   2e-35   
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    141   2e-35   
gb|ACJ85858.1|  unknown                                                 141   2e-35   
ref|XP_006578576.1|  PREDICTED: probable methyltransferase PMT2-l...    139   2e-35   
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  141   2e-35   
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        141   2e-35   
ref|NP_564265.1|  putative methyltransferase PMT2                       141   2e-35   
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        141   2e-35   
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         140   2e-35   
ref|NP_001147806.1|  methyltransferase                                  141   3e-35   
gb|KEH18956.1|  methyltransferase                                       141   3e-35   
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460             141   3e-35   
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             141   3e-35   
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    140   3e-35   
ref|XP_002874627.1|  dehydration-responsive family protein              141   3e-35   
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        141   3e-35   
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        141   3e-35   
ref|XP_006398351.1|  hypothetical protein EUTSA_v10000856mg             140   3e-35   
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        140   3e-35   



>ref|XP_009620566.1| PREDICTED: probable methyltransferase PMT13 [Nicotiana tomentosiformis]
Length=599

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDP+WVMNVVPAHKPLTLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIHV AIESL
Sbjct  457  AAALSSDPIWVMNVVPAHKPLTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHVGAIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP SGK+RC+LVDLMVEIDRMLRPEG+V++RDSPEVID+ ERIA AVRWT SI+EKEP
Sbjct  517  IKDPLSGKTRCSLVDLMVEIDRMLRPEGTVIVRDSPEVIDKVERIAPAVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S SH
Sbjct  577  ESHGREKILVATKNFWKLPSASH  599



>ref|XP_009782445.1| PREDICTED: probable methyltransferase PMT13 [Nicotiana sylvestris]
Length=599

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDP+WVMNVVPAHKPLTLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIHV AIESL
Sbjct  457  AAALASDPIWVMNVVPAHKPLTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHVGAIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP SGK+RC+LVDLMVEIDRMLRPEG+V+IRDSPEVID+ +RIA AVRWT SI+EKEP
Sbjct  517  IKDPVSGKTRCSLVDLMVEIDRMLRPEGTVIIRDSPEVIDKVDRIAPAVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S SH
Sbjct  577  ESHGREKILVATKNFWKLPSASH  599



>ref|XP_004229834.1| PREDICTED: probable methyltransferase PMT13 [Solanum lycopersicum]
Length=599

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDP+WVMNVVPA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHV AIESL
Sbjct  457  AAALSSDPIWVMNVVPAQKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVGAIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP SGK RC+LVDLMVEIDR+LRPEG+V+IRDSPEVID+ ERIA AVRWT SI+EKEP
Sbjct  517  IKDPVSGKIRCSLVDLMVEIDRILRPEGTVIIRDSPEVIDKVERIAPAVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S+S+
Sbjct  577  ESHGREKILVATKNFWKLPSSSY  599



>ref|XP_006339458.1| PREDICTED: probable methyltransferase PMT13-like [Solanum tuberosum]
Length=599

 Score =   245 bits (626),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDP+WVMNVVPA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHV AIESL
Sbjct  457  AAALSSDPIWVMNVVPAQKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVGAIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP SGK RC+LVDLMVEIDR+LRPEG+V+IRDSPEVID+ ERIA AVRWT SI+EKEP
Sbjct  517  IKDPVSGKIRCSLVDLMVEIDRILRPEGTVIIRDSPEVIDKVERIAPAVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S S+
Sbjct  577  ESHGREKILVATKNFWKLPSASY  599



>ref|XP_011091711.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
Length=597

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIHVAA+ESL
Sbjct  455  AAAIISDPVWVMNVVPACKPSTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHVAAVESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDPSSGKSRCN+VDLMVEIDRMLRPEG+ VIRDSPEVID+ +RI+ A+RW TS+++KEP
Sbjct  515  IKDPSSGKSRCNIVDLMVEIDRMLRPEGTAVIRDSPEVIDKIDRISRAIRWRTSVHDKEP  574

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVA K  W L S SH
Sbjct  575  ESHGREKILVARKNFWKLPSASH  597



>ref|XP_007051915.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX96072.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=598

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ISDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHVA IESL
Sbjct  456  AAALISDPVWVMNVVPARKPLTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S KSRC LVDLMVEIDRMLRPEG+VVIRDSPEV+D+  RIAHAVRW  +IY+KEP
Sbjct  516  IKLPGSSKSRCTLVDLMVEIDRMLRPEGTVVIRDSPEVLDKVTRIAHAVRWRATIYDKEP  575

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L+S SH
Sbjct  576  ESHGREKILVATKTFWQLTSASH  598



>gb|EYU32065.1| hypothetical protein MIMGU_mgv1a003241mg [Erythranthe guttata]
Length=597

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIH+ AIESL
Sbjct  455  AAAIISDPVWVMNVVPARKPSTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHIDAIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP SGK+RCN+VDLMVEIDR+LRPEG VVIRDSPEVID+  RI+HA+RW  SI++KEP
Sbjct  515  IKDPVSGKNRCNMVDLMVEIDRILRPEGKVVIRDSPEVIDKVYRISHAIRWKASIHDKEP  574

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++G+E+ILVATK  W L S+SH
Sbjct  575  ESHGKERILVATKSLWKLPSSSH  597



>gb|KJB22349.1| hypothetical protein B456_004G042500 [Gossypium raimondii]
Length=598

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVA IESL
Sbjct  456  AAALKSDPVWVMNVVPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S KSRCNLVDLMVEIDRMLRPEG+VVIRDSPEVI++  RIAHAVRW+ +I +KEP
Sbjct  516  IKLPGSSKSRCNLVDLMVEIDRMLRPEGTVVIRDSPEVIEKVARIAHAVRWSATINDKEP  575

Query  269  GANGREKILVATKKHWNLSSTS  204
             ++GRE ILVATK  W L+S+S
Sbjct  576  ESHGRENILVATKTFWQLTSSS  597



>gb|KJB41229.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
 gb|KJB41232.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=597

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYD IHVA IESL
Sbjct  456  AAALVSDPVWVMNVVPARKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVAGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S KSRCNLVDLMVE+DRMLRPEG+VVIRDSPEVID+  RIAHAVRWT +I +KEP
Sbjct  516  IKLPGSSKSRCNLVDLMVEMDRMLRPEGTVVIRDSPEVIDKVARIAHAVRWTATINDKEP  575

Query  269  GANGREKILVATKKHWNLSST  207
             ++GREKILVATK  W L+S+
Sbjct  576  ESHGREKILVATKTFWKLTSS  596



>ref|XP_010278571.1| PREDICTED: probable methyltransferase PMT13 [Nelumbo nucifera]
Length=595

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNVVP  KP TL +IYDRGLIG+YHDWCEPFSTYPRTYDLIHV +IESL
Sbjct  453  AAALLSDPVWVMNVVPPRKPSTLGMIYDRGLIGMYHDWCEPFSTYPRTYDLIHVTSIESL  512

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P SGK+RCNLVDLMVEIDRMLRPEG+VV+RDSPEVID+  RIA A+RWT +I+E EP
Sbjct  513  VKHPGSGKNRCNLVDLMVEIDRMLRPEGTVVVRDSPEVIDKVGRIARAIRWTANIHEPEP  572

Query  269  GANGREKILVATKKHWNLSSTSH  201
             + GREKILVATKK W L S SH
Sbjct  573  ESTGREKILVATKKFWKLPSASH  595



>ref|XP_010529254.1| PREDICTED: probable methyltransferase PMT13 [Tarenaya hassleriana]
Length=599

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA++ SDPVWVMNV+PA  PLTLDVIYDRGLIG YHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  457  AASLASDPVWVMNVIPARNPLTLDVIYDRGLIGAYHDWCEPFSTYPRTYDFIHVSGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             + P S K+RC+LVDLMVE+DR+LRPEG+V+IRDSPEVID+ E IA AVRW++SI+EKEP
Sbjct  517  IRQPRSSKTRCSLVDLMVEMDRILRPEGTVLIRDSPEVIDKVESIARAVRWSSSIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
            G++GREKIL+ATK  WNL S SH
Sbjct  577  GSHGREKILIATKSPWNLPSNSH  599



>ref|XP_006396269.1| hypothetical protein EUTSA_v10028525mg [Eutrema salsugineum]
 gb|ESQ37722.1| hypothetical protein EUTSA_v10028525mg [Eutrema salsugineum]
Length=599

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  457  AAALASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S KSRC+LVDLMVE+DR+LRPEG V+IRDSPEV+D+  R+AHAVRW++SI++KEP
Sbjct  517  IKRPGSSKSRCSLVDLMVEMDRILRPEGKVLIRDSPEVLDKVARMAHAVRWSSSIHDKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  577  ESHGREKILVATKSLWKMPSNSH  599



>ref|XP_002872932.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49191.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. 
lyrata]
Length=602

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  460  AAALASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  519

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  520  IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEP  579

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKIL+ATK  W L S SH
Sbjct  580  ESHGREKILIATKSLWKLPSNSH  602



>gb|KEH18952.1| methyltransferase [Medicago truncatula]
Length=602

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP  KP TLD+I+DRGLIGVYHDWCEPFSTYPR+YDLIHVA+IESL
Sbjct  465  AAALKSDPVWVMNVVPFRKPSTLDMIFDRGLIGVYHDWCEPFSTYPRSYDLIHVASIESL  524

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP SGKSRCNLVDLMVEIDRMLRPEG+VV+RD+PEVID+  R+AHAVRW  +IY+KEP
Sbjct  525  IKDPVSGKSRCNLVDLMVEIDRMLRPEGTVVVRDNPEVIDKVARVAHAVRWRPTIYDKEP  584

Query  269  GANGREKILVATKKHWNL  216
            G+ G++KILVATK  W L
Sbjct  585  GSQGKDKILVATKTFWTL  602



>gb|KDO86020.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=378

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV+ IESL
Sbjct  239  AAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESL  298

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+P S K+ C+LVDLMVE+DRMLRPEG+VV+RDSPEVID+  RIA+ VRWT ++++KEP
Sbjct  299  IKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEP  358

Query  269  GANGREKILVATKKHWNLSS  210
            G+NGREKILVATK  W L S
Sbjct  359  GSNGREKILVATKSLWKLPS  378



>ref|XP_010419629.1| PREDICTED: probable methyltransferase PMT13 [Camelina sativa]
Length=599

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+PVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  457  AAALASEPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  517  IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKIL+ATK  W L S SH
Sbjct  577  ESHGREKILIATKSLWKLPSNSH  599



>ref|XP_010427357.1| PREDICTED: probable methyltransferase PMT13 [Camelina sativa]
Length=599

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+PVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  457  AAALASEPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  517  IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKMARMAHAVRWSSSIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKIL+ATK  W L S SH
Sbjct  577  ESHGREKILIATKSLWKLPSNSH  599



>ref|NP_567184.1| type II membrane pectin methyltransferase [Arabidopsis thaliana]
 sp|Q93W95.1|PMTD_ARATH RecName: Full=Probable methyltransferase PMT13 [Arabidopsis thaliana]
 gb|AAL24317.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL24395.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15470.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37736.1| At4g00740 [Arabidopsis thaliana]
 gb|AEE81928.1| type II membrane pectin methyltransferase [Arabidopsis thaliana]
Length=600

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA + SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  458  AATLASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  517

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  518  IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEP  577

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKIL+ATK  W L S SH
Sbjct  578  ESHGREKILIATKSLWKLPSNSH  600



>ref|XP_010055223.1| PREDICTED: probable methyltransferase PMT13 [Eucalyptus grandis]
 gb|KCW71691.1| hypothetical protein EUGRSUZ_E00210 [Eucalyptus grandis]
Length=596

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ISDPVWVMNVVPA KP TL VIYDRGL GVYHDWCEPFSTYPRTYD IHVA IE L
Sbjct  454  AAALISDPVWVMNVVPARKPSTLGVIYDRGLTGVYHDWCEPFSTYPRTYDFIHVAGIELL  513

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            TKDPS+ KSRC+LVDLMVE+DR+LRPEG VVIRDSPEVIDR  RIA AVRW+ +I+E+EP
Sbjct  514  TKDPSTSKSRCHLVDLMVEMDRILRPEGKVVIRDSPEVIDRISRIADAVRWSATIHEQEP  573

Query  269  GANGREKILVATKKHWNLSSTS  204
            G++ REKILVATK  W L ++S
Sbjct  574  GSHAREKILVATKSFWKLPTSS  595



>ref|XP_006491019.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT13-like 
[Citrus sinensis]
Length=598

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV+ IESL
Sbjct  456  AAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+P S K+ C+LVDLMVE+DRMLRPEG+VV+RDSPEVID+  RIA+ VRWT ++++KEP
Sbjct  516  IKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEP  575

Query  269  GANGREKILVATKKHWNLSSTSH  201
            G+NGREKILVATK  W L S SH
Sbjct  576  GSNGREKILVATKSLWKLPSXSH  598



>ref|XP_002272714.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 ref|XP_010661563.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 ref|XP_010661564.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 emb|CBI38767.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP  KP TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV +IESL
Sbjct  455  AAALTSDPVWVMNVVPPRKPSTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVTSIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   SGK+RCNLVDLMVE+DR+LRPEG+VVIRDSPEVID+  RIA AVRWT +I+EKEP
Sbjct  515  IKILGSGKNRCNLVDLMVEMDRILRPEGTVVIRDSPEVIDKIGRIAQAVRWTATIHEKEP  574

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S SH
Sbjct  575  ESHGREKILVATKNFWKLPSASH  597



>ref|XP_010671696.1| PREDICTED: probable methyltransferase PMT13 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=448

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SD VWVMNVVP HKP TLDVIYDRGLIGVYHDWCEPFSTYPRTYD +HV+ IESL
Sbjct  309  AAALVSDLVWVMNVVPPHKPSTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFLHVSGIESL  368

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD +SGK RC+LVDLMVE+DR+LRPEG+VV+RDSPEVID+  R+AHA+RWTTSI+EKEP
Sbjct  369  IKDSASGKQRCHLVDLMVEMDRILRPEGTVVVRDSPEVIDKVSRLAHAMRWTTSIHEKEP  428

Query  269  GANGREKILVATKKHWN  219
             ++GR++ILVATK  W 
Sbjct  429  DSSGRDRILVATKTLWK  445



>gb|KHN27285.1| Putative methyltransferase PMT13, partial [Glycine soja]
Length=475

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP+HKP+TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIHVA++ESL
Sbjct  338  AAALNSDPVWVMNVVPSHKPITLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHVASMESL  397

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC L+DLMVE+DR+LRPEG+VV+RD+PEVI++  R+AHAVRW  +IY KEP
Sbjct  398  VKDPASGRNRCTLLDLMVELDRILRPEGTVVVRDTPEVIEKVARVAHAVRWKPTIYNKEP  457

Query  269  GANGREKILVATKKHWN  219
             ++GREKILVATK  W 
Sbjct  458  ESHGREKILVATKTFWK  474



>ref|XP_011093168.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
 ref|XP_011093169.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
Length=601

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI SDPVWVMNVVP+ K LTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHV  IESL
Sbjct  460  AAAIASDPVWVMNVVPSSKTLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVDDIESL  519

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDPSSG +RCNLVDLMVEIDRMLRP+G+V+IRDSPE I++   I+HA+RWTTS++EKEP
Sbjct  520  LKDPSSGMNRCNLVDLMVEIDRMLRPKGTVIIRDSPEAIEKLGHISHALRWTTSVHEKEP  579

Query  269  GANGREKILVATKKHWNLSST  207
             ++GRE++LVATK  W LS++
Sbjct  580  RSHGRERVLVATKSLWKLSAS  600



>gb|AFK44386.1| unknown [Medicago truncatula]
Length=387

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVVPA KP TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  250  AAALKFDPVWVMNVVPAQKPPTLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHAVSIESL  309

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP++GK+RCN+VDLMVEIDR+LRPEG+VV+RD+P+VID+  RIAHAVRW  +IY+KEP
Sbjct  310  IKDPATGKNRCNIVDLMVEIDRILRPEGTVVLRDAPKVIDKVARIAHAVRWKPTIYDKEP  369

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILV TK  W L
Sbjct  370  DSHGREKILVLTKTLWKL  387



>gb|KDO86019.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=527

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV+ IESL
Sbjct  388  AAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESL  447

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+P S K+ C+LVDLMVE+DRMLRPEG+VV+RDSPEVID+  RIA+ VRWT ++++KEP
Sbjct  448  IKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEP  507

Query  269  GANGREKILVATKKHWNLSS  210
            G+NGREKILVATK  W L S
Sbjct  508  GSNGREKILVATKSLWKLPS  527



>ref|XP_006286484.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
 gb|EOA19382.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
Length=599

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+ VWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  457  AAALASETVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI++KEP
Sbjct  517  IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHDKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKIL+ATK  W L S+SH
Sbjct  577  ESHGREKILIATKSLWKLPSSSH  599



>ref|XP_003521295.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=597

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP+HKP+TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIHVA++ESL
Sbjct  460  AAALNSDPVWVMNVVPSHKPITLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHVASMESL  519

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC L+DLMVE+DR+LRPEG+VV+RD+PEVI++  R+AHAVRW  +IY KEP
Sbjct  520  VKDPASGRNRCTLLDLMVELDRILRPEGTVVVRDTPEVIEKVARVAHAVRWKPTIYNKEP  579

Query  269  GANGREKILVATKKHWN  219
             ++GREKILVATK  W 
Sbjct  580  ESHGREKILVATKTFWK  596



>gb|KEH23339.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=446

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVVPA KP TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  309  AAALKFDPVWVMNVVPAQKPPTLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHAVSIESL  368

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP++GK+RCN+VDLMVEIDR+LRPEG+VV+RD+P+VID+  RIAHAVRW  +IY+KEP
Sbjct  369  IKDPATGKNRCNIVDLMVEIDRILRPEGTVVLRDAPKVIDKVARIAHAVRWKPTIYDKEP  428

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILV TK  W L
Sbjct  429  DSHGREKILVLTKTLWKL  446



>ref|XP_006445145.1| hypothetical protein CICLE_v10019404mg [Citrus clementina]
 gb|ESR58385.1| hypothetical protein CICLE_v10019404mg [Citrus clementina]
 gb|KDO86018.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=595

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV+ IESL
Sbjct  456  AAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+P S K+ C+LVDLMVE+DRMLRPEG+VV+RDSPEVID+  RIA+ VRWT ++++KEP
Sbjct  516  IKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEP  575

Query  269  GANGREKILVATKKHWNLSS  210
            G+NGREKILVATK  W L S
Sbjct  576  GSNGREKILVATKSLWKLPS  595



>ref|XP_010671687.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SD VWVMNVVP HKP TLDVIYDRGLIGVYHDWCEPFSTYPRTYD +HV+ IESL
Sbjct  458  AAALVSDLVWVMNVVPPHKPSTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFLHVSGIESL  517

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD +SGK RC+LVDLMVE+DR+LRPEG+VV+RDSPEVID+  R+AHA+RWTTSI+EKEP
Sbjct  518  IKDSASGKQRCHLVDLMVEMDRILRPEGTVVVRDSPEVIDKVSRLAHAMRWTTSIHEKEP  577

Query  269  GANGREKILVATKKHWN  219
             ++GR++ILVATK  W 
Sbjct  578  DSSGRDRILVATKTLWK  594



>emb|CDX91893.1| BnaC03g31950D [Brassica napus]
Length=597

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+ VWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  455  AAALASESVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S KSRC+LVDLMVE+DR+LRPEG V+IRD+PEV+D+  R+AHAVRW+++I++KEP
Sbjct  515  IKRPDSSKSRCSLVDLMVEMDRILRPEGKVLIRDTPEVLDKVARMAHAVRWSSTIHDKEP  574

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  575  ESHGREKILVATKPLWKMPSNSH  597



>ref|XP_003552360.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=596

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWV+NVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPR+YDLIHVA+IESL
Sbjct  459  AAALKSDPVWVINVVPALKPPTLDVIFDRGLIGVYHDWCEPFSTYPRSYDLIHVASIESL  518

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC LVDLMVEIDRMLRPEG+VV+RD+PEVIDR  RIA AVRW  ++Y+KEP
Sbjct  519  IKDPASGQNRCTLVDLMVEIDRMLRPEGTVVVRDAPEVIDRVARIASAVRWKPTVYDKEP  578

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILVATK  W L
Sbjct  579  ESHGREKILVATKTLWKL  596



>gb|KHN29412.1| Putative methyltransferase PMT13 [Glycine soja]
Length=445

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPR+YDLIHV ++ESL
Sbjct  308  AAALKSDPVWVMNVVPAQKPPTLDVIFDRGLIGVYHDWCEPFSTYPRSYDLIHVVSVESL  367

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC LVDLMVEIDR+LRPEG++V+RD+PEVIDR   IA AVRW  ++Y+KEP
Sbjct  368  IKDPASGQNRCTLVDLMVEIDRILRPEGTMVVRDAPEVIDRVAHIAGAVRWKPTVYDKEP  427

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILVATK  W L
Sbjct  428  ESHGREKILVATKTLWKL  445



>ref|XP_004133879.1| PREDICTED: probable methyltransferase PMT13-like [Cucumis sativus]
 ref|XP_004155811.1| PREDICTED: probable methyltransferase PMT13-like [Cucumis sativus]
 gb|KGN56547.1| hypothetical protein Csa_3G123200 [Cucumis sativus]
Length=593

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI SDPVWVMNVVP+HKP TL  IYDRGLIGVYHDWCEPFSTYPR+YD IHV+ IESL
Sbjct  455  AAAIKSDPVWVMNVVPSHKPSTLAAIYDRGLIGVYHDWCEPFSTYPRSYDFIHVSGIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
               P S KSRCNLVDLMVE+DR LRPEG+VVIRD+PE I+R  RIA A+RWT +++EKEP
Sbjct  515  VNYPGSDKSRCNLVDLMVEMDRFLRPEGTVVIRDNPEAIERVSRIARAIRWTATVHEKEP  574

Query  269  GANGREKILVATKKHWNL  216
            G+ GREKILVATK  W L
Sbjct  575  GSQGREKILVATKNFWKL  592



>gb|KHN04625.1| Putative methyltransferase PMT13 [Glycine soja]
Length=446

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP+HKP+TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  309  AAALNSDPVWVMNVVPSHKPITLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHATSIESL  368

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC+L+DLMVE+DR+LRPEG+VV+RD+PEVI++  R+  AVRW  +IY KEP
Sbjct  369  IKDPASGRNRCSLLDLMVELDRILRPEGTVVVRDTPEVIEKVARVVRAVRWKPTIYNKEP  428

Query  269  GANGREKILVATKKHWN  219
             ++GREKILVATK  W 
Sbjct  429  ESHGREKILVATKTFWK  445



>ref|XP_010091551.1| putative methyltransferase PMT13 [Morus notabilis]
 gb|EXB44736.1| putative methyltransferase PMT13 [Morus notabilis]
Length=545

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCEPFSTYPRTYD IHV  IESL
Sbjct  403  AAALKSDPVWVMNVVPARKLSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVTDIESL  462

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S K+RCNLVDLM E+DR+LRPEG+VV+RDSPEVID+  RIA AVRWT +I++KEP
Sbjct  463  IKHQGSSKNRCNLVDLMAEMDRILRPEGTVVVRDSPEVIDKVARIARAVRWTATIHQKEP  522

Query  269  GANGREKILVATKKHWNLSSTSH  201
             +NGREKILVATK  W L S SH
Sbjct  523  ESNGREKILVATKTFWKLPSASH  545



>ref|XP_008438089.1| PREDICTED: probable methyltransferase PMT13 [Cucumis melo]
Length=593

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI SDPVWVMNVVP+HKP TL  IYDRGLIGVYHDWCEPFSTYPR+YD IHV+ IESL
Sbjct  455  AAAIKSDPVWVMNVVPSHKPSTLAAIYDRGLIGVYHDWCEPFSTYPRSYDFIHVSGIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
               P S K+RCNLVDLMVE+DR LRPEG+VV+RD+PEVI+R  RIA  VRWT +I+EKEP
Sbjct  515  VNYPGSDKNRCNLVDLMVEMDRFLRPEGTVVVRDNPEVIERVSRIARGVRWTATIHEKEP  574

Query  269  GANGREKILVATKKHWNL  216
            G+ GREKILVATK  W L
Sbjct  575  GSQGREKILVATKNFWKL  592



>ref|XP_008232740.1| PREDICTED: probable methyltransferase PMT13 [Prunus mume]
Length=599

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SD VWVMNVVPA KP TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IESL
Sbjct  457  AAALKSDAVWVMNVVPARKPSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+ CNLVDLMVE+DRMLRPEG+V++RDSPEVI++  RIAHAVRWT SI+EKEP
Sbjct  517  IKHPGSTKNSCNLVDLMVEMDRMLRPEGTVLVRDSPEVIEKVARIAHAVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S S+
Sbjct  577  ESHGREKILVATKTFWTLPSASN  599



>emb|CDP08877.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA +   L VIYDRGLIG+YHDWCEPFSTYPRTYDLIH  ++ESL
Sbjct  459  AAALTSDPVWVMNVVPARQHSMLGVIYDRGLIGMYHDWCEPFSTYPRTYDLIHAVSVESL  518

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD SSGK RCNLVDLMVEIDRMLRPEG+VV+RDSPE+ID+  RIA AVRW  +I+EKEP
Sbjct  519  IKDSSSGKLRCNLVDLMVEIDRMLRPEGTVVVRDSPEMIDKVARIARAVRWRVAIHEKEP  578

Query  269  GANGREKILVATKKHWNLSSTSH  201
             +NGREKILV TK  W L S S+
Sbjct  579  ESNGREKILVGTKNLWKLPSASN  601



>ref|XP_009134532.1| PREDICTED: probable methyltransferase PMT13 [Brassica rapa]
Length=597

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+ VWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  455  AAALASESVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG V+IRD+PEV+D+  R+AHAVRW+++I++KEP
Sbjct  515  IKRSDSSKSRCSLVDLMVEMDRILRPEGKVLIRDTPEVLDKVARMAHAVRWSSTIHDKEP  574

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  575  ESHGREKILVATKPLWKMPSNSH  597



>ref|XP_004492679.1| PREDICTED: probable methyltransferase PMT13-like [Cicer arietinum]
Length=595

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KP TLD ++DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  458  AAALKSDPVWVMNVVPAQKPPTLDAVFDRGLIGVYHDWCEPFSTYPRTYDLIHAVSIESL  517

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SGKSRCN++D+MVEIDR+LRPEG VV+RD+PEVID+   IAHAVRW + IY++EP
Sbjct  518  IKDPASGKSRCNIIDMMVEIDRILRPEGKVVVRDAPEVIDKVAHIAHAVRWKSKIYDQEP  577

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILV TK  W L
Sbjct  578  DSHGREKILVLTKTLWKL  595



>ref|XP_007220546.1| hypothetical protein PRUPE_ppa003145mg [Prunus persica]
 gb|EMJ21745.1| hypothetical protein PRUPE_ppa003145mg [Prunus persica]
Length=599

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SD VWVMNVVPA KP TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IESL
Sbjct  457  AAALKSDVVWVMNVVPARKPSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+ CNLVDLMVE+DRMLRPEG+V++RDSPEVI++  RIAHAVRWT SI+EKEP
Sbjct  517  IKHPGSTKNSCNLVDLMVEMDRMLRPEGTVLVRDSPEVIEKVARIAHAVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W L S S+
Sbjct  577  ESHGREKILVATKTFWTLPSASN  599



>ref|XP_008799525.1| PREDICTED: probable methyltransferase PMT13 [Phoenix dactylifera]
Length=605

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTL +IYDRGLIGVYHDWCE FSTYPRTYDLIHVA I SL
Sbjct  463  AAALNSDPVWVMNVIPARKPLTLGIIYDRGLIGVYHDWCEAFSTYPRTYDLIHVAGINSL  522

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +DP+SGKSRC+L+DLM+E+DRMLRPEG+ VIRD P+VID+  RIAHA+RWT  ++E EP
Sbjct  523  IRDPTSGKSRCHLLDLMIEMDRMLRPEGTAVIRDLPDVIDKVARIAHAIRWTAQVHESEP  582

Query  269  GANGREKILVATKKHWNLSSTSH  201
               G EKILVATK  W L S S+
Sbjct  583  ETRGGEKILVATKTFWKLPSASN  605



>ref|XP_007139954.1| hypothetical protein PHAVU_008G072600g [Phaseolus vulgaris]
 gb|ESW11948.1| hypothetical protein PHAVU_008G072600g [Phaseolus vulgaris]
Length=592

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  614  SDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESLTKDPS  435
            SDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPR+YDLIHVA+IESL KDP+
Sbjct  460  SDPVWVMNVVPAQKPPTLDVIFDRGLIGVYHDWCEPFSTYPRSYDLIHVASIESLIKDPA  519

Query  434  SGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEPGANGR  255
            SGK+RC LVDLMVEIDR+LRPEG+VV+RD+PEVID+  RIA AVRW  +IY+KEP ++GR
Sbjct  520  SGKNRCTLVDLMVEIDRILRPEGTVVVRDAPEVIDKVARIAGAVRWKPTIYDKEPESHGR  579

Query  254  EKILVATKKHWNL  216
            EKILVATK  W L
Sbjct  580  EKILVATKTLWKL  592



>ref|XP_004306834.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            A A+ SDPVWVMNVVP+ KP TL +IYDRGLIGVYHDWCEPFSTYPR+YD IHV +IESL
Sbjct  457  AGALKSDPVWVMNVVPSRKPSTLSIIYDRGLIGVYHDWCEPFSTYPRSYDFIHVTSIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   +GK+RCNLVDL+VE+DR+LRPEG+VVIRDSPEVID+  RIAH VRWT SI+EKEP
Sbjct  517  IKHSITGKNRCNLVDLLVEMDRILRPEGTVVIRDSPEVIDKIGRIAHNVRWTASIHEKEP  576

Query  269  GANGREKILVATKKHWNLSSTS  204
             ++GREKILVATK  W L S S
Sbjct  577  ESHGREKILVATKNFWKLPSAS  598



>emb|CDX74348.1| BnaA03g26990D [Brassica napus]
Length=597

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+ VWVMNV+PA KPLTLDV+YDRGLIGVYHDWCEPFSTYPRTYD IHV+ IESL
Sbjct  455  AAALASESVWVMNVIPARKPLTLDVVYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S KSRC+LVDLMVE+DR+LRPEG V+IRD+PEV+D+  R+AHAVRW+++I++KEP
Sbjct  515  IKRSDSSKSRCSLVDLMVEMDRILRPEGKVLIRDTPEVLDKVARMAHAVRWSSTIHDKEP  574

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  575  ESHGREKILVATKPLWKMPSNSH  597



>ref|XP_003623833.1| hypothetical protein MTR_7g076150 [Medicago truncatula]
 gb|ABN08824.1| Protein of unknown function DUF248, methyltransferase putative 
[Medicago truncatula]
 gb|AES80051.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=589

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVVPA KP TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  452  AAALKFDPVWVMNVVPAQKPPTLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHAVSIESL  511

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP++GK+RCN+VDLMVEIDR+LRPEG+VV+RD+P+VID+  RIAHAVRW  +IY+KEP
Sbjct  512  IKDPATGKNRCNIVDLMVEIDRILRPEGTVVLRDAPKVIDKVARIAHAVRWKPTIYDKEP  571

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILV TK  W L
Sbjct  572  DSHGREKILVLTKTLWKL  589



>gb|AIU48625.1| quasimodo 3, partial [Solanum lycopersicum]
Length=505

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDP+WVMNVVPA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHV AIES+
Sbjct  374  AAALSSDPIWVMNVVPAQKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVGAIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD  SGK RC+LVDLMVEIDR+LRPEG+V+IRDSPEVID+ ERIA AVRWT SI+EKEP
Sbjct  434  -KD-VSGKIRCSLVDLMVEIDRILRPEGTVIIRDSPEVIDKVERIAPAVRWTASIHEKEP  491

Query  269  GANGREKILVATKK  228
             ++GREKILVATK 
Sbjct  492  ESHGREKILVATKN  505



>gb|AIU48615.1| quasimodo 3, partial [Solanum tuberosum]
Length=505

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDP+WVMNVVPA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHV AIES+
Sbjct  374  AAALSSDPIWVMNVVPAQKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVGAIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD  SGK RC+LVDLMVEIDR+LRPEG+V+IRDSPEVID+ ERIA AVRWT SI+EKEP
Sbjct  434  -KD-VSGKIRCSLVDLMVEIDRILRPEGTVIIRDSPEVIDKVERIAPAVRWTASIHEKEP  491

Query  269  GANGREKILVATKK  228
             ++GREKILVATK 
Sbjct  492  ESHGREKILVATKN  505



>gb|AIU48592.1| quasimodo 3, partial [Theobroma cacao]
Length=505

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ISDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHVA IES+
Sbjct  374  AAALISDPVWVMNVVPARKPLTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S KSRC LVDLMVEIDRMLRPEG+VVIRDSPEV+D+  RIAHAVRW  +IY+KEP
Sbjct  434  KL--GSSKSRCTLVDLMVEIDRMLRPEGTVVIRDSPEVLDKVTRIAHAVRWRATIYDKEP  491

Query  269  GANGREKILVATK  231
             ++GREKILVATK
Sbjct  492  ESHGREKILVATK  504



>ref|XP_003534594.1| PREDICTED: probable methyltransferase PMT13-like isoform X1 [Glycine 
max]
 ref|XP_006587869.1| PREDICTED: probable methyltransferase PMT13-like isoform X2 [Glycine 
max]
Length=597

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPR+YDLIHV ++ESL
Sbjct  460  AAALKSDPVWVMNVVPAQKPPTLDVIFDRGLIGVYHDWCEPFSTYPRSYDLIHVVSVESL  519

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC LVDLMVEIDR+LRPEG++V+RD+PEVIDR   IA AVRW  ++Y+KEP
Sbjct  520  IKDPASGQNRCTLVDLMVEIDRILRPEGTMVVRDAPEVIDRVAHIAGAVRWKPTVYDKEP  579

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILVATK  W L
Sbjct  580  ESHGREKILVATKTLWKL  597



>gb|AIU48585.1| quasimodo 3, partial [Arabidopsis lyrata]
Length=505

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IES+
Sbjct  374  AAALASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D  S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  434  KRD--SSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEP  491

Query  269  GANGREKILVATK  231
             ++GREKIL+ATK
Sbjct  492  ESHGREKILIATK  504



>ref|XP_002511800.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50469.1| conserved hypothetical protein [Ricinus communis]
Length=507

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            A+A+ SDP WVMNVVPA K  TLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIHVA IESL
Sbjct  367  ASALSSDPAWVMNVVPAGKLSTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESL  426

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S K+RCNLVDLMVE+DR+LRPEG+V+IRD+PEVIDR   +AHAV+WT +I+EKEP
Sbjct  427  IK--GSSKNRCNLVDLMVEMDRILRPEGTVLIRDTPEVIDRVAHVAHAVKWTATIHEKEP  484

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKI+VATK  W L S SH
Sbjct  485  ESHGREKIMVATKSFWKLPSASH  507



>ref|XP_002320756.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE99071.1| dehydration-responsive family protein [Populus trichocarpa]
Length=594

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++ DPVWVMNVVPA KP TL VIYDRGLIGVYHDWCEPFSTYPR+YDLIHVA IESL
Sbjct  456  AAALMPDPVWVMNVVPARKPSTLGVIYDRGLIGVYHDWCEPFSTYPRSYDLIHVAGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+RCNLVDLMVE+DR+LRPEG+V+IRDSPEVID+  R+A AVRW  +I+EKEP
Sbjct  516  LKLPGSSKNRCNLVDLMVEMDRILRPEGTVIIRDSPEVIDKVARVALAVRWLVTIHEKEP  575

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILVATK  W L
Sbjct  576  ESSGREKILVATKTFWKL  593



>ref|XP_003528881.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=594

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP+HKP+TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  457  AAALNSDPVWVMNVVPSHKPITLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHATSIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+SG++RC+L+DLMVE+DR+LRPEG+VV+RD+PEVI++  R+  AVRW  +IY KEP
Sbjct  517  IKDPASGRNRCSLLDLMVELDRILRPEGTVVVRDTPEVIEKVARVVRAVRWKPTIYNKEP  576

Query  269  GANGREKILVATKKHWN  219
             ++GREKILVATK  W 
Sbjct  577  ESHGREKILVATKTFWK  593



>ref|XP_010919246.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Elaeis 
guineensis]
Length=605

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTL +IYDRGLIG+YHDWCE FS+YPRTYDLIHVA I SL
Sbjct  463  AAALNSDPVWVMNVIPARKPLTLGIIYDRGLIGLYHDWCEAFSSYPRTYDLIHVAGINSL  522

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +DP+SGKSRC+LVDLM+E+DR+LRPEG+ VIRDSPEVID+  RIAHA+RWT  ++E EP
Sbjct  523  IRDPTSGKSRCHLVDLMIEMDRILRPEGTAVIRDSPEVIDKVARIAHAIRWTAQVHESEP  582

Query  269  GANGREKILVATKKHWNLSSTSH  201
               G EKILVATK  W L   S+
Sbjct  583  ETRGGEKILVATKTLWKLPPASN  605



>ref|XP_011035117.1| PREDICTED: probable methyltransferase PMT13 [Populus euphratica]
Length=594

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++ DPVWVMNVVPA KP TL VIYDRGLIGVYHDWCEPFSTYPR+YDLIHVA IESL
Sbjct  456  AAALMPDPVWVMNVVPARKPSTLGVIYDRGLIGVYHDWCEPFSTYPRSYDLIHVAGIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+RCNLVDLMVE+DR+LRPEG+V+IRDSPEV+D+  R+A AVRW  +I+EKEP
Sbjct  516  LKMPGSSKNRCNLVDLMVEMDRILRPEGTVIIRDSPEVVDKVARVALAVRWLVTIHEKEP  575

Query  269  GANGREKILVATKKHWNL  216
             ++GREKILVATK  W L
Sbjct  576  ESSGREKILVATKSFWKL  593



>ref|XP_009349940.1| PREDICTED: probable methyltransferase PMT13 [Pyrus x bretschneideri]
Length=599

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SD VWVMNVVPA KP TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IESL
Sbjct  457  AAALKSDAVWVMNVVPARKPSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+RCN+VDLMVE+DRMLRPEG+VV+RDSPEVI++  RIAHAVRWT +I+EKE 
Sbjct  517  IKHPGSTKNRCNIVDLMVEMDRMLRPEGTVVVRDSPEVIEKIARIAHAVRWTATIHEKEA  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREK+LVATK  W L S S+
Sbjct  577  ESHGREKVLVATKIFWQLPSASN  599



>gb|AIU48586.1| quasimodo 3, partial [Arabidopsis thaliana]
Length=505

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA + SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IES+
Sbjct  374  AATLASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D  S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  434  KRD--SSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEP  491

Query  269  GANGREKILVATK  231
             ++GREKIL+ATK
Sbjct  492  ESHGREKILIATK  504



>ref|XP_009382296.1| PREDICTED: probable methyltransferase PMT13 [Musa acuminata subsp. 
malaccensis]
Length=600

 Score =   221 bits (564),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA  PLTLD+IYDRGLIG+YHDWCE FSTYPRTYDLIHVA I SL
Sbjct  458  AAALSSDPVWVMNVVPAQNPLTLDIIYDRGLIGLYHDWCEAFSTYPRTYDLIHVAGINSL  517

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D +S   RC+LVDLMVE+DRMLRP+G+ V+RD+PEVIDR  RIAHA+RWT  +++ EP
Sbjct  518  IRDTTSDNDRCSLVDLMVEMDRMLRPQGTAVVRDTPEVIDRVARIAHAIRWTIQVHKSEP  577

Query  269  GANGREKILVATKKHWNLSSTSH  201
             +  REKILVATK  W L +TSH
Sbjct  578  ESGDREKILVATKTFWMLPATSH  600



>gb|AIU48597.1| quasimodo 3, partial [Carica papaya]
Length=505

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNVVPA KP TLDVIYDRGLIG+YHDWCEPFSTYPRTYDL+HVA IES+
Sbjct  374  AAALVSDPVWVMNVVPARKPATLDVIYDRGLIGIYHDWCEPFSTYPRTYDLLHVAGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S KSRC+LVDLMVE+DR+LRPEG+ +IRDSPEVID+  RIAHAVRWT ++YEKEP
Sbjct  434  KH--GSTKSRCSLVDLMVEMDRILRPEGTALIRDSPEVIDKVGRIAHAVRWTFTVYEKEP  491

Query  269  GANGREKILVATK  231
             ++GREKILVATK
Sbjct  492  ESHGREKILVATK  504



>ref|XP_008383241.1| PREDICTED: probable methyltransferase PMT13 [Malus domestica]
Length=599

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SD VWVMNVVPA K  TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IESL
Sbjct  457  AAALKSDAVWVMNVVPARKSSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+RCN+VDLMVE+DRMLRPEG+VV+RDSPEVI++  RIAHAVRWT +I+EKE 
Sbjct  517  IKHPGSTKNRCNIVDLMVEMDRMLRPEGTVVVRDSPEVIEKIARIAHAVRWTATIHEKEA  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREK+LVATK  W L S S+
Sbjct  577  ASHGREKVLVATKIFWQLPSVSN  599



>ref|XP_008385702.1| PREDICTED: probable methyltransferase PMT13 [Malus domestica]
Length=599

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IESL
Sbjct  457  AAALKSDPVWVMNVVPARKSSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S K+RCN+VDLMVE+DRMLRPEG VV+RDSPEVI++  RIAHAVRWT +I+EKE 
Sbjct  517  IKHQGSTKNRCNMVDLMVEMDRMLRPEGIVVVRDSPEVIEKIARIAHAVRWTATIHEKEA  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREK+LVATK  W L S S+
Sbjct  577  ESHGREKVLVATKNFWQLPSASN  599



>ref|XP_009111460.1| PREDICTED: probable methyltransferase PMT13 [Brassica rapa]
Length=591

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 5/143 (3%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+P+ K LTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IH++ IESL
Sbjct  454  AAALASDPVWVMNVIPSRKQLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHLSGIESL  513

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T      KSRC+LVDLMVE+DR+LRPEG V+IRD+PEV+D+  R+AHAVRW++SI++KEP
Sbjct  514  TS-----KSRCSLVDLMVEMDRILRPEGKVLIRDTPEVLDKVARMAHAVRWSSSIHDKEP  568

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  569  ESHGREKILVATKPLWRMPSNSH  591



>emb|CDY51142.1| BnaA09g51770D [Brassica napus]
Length=617

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 5/143 (3%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+P+ K LTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IH++ IESL
Sbjct  480  AAALASDPVWVMNVIPSRKQLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHLSGIESL  539

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T      KSRC+LVDLMVE+DR+LRPEG V+IRD+PEV+D+  R+AHAVRW++SI++KEP
Sbjct  540  TS-----KSRCSLVDLMVEMDRILRPEGKVLIRDTPEVLDKVARMAHAVRWSSSIHDKEP  594

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  595  ESHGREKILVATKPLWRMPSNSH  617



>gb|AIU48627.1| quasimodo 3, partial [Schrenkiella parvula]
Length=505

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IES+
Sbjct  374  AAALASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +   S KSRC+LVDLMVE+DR+LRPEG V+IRDSPEV+D+  R+AHAVRW++SI++KEP
Sbjct  434  KR--GSSKSRCSLVDLMVEMDRILRPEGKVLIRDSPEVLDKVARMAHAVRWSSSIHDKEP  491

Query  269  GANGREKILVATK  231
             ++GREKILVATK
Sbjct  492  ESHGREKILVATK  504



>emb|CDY07198.1| BnaCnng02130D [Brassica napus]
Length=599

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            +AA+ S+ +WVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IH++ +ESL
Sbjct  457  SAALASESLWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHLSGVESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +   S KSRC+LVDLMVE+DR+LRPEG V+IRD+PEV+D+  R+AHAVRW+ SI++K+P
Sbjct  517  IQRSDSSKSRCSLVDLMVEMDRILRPEGKVLIRDTPEVLDKVARMAHAVRWSFSIHDKDP  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKILVATK  W + S SH
Sbjct  577  ESHGREKILVATKPLWRMPSNSH  599



>gb|AIU48613.1| quasimodo 3, partial [Erythranthe guttata]
Length=505

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 121/133 (91%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIH+ AIES+
Sbjct  374  AAAIISDPVWVMNVVPARKPSTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHIDAIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD  SGK+RCN+VDLMVEIDR+LRPEG VVIRDSPEVID+  RI+HA+RW  SI++KEP
Sbjct  434  -KD-VSGKNRCNMVDLMVEIDRILRPEGKVVIRDSPEVIDKVYRISHAIRWKASIHDKEP  491

Query  269  GANGREKILVATK  231
             ++G+E+ILVATK
Sbjct  492  ESHGKERILVATK  504



>gb|AIU48632.1| quasimodo 3, partial [Platanus x acerifolia]
Length=505

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNVVP  KP TL +IYDRGLIG+YHDWCEPFSTYPRTYDLIHVA I+S+
Sbjct  374  AAALVSDPVWVMNVVPPRKPSTLGMIYDRGLIGIYHDWCEPFSTYPRTYDLIHVANIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 SGK+RCNLVDLMVEIDRMLRPE +VV+RDSPEVID+ +RIAHA+RWT+ I+  EP
Sbjct  434  KY--GSGKNRCNLVDLMVEIDRMLRPEATVVVRDSPEVIDKVDRIAHAIRWTSIIHNPEP  491

Query  269  GANGREKILVATKK  228
             +NGREKILVATKK
Sbjct  492  ESNGREKILVATKK  505



>gb|AIU48598.1| quasimodo 3, partial [Capsella rubella]
Length=505

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S+ VWVMNV+PA KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYD IHV+ IES+
Sbjct  374  AAALASETVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D  S KSRC+LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI++KEP
Sbjct  434  KRD--SSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHDKEP  491

Query  269  GANGREKILVATK  231
             ++GREKIL+ATK
Sbjct  492  ESHGREKILIATK  504



>ref|XP_009343540.1| PREDICTED: probable methyltransferase PMT13 [Pyrus x bretschneideri]
Length=599

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IESL
Sbjct  457  AAALKSDPVWVMNVVPARKSSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K   S K+RCN+VDLMVE+DRMLRPEG VV+RDSPEVI++  RIA AVRWT +I+EKE 
Sbjct  517  IKHQGSTKNRCNMVDLMVEMDRMLRPEGIVVVRDSPEVIEKIARIARAVRWTATIHEKEA  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREK+LVATK  W L S S+
Sbjct  577  ESHGREKVLVATKNFWQLPSASN  599



>gb|AIU48628.1| quasimodo 3, partial [Vitis vinifera]
Length=505

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP  KP TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV +IES+
Sbjct  374  AAALTSDPVWVMNVVPPRKPSTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVTSIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 SGK+RCNLVDLMVE+DR+LRPEG+VVIRDSPEVID+  RIA AVRWT +I+EKEP
Sbjct  434  KI--GSGKNRCNLVDLMVEMDRILRPEGTVVIRDSPEVIDKIGRIAQAVRWTATIHEKEP  491

Query  269  GANGREKILVATKK  228
             ++GREKILVATK 
Sbjct  492  ESHGREKILVATKN  505



>gb|AIU48594.1| quasimodo 3, partial [Sarcandra glabra]
Length=504

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA ++SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHVA IES 
Sbjct  374  AATLVSDPVWVMNVVPARKPLTLTVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIES-  432

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T+D SSGKSRCNLVDLMVEIDRMLRP G VVIRDS EVID+   IA AVRWT S+++ EP
Sbjct  433  TRD-SSGKSRCNLVDLMVEIDRMLRPAGMVVIRDSLEVIDKVGHIARAVRWTVSVHKTEP  491

Query  269  GANGREKILVATK  231
             +NGREK+LVATK
Sbjct  492  ESNGREKLLVATK  504



>gb|KDP28683.1| hypothetical protein JCGZ_14454 [Jatropha curcas]
Length=598

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIG+YHDWCEPFSTYPRTYDLIHV +IESL
Sbjct  456  AAALASDPVWVMNVVPAGKLSTLGVIYDRGLIGLYHDWCEPFSTYPRTYDLIHVTSIESL  515

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P S K+RCNLVDL+VE+DR+LRPEG+V+IRD+PEVID+   I  AVRWT   +EKEP
Sbjct  516  IKSPGSSKNRCNLVDLIVEMDRILRPEGTVIIRDTPEVIDKVVYIVRAVRWTAETHEKEP  575

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++ REKILVA K  W L S SH
Sbjct  576  ESHAREKILVARKTFWKLPSASH  598



>ref|XP_006652660.1| PREDICTED: probable methyltransferase PMT13-like [Oryza brachyantha]
Length=457

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++ DPVWVMNVVPA KPLTL VIYDRGLIGVYH+WCEPFSTYPRTYDLIH   I SL
Sbjct  315  AAAVVPDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHEWCEPFSTYPRTYDLIHADGISSL  374

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +DP SGK+RC+L D+M+E+DR+LRPEG+ +IRDSP+VID+  ++A ++RW   +++ EP
Sbjct  375  IRDPISGKNRCDLFDVMLEMDRILRPEGTAIIRDSPDVIDKAAQVAQSIRWIAQVHDAEP  434

Query  269  GANGREKILVATKKHWNLSSTS  204
             +   EKILVATK HW L  TS
Sbjct  435  ESGRMEKILVATKTHWKLPLTS  456



>ref|XP_010255504.1| PREDICTED: probable methyltransferase PMT13 [Nelumbo nucifera]
Length=593

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP H P T+ VIYDRGLIGVYHDWCEPFSTYPRTYD IHV +I+SL
Sbjct  456  AAALFSDPVWVMNVVPPHSP-TIGVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVNSIDSL  514

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K P SG++RCNLVDLMVEIDRMLRPEG+VV+RDSPEVID+  RIA A+R T +I++ E 
Sbjct  515  VKYPGSGRNRCNLVDLMVEIDRMLRPEGTVVVRDSPEVIDKVVRIARAIRLTATIHDPET  574

Query  269  GANGREKILVATKKHWNL  216
             + GREKILVATKK W L
Sbjct  575  ESTGREKILVATKKDWKL  592



>gb|AIU48595.1| quasimodo 3, partial [Citrus clementina]
 gb|AIU48599.1| quasimodo 3, partial [Citrus sinensis]
Length=505

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHV+ IES+
Sbjct  374  AAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S K+ C+LVDLMVE+DRMLRPEG+VV+RDSPEVID+  RIA+ VRWT ++++KEP
Sbjct  434  KN--GSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEP  491

Query  269  GANGREKILVATK  231
            G+NGREKILVATK
Sbjct  492  GSNGREKILVATK  504



>dbj|BAJ96685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL
Sbjct  438  AAAVASDPVWVMNVVPAKKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADGINSL  497

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              DP SGKSRC+L D+M+E+DR+LRPEG+ VIRDSP+VI++  ++A ++RWTT +++ EP
Sbjct  498  ISDPKSGKSRCDLFDVMLEMDRILRPEGTAVIRDSPDVINKAVQVAQSIRWTTQVHDSEP  557

Query  269  GANGREKILVATKKHWNLSSTS  204
             +   EKILVATK  W L  TS
Sbjct  558  ESGSAEKILVATKTFWKLPLTS  579



>gb|ABK25383.1| unknown [Picea sitchensis]
Length=601

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DPVW+MNVVPA+   TL VIYDRGLIGVYHDWCE FSTYPRTYD IH   IESL
Sbjct  459  AAAVIADPVWIMNVVPAYTSNTLGVIYDRGLIGVYHDWCEAFSTYPRTYDFIHAIGIESL  518

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D S G  RC+LVDLM+E+DR+LRPEG+VV+RD+P+VIDR  +IA A+ W+T +Y+ EP
Sbjct  519  IRDLSRGGDRCSLVDLMIEMDRILRPEGTVVVRDTPKVIDRVAKIASAIHWSTEVYDTEP  578

Query  269  GANGREKILVATKKHWNLSSTS  204
             +NG+EK+LVATK+ W LSSTS
Sbjct  579  ESNGKEKLLVATKQFWTLSSTS  600



>gb|AIU48609.1| quasimodo 3, partial [Aristolochia tagala]
Length=505

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDP+WVMNVVP+ KP TL VIYDRGLIGVYHDWCEPFSTYPRTYDLIHVA IES+
Sbjct  374  AAALLSDPIWVMNVVPSQKPSTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD SSGK RC+LVDLMVEIDRMLRPEG+V++RD PEV+D+  R+A AVRW   +++ EP
Sbjct  434  -KD-SSGKRRCHLVDLMVEIDRMLRPEGTVLVRDVPEVVDKVARVARAVRWKVVVHDPEP  491

Query  269  GANGREKILVATKK  228
             +NGREKILVATKK
Sbjct  492  ESNGREKILVATKK  505



>gb|AIU48584.1| quasimodo 3, partial [Aquilegia coerulea]
Length=505

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNV+PA KP TL V+YDRGLIGVYHDWCEPFSTYPRTYDLIHV++I+S+
Sbjct  374  AAALLSDPVWVMNVIPARKPSTLGVVYDRGLIGVYHDWCEPFSTYPRTYDLIHVSSIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S KSRCNLVDLMVE+DR+LRPEG+V+IRDSP+V+++   IAHA+RWTTS+  KEP
Sbjct  434  KH--GSSKSRCNLVDLMVEMDRILRPEGTVIIRDSPDVLEKVAHIAHAIRWTTSVPAKEP  491

Query  269  GANGREKILVATKK  228
             +NG+E++LVATKK
Sbjct  492  ESNGKERVLVATKK  505



>gb|KJB24669.1| hypothetical protein B456_004G156600 [Gossypium raimondii]
Length=586

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ +DPVWVMNVVPA KPLTLD+IYDRGLIGVYHDWCEPFSTYPRTYDLIHVA+I+SL
Sbjct  449  AAALETDPVWVMNVVPARKPLTLDIIYDRGLIGVYHDWCEPFSTYPRTYDLIHVASIDSL  508

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            TK P S    C+LVDLM EIDRMLRPEG+ VI+DSPEVI +  RIAH +RW T+I  KEP
Sbjct  509  TKLPGSRNRSCSLVDLMAEIDRMLRPEGTAVIQDSPEVIKKVARIAHVLRWVTTINNKEP  568

Query  269  GANGREKILVATKKHWNL  216
             ++GR KILVATK   +L
Sbjct  569  ESHGRGKILVATKTFRHL  586



>gb|AIU48616.1| quasimodo 3, partial [Populus trichocarpa]
Length=505

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++ DPVWVMNVVPA KP TL VIYDRGLIGVYHDWCEPFSTYPR+YDLIHVA IESL
Sbjct  374  AAALMPDPVWVMNVVPARKPSTLGVIYDRGLIGVYHDWCEPFSTYPRSYDLIHVAGIESL  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S K+RCNLVDLMVE+DR+LRPEG+V+IRDSPEVID+  R+A AVRW  +I+EKEP
Sbjct  434  KL--GSSKNRCNLVDLMVEMDRILRPEGTVIIRDSPEVIDKVARVALAVRWLVTIHEKEP  491

Query  269  GANGREKILVATK  231
             ++GREKILVATK
Sbjct  492  ESSGREKILVATK  504



>gb|AIU48610.1| quasimodo 3, partial [Medicago truncatula]
Length=505

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVVPA KP TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IES+
Sbjct  374  AAALKFDPVWVMNVVPAQKPPTLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHAVSIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD ++GK+RCN+VDLMVEIDR+LRPEG+VV+RD+P+VID+  RIAHAVRW  +IY+KEP
Sbjct  434  -KD-ATGKNRCNIVDLMVEIDRILRPEGTVVLRDAPKVIDKVARIAHAVRWKPTIYDKEP  491

Query  269  GANGREKILVATK  231
             ++GREKILV TK
Sbjct  492  DSHGREKILVLTK  504



>ref|XP_002448358.1| hypothetical protein SORBIDRAFT_06g025780 [Sorghum bicolor]
 gb|EES12686.1| hypothetical protein SORBIDRAFT_06g025780 [Sorghum bicolor]
Length=606

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI+SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+SL
Sbjct  464  AAAIVSDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSL  523

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              DP SG SRC+L D+M+E+DR+LRPEG+ VIR SP+V+D+  +IA ++RW   +++ EP
Sbjct  524  ISDPISGTSRCDLFDVMLEMDRILRPEGTAVIRASPDVVDKAAQIARSIRWKAQVHDSEP  583

Query  269  GANGREKILVATKKHWNLSSTSH  201
             +   EKILVATK  W L  TS 
Sbjct  584  ESGSTEKILVATKTFWKLPLTSQ  606



>gb|AIU48619.1| quasimodo 3, partial [Phaseolus vulgaris]
Length=504

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 117/128 (91%), Gaps = 2/128 (2%)
 Frame = -1

Query  614  SDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESLTKDPS  435
            SDPVWVMNVVPA KP TLDVI+DRGLIGVYHDWCEPFSTYPR+YDLIHVA+IES+ KD +
Sbjct  378  SDPVWVMNVVPAQKPPTLDVIFDRGLIGVYHDWCEPFSTYPRSYDLIHVASIESI-KD-A  435

Query  434  SGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEPGANGR  255
            SGK+RC LVDLMVEIDR+LRPEG+VV+RD+PEVID+  RIA AVRW  +IY+KEP ++GR
Sbjct  436  SGKNRCTLVDLMVEIDRILRPEGTVVVRDAPEVIDKVARIAGAVRWKPTIYDKEPESHGR  495

Query  254  EKILVATK  231
            EKILVATK
Sbjct  496  EKILVATK  503



>gb|AIU48588.1| quasimodo 3, partial [Magnolia denudata]
Length=505

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA++++DPVWVMNVVPA KPLTL VIYDRGL+GVYHDWCE FSTYPRTYDLIHV +I+S 
Sbjct  374  AASLVTDPVWVMNVVPARKPLTLGVIYDRGLVGVYHDWCEAFSTYPRTYDLIHVTSIQS-  432

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T+D SSGKSRC+L+D+MVE+DRMLRPEG+ VIRD PEVI++  RIAHA+RW  +++  EP
Sbjct  433  TRD-SSGKSRCHLIDVMVEMDRMLRPEGTAVIRDIPEVIEKVGRIAHAIRWAVTVHNTEP  491

Query  269  GANGREKILVATKK  228
             +NGREK+LVATKK
Sbjct  492  ESNGREKLLVATKK  505



>gb|EEE61526.1| hypothetical protein OsJ_15828 [Oryza sativa Japonica Group]
Length=463

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  617  ISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESLTKDP  438
            +SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL +DP
Sbjct  327  VSDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADRINSLIRDP  386

Query  437  SSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEPGANG  258
             SGKSRC+L D+M+E+DR+LRPEG  V+RDSP+VID+  ++A ++RWT  +++ EP + G
Sbjct  387  ISGKSRCDLFDVMLEMDRILRPEGIAVVRDSPDVIDKAAQVAQSIRWTVQVHDSEPESGG  446

Query  257  REKILVATKKHWNLSST  207
             EKILVATK  W L  T
Sbjct  447  TEKILVATKTFWKLPLT  463



>gb|AIU48621.1| quasimodo 3, partial [Ricinus communis]
Length=496

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 116/133 (87%), Gaps = 3/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            A+A+ SDP WVMNVVPA K  TLDVI+DRGLIGVYHDWCEPFSTYPRTYDLIHVA IES+
Sbjct  366  ASALSSDPAWVMNVVPAGKLSTLDVIFDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESI  425

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S K+RCNLVDLMVE+DR+LRPEG+V+IRD+PEVIDR   +AHAV+WT +I+EKEP
Sbjct  426  K---GSSKNRCNLVDLMVEMDRILRPEGTVLIRDTPEVIDRVAHVAHAVKWTATIHEKEP  482

Query  269  GANGREKILVATK  231
             ++GREKI+VATK
Sbjct  483  ESHGREKIMVATK  495



>emb|CAH67036.1| OSIGBa0139P06.9 [Oryza sativa Indica Group]
 gb|EEC77823.1| hypothetical protein OsI_17029 [Oryza sativa Indica Group]
Length=584

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  617  ISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESLTKDP  438
            +SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL +DP
Sbjct  448  VSDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADRINSLIRDP  507

Query  437  SSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEPGANG  258
             SGKSRC+L D+M+E+DR+LRPEG  VIRDSP+VID+  ++A ++RWT  +++ EP + G
Sbjct  508  ISGKSRCDLFDVMLEMDRILRPEGIAVIRDSPDVIDKAAQVAQSIRWTVQVHDSEPESGG  567

Query  257  REKILVATKKHWNLSST  207
             EKILVATK  W L  T
Sbjct  568  TEKILVATKTFWKLPLT  584



>gb|AIU48617.1| quasimodo 3, partial [Prunus persica]
Length=505

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SD VWVMNVVPA KP TL VI+DRGLIGVYHDWCEPFSTYPR+YD IHV  IES+
Sbjct  374  AAALKSDVVWVMNVVPARKPSTLSVIFDRGLIGVYHDWCEPFSTYPRSYDFIHVTGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S K+ CNLVDLMVE+DRMLRPEG+V++RDSPEVI++  RIAHAVRWT SI+EKEP
Sbjct  434  KH--GSTKNSCNLVDLMVEMDRMLRPEGTVLVRDSPEVIEKVARIAHAVRWTASIHEKEP  491

Query  269  GANGREKILVATK  231
             ++GREKILVATK
Sbjct  492  ESHGREKILVATK  504



>emb|CAE02253.2| OSJNBb0032E06.12 [Oryza sativa Japonica Group]
Length=586

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  617  ISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESLTKDP  438
            +SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL +DP
Sbjct  450  VSDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADRINSLIRDP  509

Query  437  SSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEPGANG  258
             SGKSRC+L D+M+E+DR+LRPEG  V+RDSP+VID+  ++A ++RWT  +++ EP + G
Sbjct  510  ISGKSRCDLFDVMLEMDRILRPEGIAVVRDSPDVIDKAAQVAQSIRWTVQVHDSEPESGG  569

Query  257  REKILVATKKHWNLSST  207
             EKILVATK  W L  T
Sbjct  570  TEKILVATKTFWKLPLT  586



>gb|AIU48637.1| quasimodo 3, partial [Trachycarpus fortunei]
Length=505

 Score =   206 bits (525),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTL +IYDRGLIGVYHDWCE FSTYPRTYDLIHV+ I S+
Sbjct  374  AAALNSDPVWVMNVIPARKPLTLGIIYDRGLIGVYHDWCEAFSTYPRTYDLIHVSGINSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                +SGKSRC+L+DLM E+DRMLRPEG+ VIRDSPEVID+  RIAHA+RWT  ++E EP
Sbjct  434  RD--TSGKSRCHLLDLMTEMDRMLRPEGTAVIRDSPEVIDKVARIAHAIRWTAQVHESEP  491

Query  269  GANGREKILVATK  231
               G EKILVATK
Sbjct  492  ETRGGEKILVATK  504



>ref|XP_009401770.1| PREDICTED: probable methyltransferase PMT13 [Musa acuminata subsp. 
malaccensis]
Length=603

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA++ S+ VWVMNVVPA KPLTL +IYDRGL+GVYHDWCE FSTYPRTYDLIHVA I SL
Sbjct  462  AASLSSELVWVMNVVPARKPLTLGIIYDRGLVGVYHDWCEAFSTYPRTYDLIHVAGINSL  521

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D +SGK+RC+LVDLMVE+DRMLRPEG+ V+RDSPEVID+   IA A+RWT  ++E EP
Sbjct  522  IRD-TSGKNRCSLVDLMVEMDRMLRPEGTAVVRDSPEVIDKAAHIARAIRWTVHVHESEP  580

Query  269  GANGREKILVATKKHWNLSSTS  204
             +   EKILVATK  W L +TS
Sbjct  581  ESRAGEKILVATKTFWTLPATS  602



>gb|AIU48601.1| quasimodo 3, partial [Illicium henryi]
Length=505

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 117/134 (87%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVPA KP TL +IYDRGLIGVYHDWCE FSTYPRTYDLIHV  I+S+
Sbjct  374  AAAIISDPVWVMNVVPALKPSTLGIIYDRGLIGVYHDWCEAFSTYPRTYDLIHVTGIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD SSGKSRCNLVDLMVE+DR+LRP G VVIRDSPE+I+R  RIA+ +RW  S++E EP
Sbjct  434  -KD-SSGKSRCNLVDLMVEMDRILRPLGKVVIRDSPEIIERVARIANGIRWKASVHETEP  491

Query  269  GANGREKILVATKK  228
             ++G+EK+LVATK+
Sbjct  492  ESSGKEKLLVATKE  505



>ref|XP_007134962.1| hypothetical protein PHAVU_010G090400g [Phaseolus vulgaris]
 gb|ESW06956.1| hypothetical protein PHAVU_010G090400g [Phaseolus vulgaris]
Length=596

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP+HKP TLD I+DRGLIGVYHDWCEPFSTYPRTYDLIH  +IESL
Sbjct  459  AAALNSDPVWVMNVVPSHKPPTLDAIFDRGLIGVYHDWCEPFSTYPRTYDLIHATSIESL  518

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KDP+S K+RCNL+DLMVE+DR+LRPEG+VV+RD+PEVI+R  R+A AVRW  +IY KEP
Sbjct  519  IKDPASAKNRCNLIDLMVELDRILRPEGTVVVRDTPEVIERVARVARAVRWKPTIYNKEP  578

Query  269  GANGREKILVATKKHWNL  216
             ++GR+ ILVATK  W +
Sbjct  579  ESHGRQNILVATKTLWTV  596



>dbj|BAJ98075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL
Sbjct  438  AAAVASDPVWVMNVVPAKKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADGINSL  497

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              DP SGKSRC+L D+M+E+DR+LRPEG+ VIRDSP+VI++  ++A ++RWTT +++ EP
Sbjct  498  ISDPKSGKSRCDLFDVMLEMDRILRPEGTAVIRDSPDVINKAVQVAQSIRWTTQVHDSEP  557

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  558  ESGSAEKILVATK  570



>gb|AIU48602.1| quasimodo 3, partial [Buxus sinica]
Length=505

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVV A KP TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHV+ I+S 
Sbjct  374  AAALSHDPVWVMNVVSARKPSTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSNIDST  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S KSRCNLVDLMVEIDRMLRP+G+VV+RDSPEV+D+  RIA A+RWT  I+EKEP
Sbjct  434  RY--GSSKSRCNLVDLMVEIDRMLRPDGTVVVRDSPEVVDKVARIARAIRWTARIHEKEP  491

Query  269  GANGREKILVATKK  228
             +  R+KILVATKK
Sbjct  492  ESTSRDKILVATKK  505



>ref|XP_003580350.1| PREDICTED: probable methyltransferase PMT13 [Brachypodium distachyon]
Length=583

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            A A+ SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL
Sbjct  441  ATAVASDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADGINSL  500

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              DP SGKSRC+L D+M+E+DR+LRPEG+ VIRDSP+VI++   +A ++RW   +++ EP
Sbjct  501  ITDPKSGKSRCDLFDVMLEMDRILRPEGTTVIRDSPDVIEKAVHVAQSIRWIAQVHDSEP  560

Query  269  GANGREKILVATKKHWNLSSTS  204
             +   EKILVATK  W +  TS
Sbjct  561  ESGSTEKILVATKTFWKVPLTS  582



>gb|AIU48622.1| quasimodo 3, partial [Dioscorea oppositifolia]
Length=505

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 117/134 (87%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNVVPA KPLTLD+IYDRGLIGVYHDWCE FSTYPRTYDLIHVA I+S+
Sbjct  374  AAALVSDPVWVMNVVPAQKPLTLDIIYDRGLIGVYHDWCEAFSTYPRTYDLIHVAEIKSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 SGK+RC+++DLMVE+DR+LRPEG++VI+DSPEVI+R  R++H +RWT  +++ EP
Sbjct  434  RD--ISGKNRCHIIDLMVEMDRILRPEGTIVIQDSPEVIERMARLSHTIRWTPKVHDAEP  491

Query  269  GANGREKILVATKK  228
              +G EKILVATKK
Sbjct  492  ELHGAEKILVATKK  505



>gb|AIU48612.1| quasimodo 3, partial [Manihot esculenta]
Length=505

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA K  TL VI+DRGLIGVYHDWCEPFSTYPRTYDLIHVA IES+
Sbjct  374  AAALASDPVWVMNVVPADKLSTLGVIFDRGLIGVYHDWCEPFSTYPRTYDLIHVAGIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              D  S K+RCNLVDL+VE+DR+LRPEG+ +IRD+PEVID+   IAHAVRWT  I+EKEP
Sbjct  434  KND--SSKNRCNLVDLIVEMDRILRPEGTAIIRDTPEVIDKVVHIAHAVRWTAIIHEKEP  491

Query  269  GANGREKILVATK  231
             ++GRE ILVATK
Sbjct  492  ESHGREIILVATK  504



>ref|XP_010053663.1| PREDICTED: probable methyltransferase PMT13 [Eucalyptus grandis]
 gb|KCW78015.1| hypothetical protein EUGRSUZ_D02247 [Eucalyptus grandis]
Length=579

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KP TL  IYDRGLIGVYHDWCEPFSTYPRTYD +HV  I  L
Sbjct  437  AAALSSDPVWVMNVLPADKPSTLSAIYDRGLIGVYHDWCEPFSTYPRTYDFLHVDGIAML  496

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +   S + RC+LVDLMVE+DR+LRPEG+V+IRDSPEVID+   IAHAVRWTT+I+E + 
Sbjct  497  IEHQGSKRRRCSLVDLMVEMDRILRPEGTVLIRDSPEVIDKVNHIAHAVRWTTAIHEGDS  556

Query  269  GANGREKILVATKKHWNLSSTS  204
            G+   EKILVATK  W LSS S
Sbjct  557  GSPETEKILVATKTMWKLSSES  578



>gb|AIU48606.1| quasimodo 3, partial [Chimonanthus praecox]
Length=505

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTL  IYDRGLIGVYHDWCE FSTYPRTYDLIHV +IES+
Sbjct  374  AAALSSDPVWVMNVVPARKPLTLSAIYDRGLIGVYHDWCEAFSTYPRTYDLIHVTSIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                SS KSRC+L+D+MVE+DR+LRPEG+V++RDS EVI++  RIA ++RW   +YE EP
Sbjct  434  RD--SSEKSRCHLIDVMVEMDRILRPEGTVLVRDSSEVIEKVSRIARSIRWKVRVYEAEP  491

Query  269  GANGREKILVATKK  228
            G+NGREK+LVATK+
Sbjct  492  GSNGREKVLVATKE  505



>ref|XP_004976531.1| PREDICTED: probable methyltransferase PMT13-like [Setaria italica]
Length=577

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI+SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+SL
Sbjct  435  AAAIVSDPVWVMNVVPARKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSL  494

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              DP SG SRC+L D+M+E+DR+LRPEG  VIR SP++I +  ++A ++RW   + + EP
Sbjct  495  ISDPISGTSRCDLFDVMLEMDRILRPEGIAVIRGSPDLIAKAAQVAQSIRWNAQVRDSEP  554

Query  269  GANGREKILVATKKHWNLSSTSH  201
             +   EKILVATK  W L  TS 
Sbjct  555  ESGNTEKILVATKTFWKLPLTSQ  577



>ref|XP_008669009.1| PREDICTED: probable methyltransferase PMT13 [Zea mays]
 gb|AFW59274.1| hypothetical protein ZEAMMB73_145295 [Zea mays]
Length=583

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVP  KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+SL
Sbjct  441  AAAIISDPVWVMNVVPGQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSL  500

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
               P SG SRC+L D+M+E+DR+LRPEG+ VIR SP+V+ +  +IA ++RW   +++ EP
Sbjct  501  ISGPISGTSRCDLFDVMLEMDRILRPEGTAVIRASPDVVAKAAQIAQSIRWKAQVHDSEP  560

Query  269  GANGREKILVATKKHWNLSSTSH  201
             +   EKILVATK  W L  T  
Sbjct  561  ESGSTEKILVATKTFWKLPLTKQ  583



>gb|AIU48589.1| quasimodo 3, partial [Musa acuminata]
Length=505

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA  PLTLD+IYDRGLIG+YHDWCE FSTYPRTYDLIHVA I S+
Sbjct  374  AAALSSDPVWVMNVVPAQNPLTLDIIYDRGLIGLYHDWCEAFSTYPRTYDLIHVAGINSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                +S   RC+LVDLMVE+DRMLRP+G+ V+RD+PEVIDR  RIAHA+RWT  +++ EP
Sbjct  434  RD--TSDNDRCSLVDLMVEMDRMLRPQGTAVVRDTPEVIDRVARIAHAIRWTIQVHKSEP  491

Query  269  GANGREKILVATK  231
             +  REKILVATK
Sbjct  492  ESGDREKILVATK  504



>gb|AIU48590.1| quasimodo 3, partial [Pinellia ternata]
Length=504

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 116/134 (87%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTL VIYDRGLIG+YHDWCEPFSTYPRTYDLIHVA I S+
Sbjct  373  AAALSSDPVWVMNVVPARKPLTLGVIYDRGLIGIYHDWCEPFSTYPRTYDLIHVAGIMSI  432

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
              D  +G+SRC++VDLMVE+DR+LRPEG+VVIRD P+ I++  R+A AVRWT +++E EP
Sbjct  433  KDD--TGRSRCSIVDLMVEMDRILRPEGTVVIRDMPKAIEKVARVARAVRWTVTVHEAEP  490

Query  269  GANGREKILVATKK  228
             ++G E++LVATK+
Sbjct  491  ESSGGERVLVATKQ  504



>gb|AIU48604.1| quasimodo 3, partial [Chloranthus japonicus]
Length=495

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++S+P+WVMNVVP+ KPLTLDV+YDRGLIGVYHDWCE F TYPRTYDLIHV  IES+
Sbjct  364  AAALMSEPIWVMNVVPSRKPLTLDVVYDRGLIGVYHDWCEAFPTYPRTYDLIHVTNIESI  423

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 +GKSRCNLVDLMVE+DRMLRPEG+VVIRDSPE ID+   IA A+RW  + ++ EP
Sbjct  424  RD--WTGKSRCNLVDLMVEVDRMLRPEGTVVIRDSPEAIDKVSCIARAIRWKVTFHDTEP  481

Query  269  GANGREKILVATKK  228
             A  REKILVATKK
Sbjct  482  DAFRREKILVATKK  495



>gb|AIU48596.1| quasimodo 3, partial [Gossypium raimondii]
Length=503

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ +DPVWVMNVVPA KPLTLD+IYDRGLIGVYHDWCEPFSTYPRTYDLIHVA+I+S 
Sbjct  372  AAALETDPVWVMNVVPARKPLTLDIIYDRGLIGVYHDWCEPFSTYPRTYDLIHVASIDS-  430

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            TK  S  +S C+LVDLM EIDRMLRPEG+ VI+DSPEVI +  RIAH +RW T+I  KEP
Sbjct  431  TKLGSRNRS-CSLVDLMAEIDRMLRPEGTAVIQDSPEVIKKVARIAHVLRWVTTINNKEP  489

Query  269  GANGREKILVATK  231
             ++GR KILVATK
Sbjct  490  ESHGRGKILVATK  502



>ref|XP_006857872.1| hypothetical protein AMTR_s00069p00098800 [Amborella trichopoda]
 gb|ERN19339.1| hypothetical protein AMTR_s00069p00098800 [Amborella trichopoda]
Length=599

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            A AI+SDPVWVMNVVPA  P TL VIYDRGLIG+YHDWCEPFSTYPRTYDL+HV AI+SL
Sbjct  457  AGAIVSDPVWVMNVVPARMPSTLGVIYDRGLIGLYHDWCEPFSTYPRTYDLLHVVAIDSL  516

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D +SG SRCNLVDLMVE+DR+LRPEG+V++RDSPEVI+R  R+A AVRW+ +I++ E 
Sbjct  517  IRDQNSGNSRCNLVDLMVEMDRILRPEGTVIVRDSPEVIERVARVARAVRWSATIHKTEQ  576

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++G+EK+LVATKK   L   SH
Sbjct  577  ESSGKEKLLVATKKLLKLPLASH  599



>gb|AIU48608.1| quasimodo 3, partial [Asparagus officinalis]
Length=505

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ +DPVWVMNVVPA KPLTLDVIYDRGLIG YHDWCE FSTYPRTYDLIHVA I S+
Sbjct  374  AAALSADPVWVMNVVPARKPLTLDVIYDRGLIGAYHDWCEAFSTYPRTYDLIHVARISSM  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 SG++RCNLVDLMVE+DR+LRPEG+ VIRD+P++I++  R+A A+RWT  ++E EP
Sbjct  434  RD--VSGRARCNLVDLMVEMDRILRPEGTAVIRDAPDIIEKVVRVARAIRWTVKVHESEP  491

Query  269  GANGREKILVATKK  228
             + G EKI++ATKK
Sbjct  492  ESRGGEKIVIATKK  505



>gb|AIU48630.1| quasimodo 3, partial [Ceratophyllum platyacanthum subsp. oryzetorum]
Length=505

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI SDPVWVMNV+P++KPLTLD+IYDRGL+GVYHDWCEPFSTYPRTYDLIHVA I+++
Sbjct  374  AAAIFSDPVWVMNVIPSNKPLTLDIIYDRGLVGVYHDWCEPFSTYPRTYDLIHVADIDTI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +  SSG+ RCNLVD+MVE+DR+LRP+G V++ DSPEVI++  RI  A+RWT ++++ EP
Sbjct  434  RR--SSGEPRCNLVDIMVEMDRILRPKGMVLVYDSPEVIEKVNRIVPALRWTATLHDIEP  491

Query  269  GANGREKILVATK  231
            G+   +KILVATK
Sbjct  492  GSENNKKILVATK  504



>gb|AIU48636.1| quasimodo 3, partial [Alisma plantago-aquatica]
Length=505

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH A I S+
Sbjct  374  AAAMHSDPVWVMNVVPARKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHAAGINSV  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD +SG++RCNLVDLMVE+DR+LRP G+ VIRDS EVID+  RI  A+RWT +I+E EP
Sbjct  434  -KD-ASGRNRCNLVDLMVEMDRILRPGGTAVIRDSAEVIDKMSRIVRAIRWTATIHETEP  491

Query  269  GANGREKILVATKK  228
             ++  EKILVA K+
Sbjct  492  ESSSGEKILVAAKQ  505



>gb|AIU48631.1| quasimodo 3, partial [Cinnamomum camphora]
Length=505

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA+++SDPVWVMNVVP HKP TLDVIYDRGLIGVYHDWCE FSTYPRTYDLIHV +IESL
Sbjct  374  AASLLSDPVWVMNVVPTHKPSTLDVIYDRGLIGVYHDWCEAFSTYPRTYDLIHVTSIESL  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                SSG SRC+L+DLM+E+DR+LRP+G+V++RDS EVID+   IA A++W  ++++ EP
Sbjct  434  RD--SSGASRCHLLDLMIEMDRILRPDGTVLVRDSSEVIDKVAGIARAIKWKVTLHDPEP  491

Query  269  GANGREKILVATKK  228
             + GREKILVA+K+
Sbjct  492  QSTGREKILVASKQ  505



>gb|AIU48605.1| quasimodo 3, partial [Ceratophyllum demersum]
Length=505

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI SDPVWVMNV+P++KPLTLD+IYDRGL+GVYHDWCEPFSTYPRTYDLIHVA I+++
Sbjct  374  AAAIFSDPVWVMNVIPSNKPLTLDIIYDRGLVGVYHDWCEPFSTYPRTYDLIHVADIDTI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +  SSG+ RCNLVD+MVE+DR+LRP+G V++ DSPEVI++  RIA A+RWT ++++ E 
Sbjct  434  RR--SSGEPRCNLVDIMVEMDRILRPKGMVLVYDSPEVIEKVNRIAPALRWTATLHDIES  491

Query  269  GANGREKILVATK  231
            G    +KILVATK
Sbjct  492  GTENNKKILVATK  504



>gb|AIU48593.1| quasimodo 3, partial [Acorus calamus]
Length=505

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA KPLTL VI+DRGLIG+YHDWCEPFSTYPRTYD +HV +I S+
Sbjct  374  AAALSSDPVWVMNVVPARKPLTLSVIFDRGLIGLYHDWCEPFSTYPRTYDFLHVTSISSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD  SG +RCNLVDLMVE+DR+LRPEG+ VIRDSPE I + ER+A A+RW+  +++ E 
Sbjct  434  -KD-KSGMNRCNLVDLMVEMDRILRPEGTAVIRDSPEAIKKLERVARAIRWSVKVHDPER  491

Query  269  GANGREKILVATK  231
             +NG EKILVATK
Sbjct  492  ESNGGEKILVATK  504



>gb|AIU48607.1| quasimodo 3, partial [Pandanus utilis]
Length=505

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDP+WVMNVVPA KPLTL VIYDRGLIGVYHDWCE FSTYPRTYDLIH A I S+
Sbjct  374  AAALVSDPLWVMNVVPARKPLTLGVIYDRGLIGVYHDWCEAFSTYPRTYDLIHAAGINSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD ++GKSRC+LVDL+VE+DRMLRPEG+VVIRD PEVI++  RI  A++WT  ++  EP
Sbjct  434  -KD-TTGKSRCHLVDLLVEMDRMLRPEGTVVIRDIPEVIEKLRRIGTAIQWTVKVHGSEP  491

Query  269  GANGREKILVATKK  228
             +   +KILVATKK
Sbjct  492  ESQTGDKILVATKK  505



>gb|AIU48611.1| quasimodo 3, partial [Canna indica]
Length=505

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KPLTL +IYDRGLIGVYHDWCE FSTYPRTYDLIHVA I S+
Sbjct  374  AAALNSDPVWVMNVIPARKPLTLGIIYDRGLIGVYHDWCEAFSTYPRTYDLIHVAGINSV  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                +SGK RC+LVDLMVE+DR+LRP G  V+RDSPEVI++  +IAHA+RW   ++E EP
Sbjct  434  RD--TSGKKRCSLVDLMVEMDRILRPGGIAVVRDSPEVIEKVAQIAHAIRWKAQVHESEP  491

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  492  ESRNGEKILVATK  504



>gb|AIU48603.1| quasimodo 3, partial [Iris japonica]
Length=505

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMNVVPA KPLTL +IYDRGLIGVYHDWCE FSTYPRTYDLIHV    S+
Sbjct  374  AAALLSDPVWVMNVVPARKPLTLGIIYDRGLIGVYHDWCEAFSTYPRTYDLIHVMGFTSV  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                +SGKSRC+LVDLMVE+DR+LRPEG  V+RDS E I++  RIA A+RWT  +++ EP
Sbjct  434  RD--TSGKSRCHLVDLMVEMDRILRPEGKAVMRDSSEAIEKAARIALAIRWTVRVHDSEP  491

Query  269  GANGREKILVATK  231
             +N  EKILVATK
Sbjct  492  ESNAGEKILVATK  504



>gb|AIU48629.1| quasimodo 3, partial [Lactuca sativa]
Length=505

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA + SDP+WVMNVV   KP TL VIYDRGLIGVYHDWCEPFS+YPRTYD IHV +IES+
Sbjct  374  AAGLTSDPLWVMNVVADKKPSTLGVIYDRGLIGVYHDWCEPFSSYPRTYDFIHVVSIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             KD  +GK+RCNLVD+MVE+DR+LRP+GSVVIRDSPE++ +  RIA +VRW ++I+ KEP
Sbjct  434  -KD-VTGKNRCNLVDVMVEMDRLLRPQGSVVIRDSPELLTKINRIADSVRWKSTIHNKEP  491

Query  269  GANGREKILVATK  231
             + GR++ILVATK
Sbjct  492  ESQGRDRILVATK  504



>gb|AIU48626.1| quasimodo 3, partial [Sorghum bicolor]
Length=505

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI+SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+S+
Sbjct  374  AAAIVSDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            +    SG SRC+L D+M+E+DR+LRPEG+ VIR SP+V+D+  +IA ++RW   +++ EP
Sbjct  434  SD--ISGTSRCDLFDVMLEMDRILRPEGTAVIRASPDVVDKAAQIARSIRWKAQVHDSEP  491

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  492  ESGSTEKILVATK  504



>gb|AIU48591.1| quasimodo 3, partial [Brachypodium distachyon]
Length=505

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            A A+ SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I S+
Sbjct  374  ATAVASDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADGINSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T    SGKSRC+L D+M+E+DR+LRPEG+ VIRDSP+VI++   +A ++RW   +++ EP
Sbjct  434  TD--KSGKSRCDLFDVMLEMDRILRPEGTTVIRDSPDVIEKAVHVAQSIRWIAQVHDSEP  491

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  492  ESGSTEKILVATK  504



>gb|AIU48618.1| quasimodo 3, partial [Panicum virgatum]
Length=505

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI+SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+S+
Sbjct  374  AAAIVSDPVWVMNVVPARKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 SG SRC+L D+M+E+DR+LRPEG+ VIR SP+VI++  ++A +VRW   +++ EP
Sbjct  434  ND--ISGTSRCDLFDVMLEMDRILRPEGTAVIRGSPDVINKAAQVAQSVRWNAQVHDSEP  491

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  492  ESGSTEKILVATK  504



>gb|AIU48600.1| quasimodo 3, partial [Eucalyptus grandis]
Length=505

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNV+PA KP TL  IYDRGLIGVYHDWCEPFSTYPRTYD +HV  I  +
Sbjct  374  AAALSSDPVWVMNVLPADKPSTLSAIYDRGLIGVYHDWCEPFSTYPRTYDFLHVDGIAMI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                 S + RC+LVDLMVE+DR+LRPEG+V+IRDSPEVID+   IAHAVRWTT+I+E + 
Sbjct  434  EH--GSKRRRCSLVDLMVEMDRILRPEGTVLIRDSPEVIDKVNHIAHAVRWTTAIHEGDS  491

Query  269  GANGREKILVATK  231
            G+   EKILVATK
Sbjct  492  GSPETEKILVATK  504



>gb|AIU48635.1| quasimodo 3, partial [Zea mays]
Length=505

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVP  KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+S+
Sbjct  374  AAAIISDPVWVMNVVPGQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            +    SG SRC+L D+M+E+DR+LRPEG+ VIR SP+V+ +  +IA ++RW   +++ EP
Sbjct  434  SG--ISGTSRCDLFDVMLEMDRILRPEGTAVIRASPDVVAKAAQIAQSIRWKAQVHDSEP  491

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  492  ESGSTEKILVATK  504



>gb|AIU48633.1| quasimodo 3, partial [Ginkgo biloba]
Length=505

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAIISDPVWVMNVVPA++  TL  IYDRGLIGVYHDWCE FSTYPRTYDLIHV  I S+
Sbjct  374  AAAIISDPVWVMNVVPAYRSKTLGAIYDRGLIGVYHDWCEAFSTYPRTYDLIHVVGIASI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S G +RC+LVDLM+E+DR+LRPEG+VV+RD+P+VI+    IA+A+ W T IY+ EP
Sbjct  434  RD--SRGGNRCSLVDLMIEMDRILRPEGTVVVRDTPKVIEMVVNIANAIHWNTEIYKTEP  491

Query  269  GANGREKILVATKK  228
             +NG+E++LVATK+
Sbjct  492  ESNGKEQVLVATKQ  505



>gb|AIU48634.1| quasimodo 3, partial [Houttuynia cordata]
Length=504

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVP HK  TL VIYDRGLIGVYHDWCEPFSTYPRTYD IHVAAIES+
Sbjct  374  AAALSSDPVWVMNVVPPHKSSTLGVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVAAIESI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                   K RC+LVDLMVE+DR+LRPEG +++RD+PEVID+  RIA AV W  ++++ E 
Sbjct  434  RG--GLRKRRCHLVDLMVEMDRILRPEGILLVRDAPEVIDKVSRIARAVHWEVTVHDPER  491

Query  269  GANGREKILVATK  231
             + GREKILVATK
Sbjct  492  ESVGREKILVATK  504



>gb|AIU48623.1| quasimodo 3, partial [Yucca filamentosa]
Length=505

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA++SDPVWVMN VPAHKP TLDVIYDRGLIGVYHDWCE FSTYPRTYD IHV  I+S+
Sbjct  374  AAALLSDPVWVMNAVPAHKPRTLDVIYDRGLIGVYHDWCEAFSTYPRTYDFIHVEGIKSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D S+ +SRC+LVD+MVE+DR+LRPEG+ VIRDS ++ID+ E IA+A+RW   +++ EP
Sbjct  434  -RDVST-ESRCHLVDVMVEMDRILRPEGTAVIRDSSKIIDKVELIANAIRWKVEVHDGEP  491

Query  269  GANGREKILVATKK  228
             +N   K LVATK+
Sbjct  492  ESNKEVKTLVATKE  505



>gb|AIU48624.1| quasimodo 3, partial [Setaria italica]
Length=505

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAAI+SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH  AI+S+
Sbjct  374  AAAIVSDPVWVMNVVPARKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADAIDSI  433

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            +    SG SRC+L D+M+E+DR+LRPEG  VIR SP++I +  ++A ++RW   + + EP
Sbjct  434  SD--ISGTSRCDLFDVMLEMDRILRPEGIAVIRGSPDLIAKAAQVAQSIRWNAQVRDSEP  491

Query  269  GANGREKILVATK  231
             +   EKILVATK
Sbjct  492  ESGNTEKILVATK  504



>gb|AIU48614.1| quasimodo 3, partial [Persea americana]
Length=215

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA+++SDPVWVMNVVPA K  TL VIYDRGLIGVYHDWCE FSTYPR+YDLIHV +IES+
Sbjct  92   AASLLSDPVWVMNVVPARKASTLGVIYDRGLIGVYHDWCEAFSTYPRSYDLIHVTSIESI  151

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEK-E  273
                SS KSRC+L+DLMVE+DR+LRPEG+VV+RD P+VID+  RIA A+RWT +++E+ E
Sbjct  152  RD--SSSKSRCHLMDLMVEMDRILRPEGTVVVRDLPQVIDKVGRIARAIRWTVTVHEEPE  209

Query  272  PGA  264
             GA
Sbjct  210  SGA  212



>gb|AIU48638.1| quasimodo 3, partial [Cabomba caroliniana]
Length=503

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA+IISDPVWVMNVVP  K  TL VIYDRGLIGVYHDWCE FSTYPRTYDLIH  +I+S+
Sbjct  372  AASIISDPVWVMNVVPFQKASTLGVIYDRGLIGVYHDWCEAFSTYPRTYDLIHADSIDSI  431

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                ++G  RCNLVD+M+EIDR+LRPEG+V++RDS +VI R  +I+ ++RW++++Y  EP
Sbjct  432  RD--ATGNYRCNLVDVMLEIDRILRPEGTVIVRDSSDVIKRIAQISKSIRWSSTVYNAEP  489

Query  269  GANGREKILVATK  231
             + G+E++L+ATK
Sbjct  490  ESTGKERLLIATK  502



>ref|NP_001053597.1| Os04g0569400 [Oryza sativa Japonica Group]
 dbj|BAF15511.1| Os04g0569400 [Oryza sativa Japonica Group]
Length=477

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  617  ISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESLTKDP  438
            +SDPVWVMNVVPA KPLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL +DP
Sbjct  319  VSDPVWVMNVVPAQKPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADRINSLIRDP  378

Query  437  SSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTS  288
             SGKSRC+L D+M+E+DR+LRPEG  V+RDSP+VID+  ++A ++RWT  
Sbjct  379  ISGKSRCDLFDVMLEMDRILRPEGIAVVRDSPDVIDKAAQVAQSIRWTVQ  428



>gb|EMT18939.1| hypothetical protein F775_17795 [Aegilops tauschii]
Length=431

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ SDPVWVMNVVPA  PLTL VIYDRGLIGVYHDWCEPFSTYPRTYDLIH   I SL
Sbjct  314  AAAVASDPVWVMNVVPAKNPLTLGVIYDRGLIGVYHDWCEPFSTYPRTYDLIHADGINSL  373

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERI  315
              DP SGK RC+L D+M+E+DR+LRPEG+ VIRDSP+VI++  +I
Sbjct  374  ISDPKSGKIRCDLFDVMLEMDRILRPEGTAVIRDSPDVINKAVQI  418



>gb|AAD17338.1| F15P23.2 gene product [Arabidopsis thaliana]
 emb|CAB80883.1| predicted protein of unknown function [Arabidopsis thaliana]
Length=590

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 99/143 (69%), Gaps = 32/143 (22%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA + SDPVWVMNV+PA KPLTLDVIYDRGLIGVYHDWC                     
Sbjct  480  AATLASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWC---------------------  518

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                       +LVDLMVE+DR+LRPEG VVIRDSPEV+D+  R+AHAVRW++SI+EKEP
Sbjct  519  -----------SLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEP  567

Query  269  GANGREKILVATKKHWNLSSTSH  201
             ++GREKIL+ATK  W L S SH
Sbjct  568  ESHGREKILIATKSLWKLPSNSH  590



>ref|XP_002961169.1| hypothetical protein SELMODRAFT_74065 [Selaginella moellendorffii]
 gb|EFJ38708.1| hypothetical protein SELMODRAFT_74065 [Selaginella moellendorffii]
Length=591

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVVP   P TL VI+DRGLIGV HDWCE FSTYPRTYD IHV+ ++S 
Sbjct  458  AAALYHDPVWVMNVVPVTAPNTLPVIFDRGLIGVLHDWCEAFSTYPRTYDFIHVSNMQSF  517

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T   S+    C+LVD+M+E+DR+LRP+G++++RD+ +++++  +IA+A++WTT +   E 
Sbjct  518  TTQASTS---CSLVDVMLEMDRILRPQGTILVRDTTKMVEKISKIAYALQWTTEVLTTEG  574

Query  269  GANGREKILVATK  231
            G  G+E++ VATK
Sbjct  575  GVLGKERLFVATK  587



>ref|XP_002966837.1| hypothetical protein SELMODRAFT_168608 [Selaginella moellendorffii]
 gb|EFJ31436.1| hypothetical protein SELMODRAFT_168608 [Selaginella moellendorffii]
Length=591

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+  DPVWVMNVVP   P TL VI+DRGLIGV HDWCE FSTYPRTYD IHV+ ++S 
Sbjct  458  AAALYHDPVWVMNVVPVTAPNTLPVIFDRGLIGVLHDWCEAFSTYPRTYDFIHVSNMQSF  517

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
            T   S+    C+LVD+M+E+DR+LRP+G++++RD+ +++++  +IA+A++WTT +   E 
Sbjct  518  TTQASTS---CSLVDVMLEMDRILRPQGTILVRDTTKMVEKISKIAYALQWTTEVLTTEG  574

Query  269  GANGREKILVATK  231
            G  G+E++ VATK
Sbjct  575  GVLGKERLFVATK  587



>ref|XP_001769468.1| predicted protein [Physcomitrella patens]
 gb|EDQ65837.1| predicted protein [Physcomitrella patens]
Length=598

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 102/141 (72%), Gaps = 9/141 (6%)
 Frame = -1

Query  629  AAAIIS--DPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDW---CEPFSTYPRTYDLIHVA  465
            AA ++S  DPVWVMNV+P   P TL  IYDRGL+GV HDW   CE FSTYPRTYDL+HVA
Sbjct  454  AANLMSRNDPVWVMNVIPTTGPNTLSTIYDRGLLGVVHDWQVRCEAFSTYPRTYDLLHVA  513

Query  464  AIESLTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSI  285
             ++  T    +   RC+L ++MVE+DR+LRPEG+++IRD+P ++ R  +IA A++W   I
Sbjct  514  PLQPFT----TLDKRCSLAEVMVEMDRILRPEGTIIIRDTPTMLSRVSKIAKAIQWKFEI  569

Query  284  YEKEPGANGREKILVATKKHW  222
            ++ EPG +G+E+I V TK  W
Sbjct  570  FDPEPGTSGKERIFVGTKVFW  590



>emb|CDY70936.1| BnaAnng35600D [Brassica napus]
Length=183

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA+++  P WVMNVVP H +  TL VIY+RGLIG Y DWCE FSTYPRTYD+IH   + +
Sbjct  42   AASMLKYPSWVMNVVPVHAEKQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFT  101

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L  +      RC+L  +++E+DR+LRPEG+VV+RD+ E++ + E+IA  ++W T I + E
Sbjct  102  LYDN------RCDLTLILLEMDRILRPEGTVVLRDNVEMLTKVEKIAKRMKWNTQIVDHE  155

Query  272  PGANGREKILVATKKHW  222
             G    EKILVA K +W
Sbjct  156  KGPYNPEKILVAVKTYW  172



>ref|XP_002982140.1| hypothetical protein SELMODRAFT_115825 [Selaginella moellendorffii]
 gb|EFJ16808.1| hypothetical protein SELMODRAFT_115825 [Selaginella moellendorffii]
Length=612

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA  ++  +WVMNVVP H +  TL V+Y+RGLIGVYHDWCE FSTYPRTYDLIH   + S
Sbjct  474  AALSMNSKMWVMNVVPHHHQHKTLGVVYERGLIGVYHDWCEAFSTYPRTYDLIHADNVFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V++RD  + ++R +RI  ++RW + +Y+ E
Sbjct  534  LYKD------RCEMKDILIEMDRILRPEGAVIVRDQVDTLNRVKRIMTSIRWQSKMYDHE  587

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+LVA K +W  SS S
Sbjct  588  SGPFNTEKVLVAVKTYWVGSSNS  610



>ref|XP_002966153.1| hypothetical protein SELMODRAFT_143797 [Selaginella moellendorffii]
 gb|EFJ32180.1| hypothetical protein SELMODRAFT_143797 [Selaginella moellendorffii]
Length=613

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA  ++  +WVMNVVP H +  TL V+Y+RGLIGVYHDWCE FSTYPRTYDLIH   + S
Sbjct  475  AALSMNSKMWVMNVVPHHHQHKTLGVVYERGLIGVYHDWCEAFSTYPRTYDLIHADNVFS  534

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V++RD  + ++R +RI  ++RW + +Y+ E
Sbjct  535  LYKD------RCEMKDILIEMDRILRPEGAVIVRDQVDTLNRVKRIMTSIRWQSKMYDHE  588

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+LVA K +W  SS S
Sbjct  589  SGPFNTEKVLVAVKTYWVGSSNS  611



>ref|XP_010110847.1| putative methyltransferase PMT18 [Morus notabilis]
 gb|EXC28326.1| putative methyltransferase PMT18 [Morus notabilis]
Length=224

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 95/137 (69%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMNVVPA+    TL VIY+RG IG Y DWCE FSTYPRTYDLIH   + S
Sbjct  88   AAALSKYPVWVMNVVPANSDQDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHAGGVFS  147

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  ++VE+DR+LRPEG+V+ RD+ E++ + + IA  +RW + I + E
Sbjct  148  IYQD------RCDITHILVEMDRILRPEGTVIFRDTVEILVKIQSIAKEMRWKSQIMDHE  201

Query  272  PGANGREKILVATKKHW  222
             G   +EKILVA K +W
Sbjct  202  SGPFNQEKILVAVKTYW  218



>gb|KHN06856.1| Putative methyltransferase PMT2 [Glycine soja]
Length=221

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  83   AAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGVFS  142

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C   D+++E+DR+LRPEG+V+ RD  +V+ + ++I   +RW T + + E
Sbjct  143  LYKD------KCKAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDTKMVDHE  196

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+LVA K++W  +STS
Sbjct  197  DGPLVPEKVLVAVKQYWVTNSTS  219



>ref|NP_001056669.2| Os06g0128100 [Oryza sativa Japonica Group]
 dbj|BAF18583.2| Os06g0128100 [Oryza sativa Japonica Group]
Length=230

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVP-AHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++ DPVWVMNVVP A    TL VIY+RGLIG Y DWCE  STYPRTYDLIH  ++ +
Sbjct  98   AAALVDDPVWVMNVVPTAAVANTLGVIYERGLIGTYQDWCEAMSTYPRTYDLIHAYSLFT  157

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + KD      RC + D+++E+DR+LRPEG+V+ RD  +V+ + + IA  +RW + I + E
Sbjct  158  MYKD------RCEMEDILLEMDRVLRPEGTVIFRDDVDVLVKIKNIADGMRWESRIVDHE  211

Query  272  PGANGREKILVATKKHWN  219
             G   REKILV+ K +W 
Sbjct  212  DGPMQREKILVSVKSYWT  229



>ref|XP_001772854.1| predicted protein [Physcomitrella patens]
 gb|EDQ62256.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 103/143 (72%), Gaps = 14/143 (10%)
 Frame = -1

Query  614  SDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDW-------CE--PFSTYPRTYDLIHVAA  462
            +DPVWVMNVVP   P TL  IYDRGL+GV+HDW       C   PFSTYPRTYDL+HV++
Sbjct  460  NDPVWVMNVVPVPGPNTLGTIYDRGLLGVFHDWQVLTSLFCFLIPFSTYPRTYDLLHVSS  519

Query  461  IESLTKDPS---SGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTT  291
            +E+LT   +   S  S C+L ++MVE+DR+LRP+G+V+IRD+P ++ R  ++A+ ++W  
Sbjct  520  VEALTTSQNRYLSVPSLCSLAEIMVEMDRILRPKGTVIIRDTPAMLARVSKVANGIQWNY  579

Query  290  SIYEKEPGANGREKILVATKKHW  222
             I++ EPGA  R  IL+ATK+ W
Sbjct  580  EIFDGEPGATDR--ILIATKQFW  600



>gb|KGN56550.1| hypothetical protein Csa_3G123720 [Cucumis sativus]
Length=396

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 7/142 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI+ DP+WVMN+VP      TL VIY+RGLIG Y +WCE  STYPRTYD IH  ++ S
Sbjct  248  AAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFS  307

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + K       RC + D+++E+DR+LRP+GSV++RD  +V+   + IA A++W   I + E
Sbjct  308  MYK------GRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIAEAMQWECRIADHE  361

Query  272  PGANGREKILVATKKHWNLSST  207
             G + REKILVATK++W  S+T
Sbjct  362  KGPHQREKILVATKQYWTASAT  383



>ref|XP_008438092.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=635

 Score =   152 bits (384),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 72/142 (51%), Positives = 100/142 (70%), Gaps = 7/142 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++ DP+WVMN+VP      TL VIY+RGLIG Y +WCE  STYPRTYD IH  ++ S
Sbjct  487  AAALVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFS  546

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + KD      RC + D+++E+DR+LRP+GSV++RD  +V+   + IA A++W   I + E
Sbjct  547  MYKD------RCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIAEAMQWECRIADHE  600

Query  272  PGANGREKILVATKKHWNLSST  207
             G + REKILVATK++W  S+T
Sbjct  601  KGPHQREKILVATKQYWTASAT  622



>gb|AEW70176.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
 gb|AEW70179.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70180.1| early responsive to dehydration 3, partial [Pinus densiflora]
Length=185

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  48   AAAVINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  104

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  105  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  161

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  162  AKNGDEKLLICQKKDWRSSKAA  183



>ref|XP_006663417.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=260

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 100/137 (73%), Gaps = 8/137 (6%)
 Frame = -1

Query  626  AAIISDPV-WVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA++  P+ WVMNVVPA  +  TL ++Y+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  121  AAVLESPISWVMNVVPAISEKNTLGIVYERGLIGIYHDWCEAFSTYPRTYDLIHANGLFS  180

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +CN+ D+++E+DR+LRPEG+V++RD+ EV+++  R    +RW + + + E
Sbjct  181  LYQN------KCNIEDILLEMDRILRPEGAVIMRDNVEVLNKVRRTVMGMRWKSKLLDHE  234

Query  272  PGANGREKILVATKKHW  222
             G +  EKILV+ KK+W
Sbjct  235  DGPHIPEKILVSVKKYW  251



>ref|XP_001779831.1| predicted protein [Physcomitrella patens]
 gb|EDQ55344.1| predicted protein, partial [Physcomitrella patens]
Length=636

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA+++ DPVWVMNV+P+  K  TL VIY+RGLIG Y +WCE FSTYPRTYDLIH + + S
Sbjct  494  AASLVKDPVWVMNVMPSDVKDNTLGVIYERGLIGTYQNWCEAFSTYPRTYDLIHASGLFS  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++VD+++E+DR+LRPEG+V+IRD  EV++R   I+  +RW T + + E
Sbjct  554  MYQD------RCDIVDILLEMDRILRPEGAVIIRDEVEVLNRVMMISQGMRWETRMADHE  607

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILV  K +W  SS +
Sbjct  608  DGPLVPEKILVGVKTYWVGSSAN  630



>gb|AAL24268.1| AT4g00750/F15P23_1 [Arabidopsis thaliana]
 gb|AAN18108.1| At4g00750/F15P23_1 [Arabidopsis thaliana]
Length=150

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            A+A++ DPVWVMNVVP    + TL VIY+RGLIG Y +WCE  STYPRTYD IH  ++ S
Sbjct  9    ASALVDDPVWVMNVVPVEASVNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFS  68

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC++ D+++E+DR+LRP+GSV+IRD  +V+ + ++I  A++W   I + E
Sbjct  69   LYKD------RCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKITDAMQWEGRIGDHE  122

Query  272  PGANGREKILVATKKHW  222
             G   REKIL   K++W
Sbjct  123  NGPLEREKILFLVKEYW  139



>gb|AEW70177.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
Length=185

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  48   AAAVINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  104

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  105  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNRHQRDTED  161

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  162  AKNGDEKLLICQKKDWRSSKAA  183



>gb|AIF75712.1| early response to drought 3, partial [Pinus hwangshanensis]
 gb|AIF75713.1| early response to drought 3, partial [Pinus hwangshanensis]
 gb|AIF75715.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  51   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  107

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  108  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  164

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  165  AKNGDEKLLICQKKDWRSSKAA  186



>gb|AEW70169.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70170.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70172.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
Length=185

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  48   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  104

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  105  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  161

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  162  AKNGDEKLLICQKKDWRSSKAA  183



>gb|AEW70174.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70178.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70181.1| early responsive to dehydration 3, partial [Pinus densiflora]
 gb|AEW70182.1| early responsive to dehydration 3, partial [Pinus densiflora]
Length=185

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  48   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  104

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  105  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  161

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  162  AKNGDEKLLICQKKDWRSSKAA  183



>gb|AIF75714.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  51   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  107

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  108  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  164

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  165  AKNGDEKLLICQKKDWRSSKAA  186



>gb|ABS83492.1| early response to drought 3 [Pinus pinaster]
Length=183

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  46   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  102

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  103  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  159

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  160  ANNGDEKLLICQKKDWRSSKAA  181



>gb|KDO82912.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=334

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  195  AAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGLFS  254

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN+ D+++E+DR+LRPEG+++IRD  + I + ++I   +RW T + + E
Sbjct  255  LYKD------KCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMRWDTKMVDHE  308

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W  S  S
Sbjct  309  DGPLVPEKILVAVKQYWVASGNS  331



>gb|AEW70168.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70173.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70175.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
Length=185

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  48   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  104

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  105  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTEN  161

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  162  ARNGDEKLLICQKKDWRSSKAA  183



>ref|XP_004979626.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=626

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP    L TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   I +
Sbjct  472  AAAIFSPKAWVMNVVPTAAELSTLGVIYERGLIGMYHDWCEAFSTYPRTYDLIHANGIFT  531

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V++RD  E++ + +R    +RW T +   E
Sbjct  532  LYKD------RCKMEDILLEMDRILRPEGTVILRDDVEILLKVQRTVKGMRWKTLMANHE  585

Query  272  PGANGREKILVATKKHWNLSS  210
               N REK+L A K++W   S
Sbjct  586  DSQNIREKVLFAVKRYWTADS  606



>gb|AEW70171.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
Length=185

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  48   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  104

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  105  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  161

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  162  ARNGDEKLLICQKKDWRSSKAA  183



>ref|XP_004508998.1| PREDICTED: probable methyltransferase PMT14-like [Cicer arietinum]
Length=611

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  472  AAALESQKSWVMNVVPTIADNTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHANGLFSL  531

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D      +CNL D+++E+DR+LRPEG+++IRD  +V+++ ++I   +RW   + + E 
Sbjct  532  YQD------KCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKIVGGMRWEAKMMDHED  585

Query  269  GANGREKILVATKKHW  222
            G    EKILVATK++W
Sbjct  586  GPLVPEKILVATKEYW  601



>gb|KHN15675.1| Putative methyltransferase PMT16 [Glycine soja]
Length=422

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I DPVWVMNVVP   K  TL  IY+RGLIG+YHDWCE  STYPRTYDLIH  ++ S
Sbjct  282  AAALIEDPVWVMNVVPVQAKVNTLGAIYERGLIGIYHDWCEAMSTYPRTYDLIHADSVFS  341

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L  +      RC L D+++E+DR+LRPEG V+IRD  +++ + + I + + W + I + E
Sbjct  342  LYSN------RCELEDILLEMDRILRPEGCVIIRDDADILVKVKSIVNGLEWDSIIVDHE  395

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G   REK+L A KK+W   + S 
Sbjct  396  DGPLQREKLLFAMKKYWTAPAASE  419



>ref|XP_008392677.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=149

 Score =   142 bits (358),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMN VPA+    TL VIY+RG IG Y DWCE FSTYPRTYDLIH   + S
Sbjct  11   AAALSKYPVWVMNTVPANSNQDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHAGGVFS  70

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+VV RD+ E++ + + I   +RW + I + E
Sbjct  71   IYQD------RCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAITDGMRWKSQIMDHE  124

Query  272  PGANGREKILVATKKHW  222
             G    EKIL+A K +W
Sbjct  125  SGPFNPEKILLAVKTYW  141



>ref|XP_006650137.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=611

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNVVP      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH  ++ S
Sbjct  474  AAALESTKLWVMNVVPTIADTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHANSVFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      RC   D+++E+DR+LRPEG+V++RD  +V+ + E+IA+A+RW T + + E
Sbjct  534  LYEN------RCKFEDILLEMDRILRPEGAVIVRDKVDVLVKVEKIANAMRWKTRLADHE  587

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKILVA K++W + S S
Sbjct  588  GGPHVPEKILVAVKQYWVVESKS  610



>ref|XP_008660000.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Zea mays]
Length=383

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  VWVMNV+P      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   I S
Sbjct  246  AAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHSNDIFS  305

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+++IRD  +V+ + E+IA+A+RW T + + E
Sbjct  306  LYQN------KCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKIANAMRWKTRLADHE  359

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKIL A K++W    TS
Sbjct  360  GGPHVPEKILFAVKQYWTAEKTS  382



>gb|ACB59070.1| early response to drought 3, partial [Pinus elliottii]
Length=207

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  70   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGLF--  127

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  +D  + +A  +RW     + E 
Sbjct  128  ----SAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVDSVKNLATGMRWNCHQRDTED  183

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG +K+L+  KK W  S  +
Sbjct  184  AKNGDQKLLICQKKDWRSSKAA  205



>gb|AHY28778.1| early response to drought 3, partial [Pinus elliottii]
Length=171

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  34   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  90

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  91   ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  147

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG +K+L+  KK W  S  +
Sbjct  148  AKNGDQKLLICQKKDWRSSKAA  169



>gb|AIF75710.1| early response to drought 3, partial [Pinus massoniana]
Length=188

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  51   AAAMINDPLWVMNVVSSYGINSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  107

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  108  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNRHQRDTED  164

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  165  AKNGDEKLLIRQKKDWRSSKAA  186



>gb|AHY28777.1| early response to drought 3, partial [Pinus echinata]
 gb|AHY28779.1| early response to drought 3, partial [Pinus palustris]
Length=188

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  51   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  107

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  108  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  164

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG +K+L+  KK W  S  +
Sbjct  165  AKNGDQKLLICQKKDWRSSKAA  186



>gb|ACO57101.1| early responsive to dehydration 3 [Pinus halepensis]
Length=201

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  64   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  120

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  121  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  177

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  178  AKNGDEKLLICQKKDWRSSKAA  199



>ref|XP_004133882.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=640

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 7/142 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI+ DP+WVMN+VP      TL VIY+RGLIG Y +WCE  STYPRTYD IH  ++ S
Sbjct  492  AAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFS  551

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + K       RC + D+++E+DR+LRP+GSV++RD  +V+   + IA A++W   I + E
Sbjct  552  MYK------GRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIAEAMQWECRIADHE  605

Query  272  PGANGREKILVATKKHWNLSST  207
             G + REKILVATK++W  S+T
Sbjct  606  KGPHQREKILVATKQYWTASAT  627



>ref|XP_004155808.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=635

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 7/142 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI+ DP+WVMN+VP      TL VIY+RGLIG Y +WCE  STYPRTYD IH  ++ S
Sbjct  487  AAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFS  546

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + K       RC + D+++E+DR+LRP+GSV++RD  +V+   + IA A++W   I + E
Sbjct  547  MYK------GRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIAEAMQWECRIADHE  600

Query  272  PGANGREKILVATKKHWNLSST  207
             G + REKILVATK++W  S+T
Sbjct  601  KGPHQREKILVATKQYWTASAT  622



>ref|NP_001050233.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|AAL58254.1|AC084762_28 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96247.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12147.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|EAZ27118.1| hypothetical protein OsJ_11050 [Oryza sativa Japonica Group]
 gb|EEC75363.1| hypothetical protein OsI_11805 [Oryza sativa Indica Group]
Length=611

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNVVP      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH  A+ S
Sbjct  474  AAALESTKLWVMNVVPTIADTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHANAVFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+V+IRD  +V+ + E+IA+A+RW T + + E
Sbjct  534  LYEN------KCKFEDILLEMDRILRPEGAVIIRDKVDVLVKVEKIANAMRWQTRLTDHE  587

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKIL A K++W + S S
Sbjct  588  GGPHVPEKILFAVKQYWVVESKS  610



>ref|XP_010662513.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Vitis 
vinifera]
Length=389

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++ DPVWVMNVVP    + TL VIY+RGLIG Y +WCE  STYPRTYDLIH  ++ S
Sbjct  248  AAALVEDPVWVMNVVPVDAKINTLGVIYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFS  307

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEGSV++RD  +V+ + +RI   + W + I + E
Sbjct  308  LYKD------RCEMEDILLEMDRILRPEGSVILRDDVDVLVKIKRITDGLNWMSRIVDHE  361

Query  272  PGANGREKILVATKKHW  222
             G + REK+L A K +W
Sbjct  362  DGPHQREKLLFAVKSYW  378



>ref|XP_003623835.1| hypothetical protein MTR_7g076170 [Medicago truncatula]
 gb|ABN08826.1| Generic methyltransferase [Medicago truncatula]
 gb|AES80053.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 99/137 (72%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I DPVWVMNVVP    + TL V+Y+RGLIG Y +WCE  STYPRTYD IH  ++ +
Sbjct  495  AAAMIDDPVWVMNVVPVEAEINTLGVVYERGLIGTYQNWCEAMSTYPRTYDFIHADSLFT  554

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L +D      RCN+ D++VE+DR+LRP+GSV++RD  +V+ + +R A A++W   I + E
Sbjct  555  LYED------RCNIEDILVEMDRILRPQGSVILRDDVDVLLKVKRFADAMQWDARIADHE  608

Query  272  PGANGREKILVATKKHW  222
             G + REKILVA K++W
Sbjct  609  KGPHQREKILVAVKQYW  625



>ref|XP_006602298.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=608

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP    + TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  470  AAAIHSSNLWVMNVVPTIAEMNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGVFS  529

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN  D+++E+DR+LRPEG+V+ RD  +V+ + ++I   +RW T + + E
Sbjct  530  LYKD------KCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDTKMVDHE  583

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+LVA K++W  +STS
Sbjct  584  DGPLVPEKVLVAVKQYWVTNSTS  606



>ref|XP_010676941.1| PREDICTED: probable methyltransferase PMT17 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 99/137 (72%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I  PVWVMNVVPA+  P TL V+Y+RG IGVYHDWCE FS+YPRTYDLIH   + S
Sbjct  519  AAAMIKYPVWVMNVVPANSNPDTLGVVYERGFIGVYHDWCEAFSSYPRTYDLIHAGGVFS  578

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++ ++++E+DR+LRPEG+V+ RD+ EV+ + + I + ++W + I + E
Sbjct  579  IYQD------RCDITNILLEMDRLLRPEGTVIFRDTVEVLVKIQAITNRMKWKSHISDHE  632

Query  272  PGANGREKILVATKKHW  222
             G    EKILVA K +W
Sbjct  633  NGPFNPEKILVAVKTYW  649



>ref|NP_001152056.1| methyltransferase [Zea mays]
 gb|ACG45571.1| methyltransferase [Zea mays]
Length=628

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVP-AHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP A +  TL V+Y+RGLIG+YHDWCE FSTYPRTYDLIH   I +
Sbjct  472  AAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTYPRTYDLIHANGIFT  531

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V++RD  EV+ + +R    +RW T +   E
Sbjct  532  LYKD------RCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRWKTLLANHE  585

Query  272  PGANGREKILVATKKHWNLSS  210
             G N  EK+L A K++W  + 
Sbjct  586  DGPNVPEKVLFAVKRYWTAAG  606



>tpg|DAA42264.1| TPA: methyltransferase isoform 1 [Zea mays]
 tpg|DAA42265.1| TPA: methyltransferase isoform 2 [Zea mays]
Length=628

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVP-AHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP A +  TL V+Y+RGLIG+YHDWCE FSTYPRTYDLIH   I +
Sbjct  472  AAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTYPRTYDLIHANGIFT  531

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V++RD  EV+ + +R    +RW T +   E
Sbjct  532  LYKD------RCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRWKTLLANHE  585

Query  272  PGANGREKILVATKKHWNLSS  210
             G N  EK+L A K++W  + 
Sbjct  586  DGPNVPEKVLFAVKRYWTAAG  606



>gb|ACF86888.1| unknown [Zea mays]
Length=228

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP   K  TL  +Y+RGLIG+YHDWCE FSTYPRTYDLIH + + +
Sbjct  89   AAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPRTYDLIHASGLFT  148

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L K      ++C++ D+++E+DR+LRPEG+V+IRD  +V+ +   +A  +RW T + + E
Sbjct  149  LYK------TKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLALGMRWDTKMVDHE  202

Query  272  PGANGREKILVATKKHW  222
             G   REKIL A K++W
Sbjct  203  DGPLVREKILYAVKQYW  219



>gb|AAW72868.1| early response to drought 3, partial [Pinus taeda]
Length=207

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  70   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGAYNDWCEAFSTYPRTYDLLHVDGLF--  127

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  128  ----SAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  183

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG +K+L+  KK W  S  +
Sbjct  184  AKNGDQKLLICQKKDWRSSKAA  205



>gb|AAW72852.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72853.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72854.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72855.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72856.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72857.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72858.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72859.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72860.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72861.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72862.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72863.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72864.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72865.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72866.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72867.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72869.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72870.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72871.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72872.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72873.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72874.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72875.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72876.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72878.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72879.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72880.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72881.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72882.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72883.1| early response to drought 3, partial [Pinus taeda]
 gb|ACB59068.1| early response to drought 3, partial [Pinus radiata]
 gb|ACB59069.1| early response to drought 3, partial [Pinus radiata]
 gb|ACB59071.1| early response to drought 3, partial [Pinus elliottii]
Length=207

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  70   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGLF--  127

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  128  ----SAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  183

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG +K+L+  KK W  S  +
Sbjct  184  AKNGDQKLLICQKKDWRSSKAA  205



>ref|XP_008373610.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=325

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S  +WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPR+YDLIH + + +L
Sbjct  184  AAALESRKLWVMNVVPTIAKNTLGVIYERGLIGIYHDWCEGFSTYPRSYDLIHASGVFTL  243

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+       C L D+++E+DR+LRPEG+V+ RD  +V+++  +I   +RW T I + E 
Sbjct  244  YKN------ECKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWDTKIMDHED  297

Query  269  GANGREKILVATKKHW  222
            G    EKILV  K++W
Sbjct  298  GPLVPEKILVVVKQYW  313



>ref|XP_008659999.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Zea mays]
Length=611

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  VWVMNV+P      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   I S
Sbjct  474  AAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHSNDIFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+++IRD  +V+ + E+IA+A+RW T + + E
Sbjct  534  LYQN------KCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKIANAMRWKTRLADHE  587

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKIL A K++W    TS
Sbjct  588  GGPHVPEKILFAVKQYWTAEKTS  610



>gb|AIF75711.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+Y RGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  51   AAALINDPLWVMNVVSSYGLNSLNVVYGRGLIGTYNDWCEAFSTYPRTYDLLHVDGL---  107

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  108  ---FSAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLAAGMRWNCHQRDTED  164

Query  269  GANGREKILVATKKHWNLSSTS  204
              NG EK+L+  KK W  S  +
Sbjct  165  AKNGDEKLLICQKKDWRSSKAA  186



>gb|ABR16934.1| unknown [Picea sitchensis]
Length=626

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 98/137 (72%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ +DPVWVMNVVP+  K  TL VIY+RG IG Y DWCE FSTYPRTYDLIH + + S
Sbjct  487  AAALANDPVWVMNVVPSDAKHNTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHASGLLS  546

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC + D+++E+DR+LRPEG+V+ RD+ +V+ + E +   +RW + + + E
Sbjct  547  MYQD------RCEISDILLEMDRILRPEGTVIFRDTVDVLVKVENLIGGMRWQSQMMDHE  600

Query  272  PGANGREKILVATKKHW  222
             G   +EKIL+A K++W
Sbjct  601  SGPFNQEKILIAVKQYW  617



>ref|XP_008668148.1| PREDICTED: methyltransferase isoform X1 [Zea mays]
Length=658

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVP-AHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP A +  TL V+Y+RGLIG+YHDWCE FSTYPRTYDLIH   I +
Sbjct  502  AAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTYPRTYDLIHANGIFT  561

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V++RD  EV+ + +R    +RW T +   E
Sbjct  562  LYKD------RCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRWKTLLANHE  615

Query  272  PGANGREKILVATKKHWNLSS  210
             G N  EK+L A K++W  + 
Sbjct  616  DGPNVPEKVLFAVKRYWTAAG  636



>ref|XP_002467784.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
 gb|EER94782.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
Length=610

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNV+P      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   I S
Sbjct  474  AAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHSNDIFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+V+IRD  +V+ + E+IA+A+RW T + + E
Sbjct  534  LYQN------KCQFEDILLEMDRILRPEGAVIIRDKVDVLVKVEKIANAMRWKTRLADHE  587

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKIL   K++W++S++S
Sbjct  588  GGPHVPEKILFVVKQYWDVSTSS  610



>ref|XP_011038052.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
 ref|XP_011038053.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
Length=628

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 95/137 (69%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMNVVPA+  P TL VIY+RG IG Y DWCE FSTYPRTYDLIH   + S
Sbjct  489  AAALAKYPVWVMNVVPANSNPDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHAGGVFS  548

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+V+ RD+ EV+ R + I + +RW + I + E
Sbjct  549  IYQD------RCDITHILLEMDRILRPEGTVIFRDTVEVLVRIQTITNGMRWKSQIMDHE  602

Query  272  PGANGREKILVATKKHW  222
             G    EKILVA K +W
Sbjct  603  SGPFNPEKILVAVKTYW  619



>ref|XP_003555372.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=600

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 97/143 (68%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I DPVWVMNVVP   K  TL  IY+RGLIG+YHDWCE  STYPRTYDLIH  ++ S
Sbjct  460  AAALIEDPVWVMNVVPVQAKVNTLGAIYERGLIGIYHDWCEAMSTYPRTYDLIHADSVFS  519

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L  +      RC L D+++E+DR+LRPEG V+IRD  +++ + + I + + W + I + E
Sbjct  520  LYSN------RCELEDILLEMDRILRPEGCVIIRDDADILVKVKSIVNGLEWDSIIVDHE  573

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G   REK+L A KK+W   + S
Sbjct  574  DGPLQREKLLFAMKKYWTAPAAS  596



>ref|XP_007039581.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY24082.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=612

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 97/142 (68%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA++ S   WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPRTYD IH   + SL
Sbjct  471  AASLESPKSWVMNVVPTVAKNTLGVIYERGLIGIYHDWCEGFSTYPRTYDFIHANGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++      +CN  D+++E+DR+LRPEG+V+ RD  +V+++  +IA  +RW T + + E 
Sbjct  531  YQN------KCNFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIAGGMRWNTKMMDHED  584

Query  269  GANGREKILVATKKHWNLSSTS  204
            G    EKILVA K++W  SS +
Sbjct  585  GPLVPEKILVAVKQYWVGSSGN  606



>ref|XP_008795397.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=629

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVP-AHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I +PVWVMNVVP A    TL VIY+RGLIG Y DWCE  STYPRTYDL+H  ++ +
Sbjct  494  AAAMIDEPVWVMNVVPTAANSSTLGVIYERGLIGTYQDWCEAMSTYPRTYDLLHADSVFT  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V+ RD  +V+ +   I + +RW + I + E
Sbjct  554  LYKD------RCQMEDILLEMDRILRPEGTVIFRDDVDVLVKIRSITNGMRWKSQIADHE  607

Query  272  PGANGREKILVATKKHWNLS  213
             G   +EKIL+A K +W LS
Sbjct  608  DGPRQKEKILLAVKDYWTLS  627



>ref|XP_010527898.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNV+P   P  TL VIY+RGLIGVYHDWCE FSTYPRTYDLIH   + S
Sbjct  477  AAALESAKLWVMNVMPTIAPKNTLGVIYERGLIGVYHDWCEAFSTYPRTYDLIHANRVFS  536

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L K+      +CN  D+++E+DR+LRPEG+V+ RD  EV+ + ++I   +RW + + + E
Sbjct  537  LYKN------KCNPEDILLEMDRILRPEGAVIFRDQVEVLIKVKKIVRRMRWDSKLVDHE  590

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W ++STS
Sbjct  591  DGPLVSEKILVAVKQYWVVNSTS  613



>ref|XP_010934554.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=608

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 100/144 (69%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I DPVWVMN+VP    + TL VIY+RGLIG YHDWCE  STYPRTYDL+H  ++ +
Sbjct  471  AAAMIDDPVWVMNIVPTVAKIDTLGVIYERGLIGTYHDWCEAMSTYPRTYDLLHADSVFT  530

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V+ RD  +++ R + I   + W + I + E
Sbjct  531  LYKD------RCEMEDILLEMDRILRPEGTVIFRDDVDILVRIKSITDGMSWNSRIVDHE  584

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G   REK+L+A K +W++S+ + 
Sbjct  585  DGPLQREKLLIAVKANWSISNQTQ  608



>gb|KEH31563.1| methyltransferase PMT14-like protein, putative [Medicago truncatula]
Length=1599

 Score =   151 bits (382),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 6/133 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMN VP     TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  474  AAALESQKSWVMNAVPTIADNTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHANGLFSL  533

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D      +CNL D+++E+DR+LRPEGSV+IRD  +VI++ ++I   +RW + + + E 
Sbjct  534  YQD------KCNLEDILLEMDRILRPEGSVIIRDEVDVINKVQKIVRGMRWESKMVDHED  587

Query  269  GANGREKILVATK  231
            G    EKILV  K
Sbjct  588  GPFAPEKILVIVK  600



>ref|XP_004984213.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=611

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNV+P      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH  AI S
Sbjct  474  AAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHSNAIFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+V++RD  + + + E+IA+A+RW T + + E
Sbjct  534  LYQN------KCKFEDILLEMDRILRPEGAVIVRDKVDALVKVEKIANAMRWKTRLADHE  587

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKIL A K++W  +S S
Sbjct  588  DGPHVPEKILFAVKQYWATTSKS  610



>gb|KDO82910.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
 gb|KDO82911.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=506

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  367  AAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGLFS  426

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN+ D+++E+DR+LRPEG+++IRD  + I + ++I   +RW T + + E
Sbjct  427  LYKD------KCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMRWDTKMVDHE  480

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W  S  S
Sbjct  481  DGPLVPEKILVAVKQYWVASGNS  503



>ref|XP_004984212.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
Length=619

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNV+P      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH  AI S
Sbjct  482  AAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHSNAIFS  541

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+V++RD  + + + E+IA+A+RW T + + E
Sbjct  542  LYQN------KCKFEDILLEMDRILRPEGAVIVRDKVDALVKVEKIANAMRWKTRLADHE  595

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G +  EKIL A K++W  +S S
Sbjct  596  DGPHVPEKILFAVKQYWATTSKS  618



>ref|XP_010250929.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250938.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250946.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250956.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250965.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250972.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250980.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
Length=633

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  PVWVMNVVPA+    TL VIY+RG IG YHDWCE FSTYPRTYDLIH   + S
Sbjct  492  AAALVKYPVWVMNVVPANTNQDTLGVIYERGFIGTYHDWCEAFSTYPRTYDLIHAGGVFS  551

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+V+ RD+ +V+ + + I   +RW + I + E
Sbjct  552  IYQD------RCDITYILLEMDRILRPEGTVIFRDTVDVLVKIQSITDGMRWKSQIMDHE  605

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K +W   ++S
Sbjct  606  SGPFNPEKILVAVKTYWTGEASS  628



>ref|XP_006368452.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
 gb|ERP65021.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
Length=612

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGL+G+YHDWCE FSTYPRTYD IH   + SL
Sbjct  471  AAALESPKSWVMNVVPTIAKNTLGVIYERGLVGIYHDWCEGFSTYPRTYDFIHANGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++      +CNL D+++E+DR+LRPEG+V+ RD  +V+++ ++I   +RW T + + E 
Sbjct  531  YQN------KCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKITEGMRWDTKMMDHED  584

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K++W
Sbjct  585  GPLVPEKILVAVKQYW  600



>ref|XP_003557818.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=611

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA + S  +WVMNVVP      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  474  AAVLESTKLWVMNVVPTIADASTLGVIYERGLIGMYHDWCEGFSTYPRTYDLIHANDVFS  533

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +C   D+++E+DR+LRPEG+V+IRD  + + + E+IA+A+RW T +   E
Sbjct  534  LYQN------KCKFEDILLEMDRILRPEGAVIIRDKVDALVKVEKIANAMRWKTRLANHE  587

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G +  EKIL A K++W   S SH
Sbjct  588  SGPHVSEKILFAVKQYWATESKSH  611



>emb|CDY03207.1| BnaC09g19490D [Brassica napus]
Length=622

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 96/136 (71%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL V+++RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  478  AAALESTESWVMNVVPTIAKNTLSVVFERGLIGIYHDWCEGFSTYPRTYDLIHANNVFSL  537

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++      RCN+ D+++E+DR+LRPEG+V+ RD  +V++   +IA+ +RW T + + E 
Sbjct  538  YQN------RCNVEDILLEMDRILRPEGTVLFRDEVDVLNDVRKIANGMRWDTKLMDHED  591

Query  269  GANGREKILVATKKHW  222
            G    EKILVA KK+W
Sbjct  592  GPLVPEKILVAVKKYW  607



>gb|KDO43766.1| hypothetical protein CISIN_1g026623mg [Citrus sinensis]
Length=235

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 91/136 (67%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  96   AAALESPKSWVMNVVPTTAKNTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHANGVFSL  155

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++       C   D+++E+DR+LRPEG+V+ RD  + +++  + A  +RW T + + E 
Sbjct  156  YENT------CKPEDILLEMDRILRPEGAVIFRDEVDALNKVRKFAEGMRWDTKMMDHED  209

Query  269  GANGREKILVATKKHW  222
            G    EKIL+A K++W
Sbjct  210  GPLMPEKILIAVKQYW  225



>ref|XP_002279420.2| PREDICTED: probable methyltransferase PMT15 isoform X1 [Vitis 
vinifera]
 emb|CBI31829.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++ DPVWVMNVVP    + TL VIY+RGLIG Y +WCE  STYPRTYDLIH  ++ S
Sbjct  515  AAALVEDPVWVMNVVPVDAKINTLGVIYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFS  574

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEGSV++RD  +V+ + +RI   + W + I + E
Sbjct  575  LYKD------RCEMEDILLEMDRILRPEGSVILRDDVDVLVKIKRITDGLNWMSRIVDHE  628

Query  272  PGANGREKILVATKKHW  222
             G + REK+L A K +W
Sbjct  629  DGPHQREKLLFAVKSYW  645



>ref|XP_009761475.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=611

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S   WVMNV+P   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH + + S
Sbjct  472  AAALHSPKFWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHASGLFS  531

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C   D+++E+DR+LRPEG+V++RD  +V+ + ++I   +RW   + + E
Sbjct  532  LYKD------KCEFEDILLEMDRILRPEGAVILRDEVDVLIKVKKIIGGMRWNFKLMDHE  585

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W L+ST+
Sbjct  586  DGPLVPEKILVAVKQYWTLNSTT  608



>ref|XP_009624681.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=611

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S   WVMNV+P   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH + + S
Sbjct  472  AAALHSPKFWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHASGLFS  531

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C   D+++E+DR+LRPEG+V++RD  +V+ + ++I   +RW   + + E
Sbjct  532  LYKD------KCEFEDILLEMDRILRPEGAVILRDDVDVLIKVKKIIGGMRWNFKLMDHE  585

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W L+ST+
Sbjct  586  DGPLVPEKILVAVKQYWTLNSTT  608



>ref|XP_003592303.1| hypothetical protein MTR_1g101370 [Medicago truncatula]
 gb|AES62554.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=634

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            A+A++ +PVWVMNVVP    + TL  IY+RGLIG YHDWCE  STYPRTYDLIH  ++ S
Sbjct  487  ASALVKNPVWVMNVVPVQAKVDTLGAIYERGLIGTYHDWCEAMSTYPRTYDLIHADSLFS  546

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L         RC L D+M+E+DR+LRPEG+++IRD  +V+ + + IA+ + W +SI + E
Sbjct  547  LYN------GRCELEDIMLEMDRILRPEGAIIIRDDVDVLLKVKNIANGLEWDSSIVDHE  600

Query  272  PGANGREKILVATKKHW  222
             G   REK+L A KK+W
Sbjct  601  DGPLEREKLLFAVKKYW  617



>ref|XP_007210880.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
 gb|EMJ12079.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
Length=612

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 93/136 (68%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPR+YDLIH + + SL
Sbjct  471  AAALESRKSWVMNVVPTIAKNTLGVIYERGLIGIYHDWCEGFSTYPRSYDLIHASGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+       CNL D+++E+DRMLRPEG+V+ RD  +V+++  +I   +RW   I + E 
Sbjct  531  YKN------ECNLEDILLEMDRMLRPEGAVIFRDEVDVLNKVRKIVGGMRWDAKIMDHED  584

Query  269  GANGREKILVATKKHW  222
            G    EKILV  K++W
Sbjct  585  GPLVPEKILVVVKQYW  600



>gb|KJB51709.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51710.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51711.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=613

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  471  AAALESPKSWVMNVVPTIGKDTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHANGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D      +C+  D+++E+DR+LRPEG+V+ RD  +V+++  +IA  +RW T + + E 
Sbjct  531  YQD------KCSFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIAGGMRWDTKMNDHED  584

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K++W
Sbjct  585  GPLVPEKILVAVKQYW  600



>ref|XP_010258374.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
 ref|XP_010258376.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=617

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  476  AAAIESPKLWVMNVVPTIAEKKTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHANGVFS  535

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN  D+++E+DR+LRPEG+V+ RD  +V+ + +RI   ++W T + + E
Sbjct  536  LYKD------KCNAEDILLEMDRILRPEGAVIFRDDVDVLIKVKRIIAGMKWNTKMVDHE  589

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W +   +
Sbjct  590  DGPLVPEKILVAVKQYWTVGENN  612



>ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH  ++ S
Sbjct  469  AAAIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHSDSLFS  528

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C+  D+++E+DR+LRPEG+V+IRD  +V+ + +++   +RW T + + E
Sbjct  529  LYKD------KCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRWNTKMVDHE  582

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKIL+A K++W  ++TS
Sbjct  583  DGPLVPEKILIAVKQYWVANATS  605



>emb|CDX99539.1| BnaC09g24530D [Brassica napus]
Length=625

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 99/144 (69%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA+++  P WVMNVVP H +  TL VIY+RGLIG Y DWCE FSTYPRTYD+IH   + +
Sbjct  484  AASMLKYPSWVMNVVPVHAEKQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFT  543

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L  +      RC+L  +++E+DR+LRPEG+VV+RD+ E++ + E+IA  ++W T I + E
Sbjct  544  LYDN------RCDLTLILLEMDRILRPEGTVVLRDNVEMLTKVEKIAKGIKWNTQIVDHE  597

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G    EKILVA K +W    +++
Sbjct  598  KGPYNPEKILVAVKTYWTGQPSNN  621



>ref|XP_011018632.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
 ref|XP_011018633.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
Length=612

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGL+G+YHDWCE FSTYPRTYD IH   + SL
Sbjct  471  AAALESPKSWVMNVVPTIAKNTLGVIYERGLVGIYHDWCEGFSTYPRTYDFIHANGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++      +CNL D+++E+DR+LRPEG+V+ RD  +V+++ ++I   +RW T + + E 
Sbjct  531  YQN------KCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKITGGMRWDTKMMDHED  584

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K++W
Sbjct  585  GPLVPEKILVAVKQYW  600



>ref|XP_006438677.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
 ref|XP_006483161.1| PREDICTED: probable methyltransferase PMT2-like [Citrus sinensis]
 gb|ESR51917.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
Length=610

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP      TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  471  AAAIQSPKLWVMNVVPTIADKNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGLFS  530

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN+ D+++E+DR+LRPEG+++IRD  + I + ++I   +RW T + + E
Sbjct  531  LYKD------KCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMRWDTKMVDHE  584

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W  S  S
Sbjct  585  DGPLVPEKILVAVKQYWVASGNS  607



>emb|CDP12267.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMNVVPA   P TL ++Y+RG IG YHDWCE FSTYPRTYDLIH   + S
Sbjct  507  AAALAKYPVWVMNVVPAKLDPDTLGIVYERGFIGTYHDWCEAFSTYPRTYDLIHADGVFS  566

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++ D+++E+DR+LRPEG+V+ RD+ EV+ + + I+  +RW + I + E
Sbjct  567  IYQD------RCDITDILLEMDRILRPEGTVIFRDAVEVLVKIKSISDGMRWESRILDHE  620

Query  272  PGANGREKILVATKKHW  222
             G    +KILVA K +W
Sbjct  621  SGPFNPQKILVAVKNYW  637



>ref|XP_006439163.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
 gb|ESR52403.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
Length=629

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMNVVP H  P TL  IY+RGLIG Y DWCE FSTYPRTYDLIH + + S
Sbjct  494  AAAMSKYPVWVMNVVPFHSNPDTLGAIYERGLIGTYQDWCEAFSTYPRTYDLIHASGVFS  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++ ++++EIDR+LRPEG+V+ RD+ E++ +   I   +RW + I + E
Sbjct  554  IYQD------RCDITNILLEIDRILRPEGTVIFRDTVEMLLKIRSITEGMRWKSQIMDHE  607

Query  272  PGANGREKILVATKKHWNLSS  210
             G    EKIL A K +W  +S
Sbjct  608  SGPFNPEKILFAAKTYWTGAS  628



>ref|XP_006385609.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
 gb|ERP63406.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
Length=612

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGL+G+YHDWCE FSTYPRTYD IH   + SL
Sbjct  471  AAALESPKSWVMNVVPTIAKNTLGVIYERGLVGIYHDWCEGFSTYPRTYDFIHANGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++      +CNL D+++E+DR+LRPEG+V+ RD  +V+++ ++IA  +RW T + + E 
Sbjct  531  YQN------KCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKIAGGMRWDTKMMDHED  584

Query  269  GANGREKILVATKKHW  222
            G    EKILV  K++W
Sbjct  585  GPLVPEKILVVVKQYW  600



>emb|CDP00327.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 98/137 (72%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNVVP   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  475  AAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHANGLFS  534

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C+  D+++E+DR+LRPEG+V+IRD+ +V+++ ++I   +RW   + + E
Sbjct  535  LYKD------KCDFEDILLEMDRILRPEGAVIIRDAVDVLNKVQKIVRGIRWDFKLTDHE  588

Query  272  PGANGREKILVATKKHW  222
             G    EKIL+A KK+W
Sbjct  589  DGPLVPEKILIAVKKYW  605



>ref|XP_010683197.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683199.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683200.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683201.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=610

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNV+P   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   I S
Sbjct  469  AAAIHSSKLWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPRTYDLIHANGIFS  528

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L K+      +CNL D+++E+DR+LRPEG+V+IRD  +V+ + ++I   +RW T + + E
Sbjct  529  LYKN------KCNLEDILLEMDRILRPEGAVIIRDEVDVLVKVKKIVAGMRWDTRMVDHE  582

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EKILVA K++W +   +
Sbjct  583  DGPLVPEKILVAVKQYWTVDGGN  605



>ref|XP_010937119.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 97/137 (71%), Gaps = 6/137 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP   +  TL V+Y+RGLIG+YHDWCE FS+YPRTYDLIH   + S
Sbjct  475  AAAIESPKLWVMNVVPTVAEKSTLSVVYERGLIGIYHDWCEAFSSYPRTYDLIHANGVFS  534

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD     SRC + D+++E+DR+LRPEG+V+ RD  +V+ + ++I   +RW T + + E
Sbjct  535  LYKD-----SRCKMEDILLEMDRILRPEGAVMFRDQDDVLAKVKQIVSGMRWNTKMADHE  589

Query  272  PGANGREKILVATKKHW  222
             G    EKILVA K++W
Sbjct  590  DGPLVPEKILVAVKQYW  606



>ref|XP_009371893.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371894.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371895.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371896.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371897.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371898.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
Length=616

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S  +WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPR+YDLIH + + SL
Sbjct  474  AAALESRKLWVMNVVPTIAKNTLGVIYERGLIGIYHDWCEGFSTYPRSYDLIHASGVFSL  533

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             K+      RC L D+++E+DR+LRPEG+V+ RD  +V+++  +I   +RW   I + E 
Sbjct  534  YKN-----GRCKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWDAKIMDHED  588

Query  269  GANGREKILVATKKHWNLSSTS  204
            G    EKILV  K++W   S +
Sbjct  589  GPLVPEKILVVVKQYWVAGSGN  610



>ref|XP_003532062.1| PREDICTED: probable methyltransferase PMT2-like isoformX1 [Glycine 
max]
 ref|XP_003532063.1| PREDICTED: probable methyltransferase PMT2-like isoformX2 [Glycine 
max]
Length=608

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  470  AAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGVFS  529

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C   D+++E+DR+LRPEG+V+ RD  +V+ + ++I   +RW T + + E
Sbjct  530  LYKD------KCKAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDTKMVDHE  583

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+LVA K++W  +STS
Sbjct  584  DGPLVPEKVLVAVKQYWVTNSTS  606



>ref|XP_011076214.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=658

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AA +I DP+WVMNVVP    + TL VIY+RGLIG Y  WCE  STYPRTYDLIH  ++ +
Sbjct  512  AANLIDDPLWVMNVVPVEAKVNTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFT  571

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+M+E+DR+LRPEGS++IRD  +++ + +RIA A+ W + I + E
Sbjct  572  LYKD------RCEMEDIMLEMDRILRPEGSLIIRDDVDILVKVKRIADALNWESQIVDHE  625

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G   REK+L A K +W   ++S
Sbjct  626  DGPLEREKLLFAVKLYWTAPASS  648



>ref|XP_010275323.1| PREDICTED: probable methyltransferase PMT14 [Nelumbo nucifera]
Length=613

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP   +  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH + + S
Sbjct  471  AAAIESPKSWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHASGVFS  530

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + ++      +C  VD+++E+DR+LRPEG+V+IRD+ +V+++  +IA+ ++W T + + E
Sbjct  531  MYQN------KCEAVDILLEMDRILRPEGAVIIRDNVDVLNKVRKIANGMKWDTKMVDHE  584

Query  272  PGANGREKILVATKKHW  222
             G    EKILVA K++W
Sbjct  585  DGPLVPEKILVAVKQYW  601



>gb|KHN17371.1| Putative methyltransferase PMT2 [Glycine soja]
Length=608

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S  +WVMNVVP    + TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  470  AAAIHSSNLWVMNVVPTIAEMNTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGVFS  529

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN  D+++E+DR+LRPEG+V+ RD  +V+ + ++    +RW T + + E
Sbjct  530  LYKD------KCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKRVGGMRWDTKMVDHE  583

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+LVA K++W  +STS
Sbjct  584  DGPLVPEKVLVAVKQYWVTNSTS  606



>gb|AAM67038.1| unknown [Arabidopsis thaliana]
Length=146

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (67%), Gaps = 7/142 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  P WVMNVVP   +  TL VI++RG IG Y DWCE FSTYPRTYDLIH   + S
Sbjct  11   AAAMMKYPSWVMNVVPVDAEKQTLGVIFERGFIGTYQDWCEGFSTYPRTYDLIHAGGLFS  70

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + ++      RC++  +++E+DR+LRPEG+VV RD+ E++ + + I + +RW + I + E
Sbjct  71   IYEN------RCDVTLILLEMDRILRPEGTVVFRDTVEMLTKIQSITNGMRWKSRILDHE  124

Query  272  PGANGREKILVATKKHWNLSST  207
             G    EKIL+A K +W   S+
Sbjct  125  RGPFNPEKILLAVKSYWTGPSS  146



>gb|AAW72877.1| early response to drought 3, partial [Pinus taeda]
Length=207

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+I+DP+WVMNVV ++   +L+V+YDRGLIG Y+DWCE FSTYPRTYDL+HV  +   
Sbjct  70   AAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYPRTYDLLHVDGLF--  127

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                S+   RC +  +++E+DR+LRP G V++R+SP  ++  + +A  +RW     + E 
Sbjct  128  ----SAESHRCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNLATGMRWNCHQRDTED  183

Query  269  GANGREKILVATKKHWNLSSTS  204
              N  +K+L+  KK W  S  +
Sbjct  184  AKNADQKLLICQKKDWRSSKAA  205



>ref|XP_008437487.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
 ref|XP_008437488.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
Length=636

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  PVWVMNVVPA+    TL VIY+RG IG Y DWCE FSTYPRTYDLIH   I S
Sbjct  494  AAALVKFPVWVMNVVPANSDRDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHANGIFS  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+V+ RD+ EV+ + + I+  +RW + I + E
Sbjct  554  IYQD------RCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTISDGMRWKSQIMDHE  607

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G    EKILVA K +W   +   
Sbjct  608  TGPFNPEKILVAVKTYWTGETNQQ  631



>ref|XP_010029610.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029618.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83590.1| hypothetical protein EUGRSUZ_B00481 [Eucalyptus grandis]
Length=614

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNV+P   K  TL VIY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  470  AAALESPKLWVMNVMPTIAKRDTLGVIYERGLIGIYHDWCEAFSTYPRTYDLIHAHGVFS  529

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN+ D+++E+DR+LRPEG+V+ RD  +V+ + +RI   +RW T + + E
Sbjct  530  LYKD------KCNMEDILLEMDRILRPEGAVIFRDELDVLLKVKRIVGGMRWNTKMVDHE  583

Query  272  PGANGREKILVATKKHWNLSSTS  204
             G    EK+L A K++W    +S
Sbjct  584  DGPLITEKVLFAVKQYWVAGESS  606



>ref|NP_001170352.1| uncharacterized protein LOC100384329 [Zea mays]
 gb|ACN36721.1| unknown [Zea mays]
Length=180

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+++DP+WVMN+VP      TL VIY+RGLIG Y DWCE  STYPRTYDLIH   + +
Sbjct  43   AAALVNDPLWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCEGMSTYPRTYDLIHADTVFT  102

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L         RC   ++++E+DR+LRPEG+V+IRD  +++ + + +A  +RW + I + E
Sbjct  103  LYN------GRCEAENILLEMDRILRPEGTVIIRDDVDLLVKIKSMADGMRWNSQIVDHE  156

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G   REK+L+  K +W L  +  
Sbjct  157  DGPLVREKLLLVVKTYWTLDGSEQ  180



>gb|EAY79581.1| hypothetical protein OsI_34717 [Oryza sativa Indica Group]
Length=589

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 8/137 (6%)
 Frame = -1

Query  626  AAIISDPV-WVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAII  P+ WVMNVVP   +  TL +IY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  450  AAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPRTYDLIHANGLFS  509

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +CN+ D+++E+DR+LRPEG+V++RD+ EV+++  R    +RW + + + E
Sbjct  510  LYQN------KCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKSKLLDHE  563

Query  272  PGANGREKILVATKKHW  222
             G +  EKILV+ KK+W
Sbjct  564  DGPHIPEKILVSVKKYW  580



>gb|EAZ17038.1| hypothetical protein OsJ_32528 [Oryza sativa Japonica Group]
Length=589

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 8/137 (6%)
 Frame = -1

Query  626  AAIISDPV-WVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAII  P+ WVMNVVP   +  TL +IY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  450  AAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPRTYDLIHANGLFS  509

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +CN+ D+++E+DR+LRPEG+V++RD+ EV+++  R    +RW + + + E
Sbjct  510  LYQN------KCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKSKLLDHE  563

Query  272  PGANGREKILVATKKHW  222
             G +  EKILV+ KK+W
Sbjct  564  DGPHIPEKILVSVKKYW  580



>ref|XP_010255519.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nelumbo 
nucifera]
Length=419

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+I DPVWV+NVVP    + TL  IY+RGLIG Y DWCE  STYPRTYDLIH  ++ +
Sbjct  273  AAALIDDPVWVINVVPTEAKINTLGAIYERGLIGTYQDWCEAMSTYPRTYDLIHADSVLT  332

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      RC + D+++E+DR+LRPEG+V+ RD  +++  T+ I   + W + I + E
Sbjct  333  LYKD------RCEIEDILLEMDRILRPEGTVIFRDDVDILVTTKSITDGMNWDSHIVDHE  386

Query  272  PGANGREKILVATKKHWNLSS  210
             G + REK+L A K++W  S+
Sbjct  387  KGPHQREKLLFAVKRYWTASA  407



>ref|NP_001065447.2| Os10g0569300 [Oryza sativa Japonica Group]
 gb|ABB48009.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF27284.2| Os10g0569300 [Oryza sativa Japonica Group]
Length=605

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 8/137 (6%)
 Frame = -1

Query  626  AAIISDPV-WVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAII  P+ WVMNVVP   +  TL +IY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  466  AAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPRTYDLIHANGLFS  525

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +CN+ D+++E+DR+LRPEG+V++RD+ EV+++  R    +RW + + + E
Sbjct  526  LYQN------KCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKSKLLDHE  579

Query  272  PGANGREKILVATKKHW  222
             G +  EKILV+ KK+W
Sbjct  580  DGPHIPEKILVSVKKYW  596



>ref|XP_004169220.1| PREDICTED: probable methyltransferase PMT18-like [Cucumis sativus]
Length=636

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  PVWVMNVVPA+    TL VIY+RGLIG Y DWCE FSTYPRTYDLIH   I S
Sbjct  494  AAALVKFPVWVMNVVPANSDRDTLGVIYERGLIGTYQDWCEAFSTYPRTYDLIHANGIFS  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+V+ RD+ EV+ + + I+  ++W + I + E
Sbjct  554  IYQD------RCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTISDGMKWKSQIMDHE  607

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G    EKILVA K +W   +   
Sbjct  608  TGPFNPEKILVAVKTYWTGETNQQ  631



>gb|KHG27439.1| hypothetical protein F383_15139 [Gossypium arboreum]
Length=643

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGLIG+YHDWCE FSTYPRTYDL+H   + SL
Sbjct  501  AAALESPKSWVMNVVPTIGKDTLGVIYERGLIGIYHDWCEGFSTYPRTYDLMHANGVFSL  560

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D      +C+  D+++E+DR+LRPEG+V+ RD  +V+++  +IA  +RW T + + E 
Sbjct  561  YQD------KCSFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIAGGMRWDTKMNDHED  614

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K++W
Sbjct  615  GPLVPEKILVAVKQYW  630



>ref|XP_004145886.1| PREDICTED: probable methyltransferase PMT18-like [Cucumis sativus]
 gb|KGN49950.1| hypothetical protein Csa_5G146240 [Cucumis sativus]
Length=636

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  PVWVMNVVPA+    TL VIY+RGLIG Y DWCE FSTYPRTYDLIH   I S
Sbjct  494  AAALVKFPVWVMNVVPANSDRDTLGVIYERGLIGTYQDWCEAFSTYPRTYDLIHANGIFS  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+V+ RD+ EV+ + + I+  ++W + I + E
Sbjct  554  IYQD------RCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTISDGMKWKSQIMDHE  607

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G    EKILVA K +W   +   
Sbjct  608  TGPFNPEKILVAVKTYWTGETNQQ  631



>ref|XP_009114343.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=624

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL V+++RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  476  AAALESSESWVMNVVPTIAKNTLSVVFERGLIGIYHDWCEGFSTYPRTYDLIHANNVFSL  535

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             ++      RCN+ D+++E+DR+LRPEG+V+ RD  +V++   +IA  +RW T + + E 
Sbjct  536  YQN------RCNVEDILLEMDRILRPEGTVLFRDEVDVLNDVRKIAKGMRWDTKLMDHED  589

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K++W
Sbjct  590  GPLVPEKILVAVKQYW  605



>ref|XP_006600888.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Glycine 
max]
 ref|XP_006600889.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Glycine 
max]
 gb|KHN01668.1| Putative methyltransferase PMT14 [Glycine soja]
Length=613

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AA + S   WVMNVVP     TL V+Y+RGLIG+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  472  AAVLESQKSWVMNVVPTIAENTLGVVYERGLIGIYHDWCEGFSTYPRTYDLIHANGLFSL  531

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
             +D      +CNL D+++E+DR+LRPEG+++IRD  +V+++ ++I   +RW   + + E 
Sbjct  532  YQD------KCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKIVRGMRWEAKLVDHED  585

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K +W
Sbjct  586  GPLVPEKILVAVKVYW  601



>gb|KDO76804.1| hypothetical protein CISIN_1g006834mg [Citrus sinensis]
Length=629

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 7/141 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAH-KPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMNVVP H  P TL  IY+RGLIG Y DWCE FSTYPRTYDLIH + + S
Sbjct  494  AAAMSKYPVWVMNVVPFHSNPDTLGAIYERGLIGTYQDWCEAFSTYPRTYDLIHASGVFS  553

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++ ++++E+DR+LRPEG+V+ RD+ E++ +   I   +RW + I + E
Sbjct  554  IYQD------RCDITNILLEMDRILRPEGTVIFRDTVEMLVKIRSITEGMRWKSQIMDHE  607

Query  272  PGANGREKILVATKKHWNLSS  210
             G    EKIL A K +W  +S
Sbjct  608  SGPFNPEKILFAAKTYWTGAS  628



>gb|EYU33422.1| hypothetical protein MIMGU_mgv1a002913mg [Erythranthe guttata]
Length=626

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 95/144 (66%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHK-PLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+   PVWVMNVVPA+  P TL VIY+RG IG Y DWCE FSTYPRTYDLIH   + S
Sbjct  488  AAALSKYPVWVMNVVPANSDPDTLGVIYERGFIGAYQDWCEAFSTYPRTYDLIHAGGVFS  547

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +D      RC++  +++E+DR+LRPEG+V+ RD  EV+ + + I   +RW + I + E
Sbjct  548  IYQD------RCDITYILLEMDRILRPEGTVIFRDVVEVLVKIKSITDGMRWESKIVDHE  601

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G    EKIL+ATK +W   S   
Sbjct  602  SGPFNVEKILLATKTYWTAESNPQ  625



>ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33582.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 6/136 (4%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIESL  450
            AAA+ S   WVMNVVP     TL VIY+RGL+G+YHDWCE FSTYPRTYDLIH   + SL
Sbjct  471  AAALESPKSWVMNVVPTAAQNTLGVIYERGLVGIYHDWCEGFSTYPRTYDLIHADGVFSL  530

Query  449  TKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKEP  270
                   +  C L D+++E+DR+LRPEGSV+ RD  +V++  +RIA  +RW T + + E 
Sbjct  531  Y------QKICKLEDILLEMDRILRPEGSVIFRDEVDVLNEVKRIAGGMRWDTKMMDHED  584

Query  269  GANGREKILVATKKHW  222
            G    EKILVA K++W
Sbjct  585  GPLVPEKILVAVKQYW  600



>ref|XP_010091504.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB44674.1| putative methyltransferase PMT2 [Morus notabilis]
Length=613

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 95/137 (69%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNV+P   +  TL V+Y+RGLIGVYHDWCE FSTYPRTYDLIH   + S
Sbjct  472  AAALESPKLWVMNVMPTIAEKDTLGVVYERGLIGVYHDWCEAFSTYPRTYDLIHANGVFS  531

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +C+ VD+++E+DR+LRPEG+V+ RD  +V+ R  RI   +RW T I + E
Sbjct  532  LYKD------KCDPVDILLEMDRILRPEGAVIFRDQEDVLIRVRRIVRGMRWNTKIVDHE  585

Query  272  PGANGREKILVATKKHW  222
             G    EK+L A KK+W
Sbjct  586  DGPLVPEKVLFAVKKYW  602



>ref|XP_009405339.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=614

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  P+WVMNVVPA     TL VIY+RG IG YHDWCE FSTYPRTYDLIH   + S
Sbjct  476  AAALVKYPLWVMNVVPADPARDTLGVIYERGFIGTYHDWCEAFSTYPRTYDLIHADGVFS  535

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +       RC++ D+++E+DR+LRPEG+V++RD+ +V+ + + I   +RW + + + E
Sbjct  536  IYQ------HRCDISDILLELDRILRPEGTVILRDTMDVLAKVQSITQRMRWKSQVMDHE  589

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G+   EKILVA K +W    T  
Sbjct  590  SGSFNPEKILVAVKTYWTAQLTQQ  613



>gb|AAL86466.1|AC077693_5 hypothetical protein [Oryza sativa Japonica Group]
Length=686

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 8/137 (6%)
 Frame = -1

Query  626  AAIISDPV-WVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAII  P+ WVMNVVP   +  TL +IY+RGLIG+YHDWCE FSTYPRTYDLIH   + S
Sbjct  547  AAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPRTYDLIHANGLFS  606

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L ++      +CN+ D+++E+DR+LRPEG+V++RD+ EV+++  R    +RW + + + E
Sbjct  607  LYQN------KCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKSKLLDHE  660

Query  272  PGANGREKILVATKKHW  222
             G +  EKILV+ KK+W
Sbjct  661  DGPHIPEKILVSVKKYW  677



>ref|XP_009405306.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405314.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405323.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405331.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  P+WVMNVVPA     TL VIY+RG IG YHDWCE FSTYPRTYDLIH   + S
Sbjct  478  AAALVKYPLWVMNVVPADPARDTLGVIYERGFIGTYHDWCEAFSTYPRTYDLIHADGVFS  537

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            + +       RC++ D+++E+DR+LRPEG+V++RD+ +V+ + + I   +RW + + + E
Sbjct  538  IYQ------HRCDISDILLELDRILRPEGTVILRDTMDVLAKVQSITQRMRWKSQVMDHE  591

Query  272  PGANGREKILVATKKHWNLSSTSH  201
             G+   EKILVA K +W    T  
Sbjct  592  SGSFNPEKILVAVKTYWTAQLTQQ  615



>ref|XP_006364604.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=616

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 94/137 (69%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA+ S  +WVMNVVP   +  TL VIYDRGLIG+YHDWCE FSTYPRTYD IH   I S
Sbjct  475  AAALESSKLWVMNVVPTIAERDTLAVIYDRGLIGIYHDWCEAFSTYPRTYDFIHANGIFS  534

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L KD      +CN  D+++E+DR+LRPEG+V+ RD  +++ R +RI   +RW T + + E
Sbjct  535  LYKD------KCNTEDILLEMDRILRPEGAVIFRDDADILGRVKRIVSGMRWKTKMVDHE  588

Query  272  PGANGREKILVATKKHW  222
             G    +K+L A K++W
Sbjct  589  DGPLISKKVLFAVKRYW  605



>gb|EAZ09099.1| hypothetical protein OsI_31366 [Oryza sativa Indica Group]
Length=616

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 97/137 (71%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPA-HKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAAI S   WVMNVVP   K  TL  IY+RGLIG+YHDWCE FSTYPRTYDLIH + + +
Sbjct  475  AAAIESPKSWVMNVVPTISKMSTLGAIYERGLIGIYHDWCEAFSTYPRTYDLIHASGLFT  534

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
            L K+      +CN+ D+++E+DR+LRPEG+V++RD  +++ +  R+A  ++W T + + E
Sbjct  535  LYKN------KCNMEDILLEMDRVLRPEGAVIMRDDVDILTKVNRLALGMKWNTRLVDHE  588

Query  272  PGANGREKILVATKKHW  222
             G   REK+L A K++W
Sbjct  589  DGPMVREKVLYAVKQYW  605



>ref|XP_004964271.1| PREDICTED: probable methyltransferase PMT17-like isoform X1 [Setaria 
italica]
 ref|XP_004964272.1| PREDICTED: probable methyltransferase PMT17-like isoform X2 [Setaria 
italica]
Length=620

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 95/137 (69%), Gaps = 7/137 (5%)
 Frame = -1

Query  629  AAAIISDPVWVMNVVPAHKPL-TLDVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVAAIES  453
            AAA++  P+WVMNVVP+  P  TL VIY+RG IG Y DWCE FSTYPRTYDLIH   + S
Sbjct  482  AAALMKYPLWVMNVVPSGSPRDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHADNVFS  541

Query  452  LTKDPSSGKSRCNLVDLMVEIDRMLRPEGSVVIRDSPEVIDRTERIAHAVRWTTSIYEKE  273
              +D      RC++  +++E+DR+LRPEG+V+IRD+ EV+ + + IA  +RW + I + E
Sbjct  542  SYQD------RCDITYILLEMDRILRPEGTVIIRDTVEVLGKVQAIAEGMRWKSQIMDHE  595

Query  272  PGANGREKILVATKKHW  222
             G    EKILVA K +W
Sbjct  596  SGPFNPEKILVAVKTYW  612



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250