BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035G01

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009760710.1|  PREDICTED: wound-induced protein 1-like            218   5e-68   Nicotiana sylvestris
ref|XP_010322279.1|  PREDICTED: wound-induced protein 1                 218   1e-67   
emb|CDP13948.1|  unnamed protein product                                219   6e-67   Coffea canephora [robusta coffee]
ref|XP_010109774.1|  hypothetical protein L484_000803                   206   1e-62   
gb|KJB67460.1|  hypothetical protein B456_010G193000                    206   5e-62   Gossypium raimondii
ref|XP_011015943.1|  PREDICTED: uncharacterized protein LOC105119493    203   3e-61   Populus euphratica
ref|XP_007008830.1|  Senescence associated gene 20, putative            204   4e-61   
gb|KJB74416.1|  hypothetical protein B456_011G293200                    202   7e-61   Gossypium raimondii
ref|XP_004160733.1|  PREDICTED: wound-induced protein 1-like            202   9e-61   
ref|XP_002520818.1|  conserved hypothetical protein                     199   5e-60   
ref|XP_011084854.1|  PREDICTED: uncharacterized protein LOC105167...    199   5e-60   Sesamum indicum [beniseed]
ref|XP_007219274.1|  hypothetical protein PRUPE_ppa018399mg             199   5e-60   
gb|KDO44857.1|  hypothetical protein CISIN_1g041268mg                   193   3e-57   Citrus sinensis [apfelsine]
ref|XP_006435847.1|  hypothetical protein CICLE_v10033519mg             193   3e-57   
ref|XP_002520817.1|  conserved hypothetical protein                     191   1e-56   
gb|KCW50407.1|  hypothetical protein EUGRSUZ_J00155                     190   2e-56   Eucalyptus grandis [rose gum]
ref|XP_006591397.1|  PREDICTED: wound-induced protein 1-like            189   2e-56   
ref|XP_004500579.1|  PREDICTED: wound-induced protein 1-like            189   7e-56   
ref|XP_003552827.1|  PREDICTED: wound-induced protein 1-like            187   2e-55   
gb|AGV54254.1|  wound-induced protein 1-like protein                    187   2e-55   Phaseolus vulgaris [French bean]
ref|XP_006300021.1|  hypothetical protein CARUB_v10016246mg             185   5e-55   
ref|XP_006407482.1|  hypothetical protein EUTSA_v10022397mg             182   8e-54   
ref|XP_003601011.1|  Wound-induced protein                              182   4e-53   
gb|KJB78751.1|  hypothetical protein B456_013G015900                    181   5e-53   Gossypium raimondii
ref|XP_010264763.1|  PREDICTED: uncharacterized protein LOC104602680    181   1e-51   Nelumbo nucifera [Indian lotus]
gb|EPS71424.1|  hypothetical protein M569_03336                         177   1e-51   Genlisea aurea
ref|XP_010257123.1|  PREDICTED: uncharacterized protein LOC104597350    179   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010650844.1|  PREDICTED: uncharacterized protein LOC100257036    175   3e-50   
emb|CDY00985.1|  BnaC05g42150D                                          173   4e-50   
emb|CBI25404.3|  unnamed protein product                                181   2e-49   Vitis vinifera
emb|CDY08559.1|  BnaA05g27950D                                          171   6e-49   Brassica napus [oilseed rape]
gb|AAF01523.1|AC009991_19  unknown protein                              176   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017022.1|  Senescence associated gene 20, putative            169   1e-47   
ref|XP_007207922.1|  hypothetical protein PRUPE_ppa018618mg             164   1e-46   
ref|XP_008236282.1|  PREDICTED: wound-induced protein 1                 163   2e-46   Prunus mume [ume]
ref|XP_009358318.1|  PREDICTED: wound-induced protein 1-like            161   6e-46   Pyrus x bretschneideri [bai li]
ref|XP_008356134.1|  PREDICTED: wound-induced protein 1-like            160   2e-45   
ref|XP_010271741.1|  PREDICTED: wound-induced protein 1-like            161   2e-45   Nelumbo nucifera [Indian lotus]
gb|KDO49276.1|  hypothetical protein CISIN_1g037228mg                   161   2e-45   Citrus sinensis [apfelsine]
ref|XP_011461439.1|  PREDICTED: wound-induced protein 1-like            162   2e-45   Fragaria vesca subsp. vesca
ref|XP_009785319.1|  PREDICTED: wound-induced protein 1                 151   1e-42   Nicotiana sylvestris
ref|XP_009421442.1|  PREDICTED: uncharacterized protein LOC104001000    154   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828191.1|  hypothetical protein AMTR_s00023p00142590          150   2e-41   
ref|XP_009614292.1|  PREDICTED: wound-induced protein 1                 148   3e-41   Nicotiana tomentosiformis
ref|XP_008369539.1|  PREDICTED: wound-induced protein 1-like            147   3e-40   
ref|XP_006468253.1|  PREDICTED: uncharacterized protein LOC102614777    151   7e-40   
ref|XP_006656972.1|  PREDICTED: wound-induced protein 1-like            147   1e-39   
sp|P20144.1|WUN1_SOLTU  RecName: Full=Wound-induced protein 1           142   4e-39   Solanum tuberosum [potatoes]
ref|XP_002325665.2|  hypothetical protein POPTR_0019s14670g             144   7e-39   
dbj|BAB13711.1|  elicitor inducible protein                             142   7e-39   Nicotiana tabacum [American tobacco]
ref|XP_008457302.1|  PREDICTED: wound-induced protein 1-like            144   8e-39   
ref|XP_006353404.1|  PREDICTED: wound-induced protein 1-like            140   3e-38   Solanum tuberosum [potatoes]
gb|KDP21696.1|  hypothetical protein JCGZ_03367                         140   4e-38   Jatropha curcas
ref|XP_004987041.1|  PREDICTED: uncharacterized protein LOC101779217    144   2e-37   
ref|XP_011076629.1|  PREDICTED: wound-induced protein 1                 138   3e-37   Sesamum indicum [beniseed]
ref|NP_001049849.1|  Os03g0299600                                       141   5e-37   
ref|XP_002312192.1|  wound-responsive family protein                    137   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006651290.1|  PREDICTED: uncharacterized protein LOC102719942    142   9e-37   
ref|XP_003561721.1|  PREDICTED: uncharacterized protein LOC100834985    138   8e-36   
ref|XP_011006090.1|  PREDICTED: wound-induced protein 1-like            134   1e-35   Populus euphratica
ref|XP_010558057.1|  PREDICTED: wound-induced protein 1-like            134   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_009407116.1|  PREDICTED: uncharacterized protein LOC103989899    136   3e-35   
ref|XP_010031140.1|  PREDICTED: wound-induced protein 1-like            132   4e-35   Eucalyptus grandis [rose gum]
ref|XP_006376550.1|  hypothetical protein POPTR_0013s14990g             133   6e-35   
ref|XP_004138405.1|  PREDICTED: wound-induced protein 1-like            132   6e-35   Cucumis sativus [cucumbers]
ref|XP_008456749.1|  PREDICTED: wound-induced protein 1                 132   7e-35   Cucumis melo [Oriental melon]
ref|XP_004307702.1|  PREDICTED: wound-induced protein 1                 131   9e-35   Fragaria vesca subsp. vesca
ref|XP_004240897.1|  PREDICTED: wound-induced protein 1-like            131   1e-34   
gb|KDP22807.1|  hypothetical protein JCGZ_00394                         132   2e-34   Jatropha curcas
ref|XP_010543692.1|  PREDICTED: wound-induced protein 1                 130   2e-34   Tarenaya hassleriana [spider flower]
dbj|BAJ98748.1|  predicted protein                                      132   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002882707.1|  hypothetical protein ARALYDRAFT_897298             130   3e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_009402774.1|  PREDICTED: uncharacterized protein LOC103986478    132   6e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002323036.2|  hypothetical protein POPTR_0016s13720g             130   8e-34   Populus trichocarpa [western balsam poplar]
ref|XP_009385278.1|  PREDICTED: uncharacterized protein LOC103972661    132   8e-34   
gb|AFW77785.1|  hypothetical protein ZEAMMB73_323824                    131   1e-33   
ref|XP_010464791.1|  PREDICTED: wound-induced protein 1-like            127   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008650816.1|  PREDICTED: uncharacterized protein LOC100191...    130   5e-33   Zea mays [maize]
ref|XP_010489944.1|  PREDICTED: wound-induced protein 1-like            127   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010094677.1|  hypothetical protein L484_003306                   134   1e-32   
gb|AFV36703.1|  wound-inducible protein 12                              126   1e-32   Glycine max [soybeans]
ref|XP_007163595.1|  hypothetical protein PHAVU_001G247700g             126   1e-32   Phaseolus vulgaris [French bean]
ref|XP_011032575.1|  PREDICTED: wound-induced protein 1-like            127   1e-32   Populus euphratica
ref|XP_006486226.1|  PREDICTED: wound-induced protein 1-like            126   1e-32   Citrus sinensis [apfelsine]
ref|XP_010658205.1|  PREDICTED: wound-induced protein 1                 125   2e-32   Vitis vinifera
ref|XP_007142081.1|  hypothetical protein PHAVU_008G251000g             127   5e-32   Phaseolus vulgaris [French bean]
ref|XP_008369311.1|  PREDICTED: wound-induced protein 1-like            124   6e-32   Malus domestica [apple tree]
tpg|DAA44925.1|  TPA: hypothetical protein ZEAMMB73_311719              128   7e-32   
gb|ADJ67179.1|  hypothetical protein                                    123   1e-31   Jatropha curcas
ref|XP_003559751.1|  PREDICTED: uncharacterized protein LOC100839760    126   2e-31   Brachypodium distachyon [annual false brome]
ref|XP_002468012.1|  hypothetical protein SORBIDRAFT_01g038035          126   2e-31   
ref|XP_011032574.1|  PREDICTED: wound-induced protein 1-like            123   4e-31   Populus euphratica
gb|ACJ85651.1|  unknown                                                 122   4e-31   Medicago truncatula
ref|XP_010256988.1|  PREDICTED: wound-induced protein 1                 123   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_008809984.1|  PREDICTED: wound-induced protein 1-like            121   6e-31   Phoenix dactylifera
ref|NP_001131159.1|  uncharacterized protein LOC100192467               124   7e-31   Zea mays [maize]
ref|XP_003544323.2|  PREDICTED: uncharacterized protein LOC100792027    122   8e-31   
ref|XP_008370220.1|  PREDICTED: wound-induced protein 1-like            122   8e-31   Malus domestica [apple tree]
gb|AAD23999.1|AF117224_1  wound-induced protein WI12                    121   1e-30   Mesembryanthemum crystallinum
emb|CDX73898.1|  BnaA03g31490D                                          120   1e-30   
gb|KFK38485.1|  hypothetical protein AALP_AA3G119100                    120   2e-30   Arabis alpina [alpine rockcress]
ref|XP_010921069.1|  PREDICTED: wound-induced protein 1-like            120   2e-30   Elaeis guineensis
ref|XP_002323037.1|  hypothetical protein POPTR_0016s13730g             121   2e-30   
ref|XP_009392731.1|  PREDICTED: wound-induced protein 1-like            120   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_974279.1|  senescence associated protein 20                      120   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003615958.1|  Wound-induced protein                              120   4e-30   Medicago truncatula
ref|XP_009369237.1|  PREDICTED: wound-induced protein 1                 120   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_008374432.1|  PREDICTED: wound-induced protein 1-like            119   9e-30   
ref|XP_007134612.1|  hypothetical protein PHAVU_010G061500g             120   9e-30   Phaseolus vulgaris [French bean]
ref|XP_010938273.1|  PREDICTED: wound-induced protein 1                 120   9e-30   Elaeis guineensis
ref|XP_010067573.1|  PREDICTED: wound-induced protein 1-like            118   1e-29   Eucalyptus grandis [rose gum]
ref|XP_008809983.1|  PREDICTED: LOW QUALITY PROTEIN: wound-induce...    119   1e-29   
ref|XP_009135140.1|  PREDICTED: wound-induced protein 1-like            116   4e-29   Brassica rapa
emb|CDY00710.1|  BnaC03g36940D                                          116   7e-29   
ref|XP_010695470.1|  PREDICTED: wound-induced protein 1                 116   8e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009122489.1|  PREDICTED: wound-induced protein 1-like            115   2e-28   Brassica rapa
ref|XP_004490683.1|  PREDICTED: uncharacterized protein LOC101505732    116   2e-28   Cicer arietinum [garbanzo]
ref|XP_009416311.1|  PREDICTED: wound-induced protein 1-like            115   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522016.2|  PREDICTED: wound-induced protein 1-like            116   4e-28   Glycine max [soybeans]
ref|XP_009146785.1|  PREDICTED: wound-induced protein 1                 114   4e-28   Brassica rapa
ref|XP_007206125.1|  hypothetical protein PRUPE_ppa013113mg             115   4e-28   Prunus persica
ref|XP_008464249.1|  PREDICTED: wound-induced protein 1                 115   5e-28   Cucumis melo [Oriental melon]
ref|XP_010039519.1|  PREDICTED: wound-induced protein 1-like            115   5e-28   Eucalyptus grandis [rose gum]
ref|XP_006359800.1|  PREDICTED: wound-induced protein 1-like            115   5e-28   Solanum tuberosum [potatoes]
ref|XP_003632589.1|  PREDICTED: wound-induced protein 1                 115   5e-28   Vitis vinifera
ref|XP_008244813.1|  PREDICTED: wound-induced protein 1-like            114   8e-28   Prunus mume [ume]
ref|XP_006828190.1|  hypothetical protein AMTR_s00023p00141210          114   8e-28   Amborella trichopoda
gb|KCW88252.1|  hypothetical protein EUGRSUZ_A00639                     114   9e-28   Eucalyptus grandis [rose gum]
gb|KJB17136.1|  hypothetical protein B456_002G267300                    114   1e-27   Gossypium raimondii
ref|XP_008782589.1|  PREDICTED: wound-induced protein 1-like            112   1e-27   Phoenix dactylifera
ref|XP_004492524.1|  PREDICTED: wound-induced protein 1-like            114   1e-27   Cicer arietinum [garbanzo]
ref|XP_008388310.1|  PREDICTED: wound-induced protein 1-like            113   2e-27   
ref|XP_003552291.1|  PREDICTED: wound-induced protein 1-like            113   2e-27   Glycine max [soybeans]
ref|XP_006602069.1|  PREDICTED: uncharacterized protein LOC102664858    114   2e-27   Glycine max [soybeans]
gb|KHN40672.1|  Wound-induced protein 1                                 113   3e-27   Glycine soja [wild soybean]
ref|XP_010039617.1|  PREDICTED: wound-induced protein 1-like            113   4e-27   Eucalyptus grandis [rose gum]
ref|XP_004149930.1|  PREDICTED: wound-induced protein 1-like            113   5e-27   Cucumis sativus [cucumbers]
ref|XP_003623507.1|  Wound-induced protein                              112   5e-27   Medicago truncatula
ref|XP_003623517.1|  Wound-induced protein                              112   5e-27   Medicago truncatula
ref|XP_003623505.1|  Wound-induced protein                              112   5e-27   Medicago truncatula
ref|XP_002872998.1|  hypothetical protein ARALYDRAFT_486893             112   7e-27   
ref|XP_003623511.1|  Wound-induced protein                              112   7e-27   Medicago truncatula
ref|XP_006591719.1|  PREDICTED: uncharacterized protein LOC102660194    112   8e-27   
ref|XP_002440895.1|  hypothetical protein SORBIDRAFT_09g015680          114   9e-27   Sorghum bicolor [broomcorn]
ref|XP_010937969.1|  PREDICTED: wound-induced protein 1-like            110   1e-26   Elaeis guineensis
ref|XP_010423988.1|  PREDICTED: wound-induced protein 1-like            111   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009125397.1|  PREDICTED: wound-induced protein 1                 111   2e-26   Brassica rapa
ref|XP_009343484.1|  PREDICTED: uncharacterized protein LOC103935438    110   2e-26   Pyrus x bretschneideri [bai li]
ref|NP_195794.1|  Nuclear transport factor 2 (NTF2) family protein      110   5e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04831.1|  BnaAnng00130D                                          110   6e-26   
ref|XP_003533675.1|  PREDICTED: wound-induced protein 1-like            109   6e-26   Glycine max [soybeans]
ref|XP_002533790.1|  Wound-induced protein, putative                    109   7e-26   
ref|XP_006398586.1|  hypothetical protein EUTSA_v10014882mg             109   1e-25   Eutrema salsugineum [saltwater cress]
gb|EPS73020.1|  hypothetical protein M569_01735                         108   1e-25   Genlisea aurea
ref|XP_011095092.1|  PREDICTED: wound-induced protein 1                 108   2e-25   Sesamum indicum [beniseed]
gb|KHN29546.1|  Wound-induced protein 1                                 107   3e-25   Glycine soja [wild soybean]
ref|XP_003623509.1|  Wound-induced protein                              107   3e-25   Medicago truncatula
gb|EAY97598.1|  hypothetical protein OsI_19523                          110   4e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_011466429.1|  PREDICTED: wound-induced protein 1                 106   6e-25   Fragaria vesca subsp. vesca
ref|XP_009630043.1|  PREDICTED: wound-induced protein 1                 107   7e-25   Nicotiana tomentosiformis
ref|XP_009766409.1|  PREDICTED: wound-induced protein 1                 107   7e-25   Nicotiana sylvestris
emb|CDP06415.1|  unnamed protein product                                107   8e-25   Coffea canephora [robusta coffee]
gb|EYU41980.1|  hypothetical protein MIMGU_mgv1a015491mg                106   1e-24   Erythranthe guttata [common monkey flower]
gb|KFK24638.1|  hypothetical protein AALP_AA8G005600                    105   4e-24   Arabis alpina [alpine rockcress]
ref|XP_006429518.1|  hypothetical protein CICLE_v10012959mg             105   4e-24   Citrus clementina [clementine]
ref|XP_007146843.1|  hypothetical protein PHAVU_006G074700g             105   4e-24   Phaseolus vulgaris [French bean]
gb|KDO63300.1|  hypothetical protein CISIN_1g031351mg                   105   4e-24   Citrus sinensis [apfelsine]
ref|XP_010102619.1|  hypothetical protein L484_001345                   105   4e-24   Morus notabilis
ref|XP_008236386.1|  PREDICTED: wound-induced protein 1-like            104   5e-24   Prunus mume [ume]
ref|XP_010039423.1|  PREDICTED: wound-induced protein 1-like            104   5e-24   Eucalyptus grandis [rose gum]
ref|XP_004296041.1|  PREDICTED: wound-induced protein 1-like            105   6e-24   Fragaria vesca subsp. vesca
ref|XP_010683577.1|  PREDICTED: wound-induced protein 1                 104   6e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006288836.1|  hypothetical protein CARUB_v10002178mg             104   6e-24   Capsella rubella
ref|XP_007206573.1|  hypothetical protein PRUPE_ppa020160mg             103   8e-24   
gb|EMS56136.1|  hypothetical protein TRIUR3_05350                       103   2e-23   Triticum urartu
ref|XP_004246826.1|  PREDICTED: wound-induced protein 1                 103   2e-23   Solanum lycopersicum
ref|XP_009404669.1|  PREDICTED: wound-induced protein 1-like            101   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010490513.1|  PREDICTED: wound-induced protein 1-like            102   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_003537326.1|  PREDICTED: wound-induced protein 1-like            100   2e-22   Glycine max [soybeans]
gb|KHN33242.1|  Wound-induced protein 1                               99.8    2e-22   Glycine soja [wild soybean]
ref|XP_011077499.1|  PREDICTED: wound-induced protein 1-like          99.0    5e-22   Sesamum indicum [beniseed]
ref|XP_003599291.1|  Wound-induced protein                            99.4    6e-22   Medicago truncatula
gb|KHN22779.1|  Wound-induced protein 1                               99.4    6e-22   Glycine soja [wild soybean]
ref|XP_003552928.1|  PREDICTED: wound-induced protein 1-like          99.4    7e-22   
gb|KCW88253.1|  hypothetical protein EUGRSUZ_A00640                   98.2    8e-22   Eucalyptus grandis [rose gum]
gb|KHN22780.1|  Wound-induced protein 1                               98.2    2e-21   Glycine soja [wild soybean]
ref|XP_002960457.1|  hypothetical protein SELMODRAFT_73443            96.3    7e-21   Selaginella moellendorffii
ref|XP_011021438.1|  PREDICTED: wound-induced protein 1-like          95.1    7e-21   Populus euphratica
ref|XP_004958783.1|  PREDICTED: wound-induced protein 1-like          94.4    1e-20   
gb|EMT30757.1|  hypothetical protein F775_02215                       95.1    2e-20   
ref|XP_008649565.1|  PREDICTED: wound-induced protein 1-like          93.6    2e-20   
ref|XP_004500329.1|  PREDICTED: wound-induced protein 1-like          94.0    6e-20   Cicer arietinum [garbanzo]
gb|ABF95470.1|  Wound-induced protein 1, putative, expressed          89.7    8e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AFM95222.1|  senescence-associated protein 20                      89.4    9e-19   Cynara cardunculus var. scolymus [artichoke]
gb|EMT05243.1|  hypothetical protein F775_04576                       89.7    1e-18   
ref|XP_010032950.1|  PREDICTED: uncharacterized protein LOC104422343  88.6    5e-18   Eucalyptus grandis [rose gum]
emb|CDP04078.1|  unnamed protein product                              82.0    4e-16   Coffea canephora [robusta coffee]
ref|XP_002465402.1|  hypothetical protein SORBIDRAFT_01g038030        82.4    5e-16   Sorghum bicolor [broomcorn]
gb|ACU16338.1|  unknown                                               82.4    6e-16   Glycine max [soybeans]
gb|EEE63316.1|  hypothetical protein OsJ_18127                        81.3    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174370.1|  Os05g0342100                                     81.3    3e-15   
gb|ACG48358.1|  wound-induced protein WI12 containing protein         78.2    7e-15   Zea mays [maize]
ref|NP_001130795.1|  uncharacterized protein LOC100191899             77.8    9e-15   Zea mays [maize]
emb|CBI18080.3|  unnamed protein product                              77.4    2e-14   Vitis vinifera
ref|XP_001783793.1|  predicted protein                                77.0    2e-14   
gb|KCW52457.1|  hypothetical protein EUGRSUZ_J01852                   76.6    6e-14   Eucalyptus grandis [rose gum]
ref|XP_002461263.1|  hypothetical protein SORBIDRAFT_02g043820        75.1    8e-14   
gb|KHN19132.1|  Wound-induced protein 1                               74.7    1e-13   Glycine soja [wild soybean]
gb|ACN85337.1|  unknown                                               75.9    7e-13   Oryza meyeriana var. granulata
ref|XP_010094676.1|  hypothetical protein L484_003305                 72.0    1e-12   
ref|XP_006658169.1|  PREDICTED: wound-induced protein 1-like          70.1    5e-12   
ref|XP_006378646.1|  hypothetical protein POPTR_0010s18940g           69.7    7e-12   
ref|XP_003570951.1|  PREDICTED: wound-induced protein 1-like          71.2    8e-12   
ref|XP_010032951.1|  PREDICTED: uncharacterized protein LOC104422344  69.3    2e-11   Eucalyptus grandis [rose gum]
gb|ACN31379.1|  unknown                                               67.8    6e-11   Zea mays [maize]
emb|CDY36286.1|  BnaA01g31320D                                        67.4    7e-11   Brassica napus [oilseed rape]
gb|KHN02123.1|  Wound-induced protein 1                               65.9    1e-10   Glycine soja [wild soybean]
gb|AFG55123.1|  hypothetical protein 0_16615_01                       64.3    3e-10   Pinus taeda
gb|AFG55125.1|  hypothetical protein 0_16615_01                       64.3    3e-10   Pinus taeda
ref|XP_007026530.1|  Uncharacterized protein TCM_021566               64.3    9e-10   
gb|AFG55126.1|  hypothetical protein 0_16615_01                       62.8    1e-09   Pinus taeda
ref|XP_001778855.1|  predicted protein                                62.0    4e-09   
ref|XP_010264764.1|  PREDICTED: uncharacterized protein LOC104602681  63.9    6e-09   
gb|AFG49700.1|  hypothetical protein 0_9318_01                        56.6    3e-07   Pinus taeda
gb|AFG49693.1|  hypothetical protein 0_9318_01                        56.2    4e-07   Pinus taeda
gb|AFG49703.1|  hypothetical protein 0_9318_01                        56.2    4e-07   Pinus taeda
ref|NP_001169134.1|  uncharacterized protein LOC100382979             56.6    6e-07   
ref|XP_001759839.1|  predicted protein                                55.8    9e-07   
gb|AFG49692.1|  hypothetical protein 0_9318_01                        53.9    3e-06   Pinus taeda
ref|XP_002984259.1|  hypothetical protein SELMODRAFT_423366           52.0    1e-04   
ref|WP_043458230.1|  hypothetical protein                             50.4    1e-04   
dbj|BAF95861.1|  hypothetical protein                                 48.9    1e-04   Vitis hybrid cultivar
ref|XP_002972428.1|  hypothetical protein SELMODRAFT_412807           51.2    2e-04   
emb|CDY72676.1|  BnaAnng42010D                                        48.9    3e-04   Brassica napus [oilseed rape]
ref|WP_028930094.1|  hypothetical protein                             47.8    0.001   Pseudonocardia asaccharolytica



>ref|XP_009760710.1| PREDICTED: wound-induced protein 1-like, partial [Nicotiana sylvestris]
Length=153

 Score =   218 bits (556),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            ET EET+NKRVV+AL EALSS DV  VQ L A+DLEWWFHGPPSHQFLM+ LTGTA   D
Sbjct  1    ETLEETQNKRVVVALYEALSSHDVVQVQNLLAADLEWWFHGPPSHQFLMQTLTGTAK--D  58

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            +F F P  +D  G  V VEG D +R+ITWVHAWTV DG+ITQVREYFNTSL VTRFG   
Sbjct  59   AFHFIPKSIDVFGSIVLVEGCDPTRSITWVHAWTVADGVITQVREYFNTSLIVTRFGK-K  117

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +   +ITPLHCPSVWESSL NRVGKSVPGLVLA+
Sbjct  118  TQSDFESITPLHCPSVWESSLANRVGKSVPGLVLAL  153



>ref|XP_010322279.1| PREDICTED: wound-induced protein 1 [Solanum lycopersicum]
Length=161

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD-  537
            T EET NK VVLAL EALSS DV  VQKL ASDLEWWFHGPPSHQFLM+ILTGTA   + 
Sbjct  7    TLEETTNKGVVLALYEALSSHDVVQVQKLLASDLEWWFHGPPSHQFLMQILTGTAKFDNA  66

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            SF+F    +D  G  V VEG D +R+ITWVHAWTVTDG+ITQVREYFNTSLTVTRF    
Sbjct  67   SFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVITQVREYFNTSLTVTRF-RKK  125

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +  ++ITPLHCPSVWESSLPNRVGKSVPGLVLA+
Sbjct  126  NQSDISSITPLHCPSVWESSLPNRVGKSVPGLVLAL  161



>emb|CDP13948.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 129/158 (82%), Gaps = 3/158 (2%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            +T EET+NK +VLAL EALS+RDVD VQ+L A DLEWWFHGPPSHQFLMR+LTG  T  D
Sbjct  113  QTLEETQNKGLVLALYEALSARDVDKVQRLVAPDLEWWFHGPPSHQFLMRLLTGN-TDKD  171

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFG--N  363
            SF F P  V A G TV VEG D +RNITWVHAWTVTDGIITQVREYFNTSLTVTRFG  +
Sbjct  172  SFNFVPQSVAAFGSTVLVEGCDQARNITWVHAWTVTDGIITQVREYFNTSLTVTRFGAAD  231

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            + +S+  A IT LHCPSVWESSL ++VG SVPGLVLAI
Sbjct  232  NPSSSNFAQITSLHCPSVWESSLASQVGISVPGLVLAI  269



>ref|XP_010109774.1| hypothetical protein L484_000803 [Morus notabilis]
 gb|EXC24684.1| hypothetical protein L484_000803 [Morus notabilis]
Length=196

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 126/175 (72%), Gaps = 16/175 (9%)
 Frame = -2

Query  725  NIQETXEETR--NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT  552
            N QET EET   N+RVV AL EAL+SRDV+ VQ+L + DL+WWFHGPP HQFLMR+LTG 
Sbjct  22   NPQETLEETDFVNQRVVRALYEALNSRDVEKVQRLLSPDLDWWFHGPPPHQFLMRLLTGA  81

Query  551  A--TAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTV  378
                +  SFRF+P    + GPTV VEG D  R+I WVHAWTVTDGIITQVREYFNTSLTV
Sbjct  82   NPDDSSSSFRFDPQSFASFGPTVIVEGCDYDRSIAWVHAWTVTDGIITQVREYFNTSLTV  141

Query  377  TRFGNHsa------------saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TR G+ +             S++ A I   HCPSVWESSL NRVGKSVPGLVLAI
Sbjct  142  TRLGSSAKSSPSGFASSSNSSSSTAEIASYHCPSVWESSLSNRVGKSVPGLVLAI  196



>gb|KJB67460.1| hypothetical protein B456_010G193000 [Gossypium raimondii]
Length=230

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 127/177 (72%), Gaps = 19/177 (11%)
 Frame = -2

Query  725  NIQE--TXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT  552
            N QE    E  +N+ VVLAL EAL++RDV+ V K+ A DLEWWFHGPP+HQFLMR+LTG 
Sbjct  55   NTQEPLVEETNKNQEVVLALYEALNTRDVETVHKILAPDLEWWFHGPPTHQFLMRLLTG-  113

Query  551  ATAGDSFRFE--PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTV  378
            A++ DSF FE  PL V   GPTV VEG D SR+I+WVHAWTVTDGIITQVREY NTSLTV
Sbjct  114  ASSDDSFCFEVDPLSVTTFGPTVIVEGCDHSRSISWVHAWTVTDGIITQVREYLNTSLTV  173

Query  377  TRFGNHsasaaaa--------------AITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TR GN + S  +                IT +HCPSVWESS  NRVGKSVPGLVLAI
Sbjct  174  TRLGNSTQSPPSDYNPSSSSSSSSSTGEITSVHCPSVWESSFSNRVGKSVPGLVLAI  230



>ref|XP_011015943.1| PREDICTED: uncharacterized protein LOC105119493 [Populus euphratica]
Length=215

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 119/158 (75%), Gaps = 8/158 (5%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD-SFRFE  522
            +N+ VVLA  EAL SRDVD V K+ A+DLEWWFHGPPSHQF+MR+LTG     D  F F 
Sbjct  58   KNQDVVLAFYEALKSRDVDTVHKILANDLEWWFHGPPSHQFMMRLLTGEKKDNDVPFEFS  117

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsa----  354
            P+ + + G  V VEG + SR+I+WVHAWTVTDGIITQVREYFNTSLTVTR GN S     
Sbjct  118  PISITSFGNLVVVEGCNTSRSISWVHAWTVTDGIITQVREYFNTSLTVTRLGNQSQPSDF  177

Query  353  ---saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
               S++   I+ LHCPS+WES+L NRVGKSVPGLVLAI
Sbjct  178  KTNSSSTGEISLLHCPSIWESTLSNRVGKSVPGLVLAI  215



>ref|XP_007008830.1| Senescence associated gene 20, putative [Theobroma cacao]
 gb|EOY17640.1| Senescence associated gene 20, putative [Theobroma cacao]
Length=265

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 125/176 (71%), Gaps = 18/176 (10%)
 Frame = -2

Query  725  NIQET--XEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT  552
            N QE    E  +N+ VVLA  EAL +RDV+ V ++ A DLEWWFHGPP+HQF+MR+LTG 
Sbjct  91   NTQEKILEETNKNQEVVLAFYEALKTRDVETVHQILAPDLEWWFHGPPTHQFMMRLLTG-  149

Query  551  ATAGDSFRFE--PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTV  378
            A++ DSF FE  PL V   G TV VEG D SR+I+WVHAWTVTDGIITQVREYFNTSLTV
Sbjct  150  ASSDDSFHFEVDPLSVTTFGSTVIVEGCDHSRSISWVHAWTVTDGIITQVREYFNTSLTV  209

Query  377  TRFGNHsa-------------saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TR GN                 ++ A I P+HCPSVWESS  NRVGKSVPGLVLAI
Sbjct  210  TRLGNSHQSPPSPSSPSSPSAPSSTAEIAPVHCPSVWESSFSNRVGKSVPGLVLAI  265



>gb|KJB74416.1| hypothetical protein B456_011G293200 [Gossypium raimondii]
Length=211

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 128/163 (79%), Gaps = 7/163 (4%)
 Frame = -2

Query  719  QETXEET-RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA  543
            Q+  EET +N+ VVLAL EAL++RDV+ V ++ A DLEWWFHGPP+HQFLMR+LTG A++
Sbjct  50   QKIVEETNKNQAVVLALYEALNTRDVNTVHQILAPDLEWWFHGPPTHQFLMRLLTG-ASS  108

Query  542  GDSFRFE--PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF  369
             D FRFE  P+ V   G TV VEG D SR+I+WVHAWTV DG ITQVREYFNTSLTVTR 
Sbjct  109  DDPFRFEVDPVLVTTFGSTVIVEGCDNSRSISWVHAWTVRDGTITQVREYFNTSLTVTRL  168

Query  368  GN---HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            G+    + S++ A I P++CP VWESSL NRVGKSVPGLVLAI
Sbjct  169  GDSPPSACSSSTAEIAPVYCPYVWESSLSNRVGKSVPGLVLAI  211



>ref|XP_004160733.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus]
Length=227

 Score =   202 bits (514),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 125/163 (77%), Gaps = 10/163 (6%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E++ N+RVVLAL EALSSR+V+ V ++ A DLEWWFHGPPSHQFLMR+LTG ++ G SF+
Sbjct  65   EDSSNQRVVLALYEALSSRNVNTVHQILAPDLEWWFHGPPSHQFLMRLLTGASSNGQSFQ  124

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F P  + + G TV VEG D SR+I+W+HAWTVTDGIITQ+REYFNTSLTVTR G+ S   
Sbjct  125  FVPQSITSFGSTVLVEGCDPSRSISWIHAWTVTDGIITQLREYFNTSLTVTRVGDPSEYP  184

Query  347  aaaAITPL----------HCPSVWESSLPNRVGKSVPGLVLAI  249
            + ++ +            HCPSVWESS+ N+VGKSVPGLVLAI
Sbjct  185  STSSSSASSEISSAASLHHCPSVWESSVSNQVGKSVPGLVLAI  227



>ref|XP_002520818.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41527.1| conserved hypothetical protein [Ricinus communis]
Length=204

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 124/182 (68%), Gaps = 23/182 (13%)
 Frame = -2

Query  725  NIQETXEET----RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILT  558
            N QE  EE     +N+ VVL+L EAL SRDVD V K+ ASDLEWWFHGPPSHQF+MR+LT
Sbjct  23   NSQEILEEESSSRKNQEVVLSLYEALKSRDVDTVHKILASDLEWWFHGPPSHQFMMRLLT  82

Query  557  GTAT-----AGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            G  T     +  +F F P  +   G  V  EG D +R+I+WVHAWTVTDGIITQV+EYFN
Sbjct  83   GADTSLSKISKKTFEFNPEIIRVFGSIVIAEGCDSTRSISWVHAWTVTDGIITQVKEYFN  142

Query  392  TSLTVTRFGNHsa--------------saaaaAITPLHCPSVWESSLPNRVGKSVPGLVL  255
            TSLTVTR G+                 S++ A IT +HCPSVWESSL NRVGKSVPGLVL
Sbjct  143  TSLTVTRLGHRDQSEPSDSSPSSSSSSSSSTAEITSVHCPSVWESSLSNRVGKSVPGLVL  202

Query  254  AI  249
            AI
Sbjct  203  AI  204



>ref|XP_011084854.1| PREDICTED: uncharacterized protein LOC105167003 isoform X1 [Sesamum 
indicum]
 ref|XP_011084855.1| PREDICTED: uncharacterized protein LOC105167003 isoform X2 [Sesamum 
indicum]
 ref|XP_011084856.1| PREDICTED: uncharacterized protein LOC105167003 isoform X3 [Sesamum 
indicum]
Length=206

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            QE  E   N+ +V AL +AL+ RD   +Q++ A+DLEWWFHGPPSHQFLMR+LTG   + 
Sbjct  58   QEALEGDFNRGLVSALYDALNRRDAPAIQQILAADLEWWFHGPPSHQFLMRLLTGEQDS-  116

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNH  360
             SFRF P  + A GPTV  EG D SR+I WVHAWTVTDG+IT VREYFNTSLTVTRF N 
Sbjct  117  -SFRFLPHSISAFGPTVLAEGFDQSRSIAWVHAWTVTDGVITHVREYFNTSLTVTRFRN-  174

Query  359  sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                    IT  HCPSVWESSLP+RVGKSVPGLVLAI
Sbjct  175  -----TDGITSPHCPSVWESSLPDRVGKSVPGLVLAI  206



>ref|XP_007219274.1| hypothetical protein PRUPE_ppa018399mg, partial [Prunus persica]
 gb|EMJ20473.1| hypothetical protein PRUPE_ppa018399mg, partial [Prunus persica]
Length=186

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 127/177 (72%), Gaps = 20/177 (11%)
 Frame = -2

Query  725  NIQETXEET--RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT  552
            N QET E++   N+RVVLAL EALSSRDV  V ++ A D+EWWFHGPP+HQFLMR+LTG 
Sbjct  12   NSQETLEDSDSSNRRVVLALYEALSSRDVRTVHQIVAPDIEWWFHGPPTHQFLMRLLTGD  71

Query  551  ATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTR  372
                +SF+F P  +D  GPTV VEG D   +I+WVHAWTVT GI+TQVREYFNTSLTVTR
Sbjct  72   Q--NESFQFSPQSIDCFGPTVLVEGCDRDCSISWVHAWTVTHGIVTQVREYFNTSLTVTR  129

Query  371  FGNHs----------------asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             G ++                +S++ A IT  HCPSVWESS+ +RVGKSVPGLVLAI
Sbjct  130  LGKNTSPSSSAQSSPSSFSSKSSSSTAEITSFHCPSVWESSVSDRVGKSVPGLVLAI  186



>gb|KDO44857.1| hypothetical protein CISIN_1g041268mg, partial [Citrus sinensis]
Length=217

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 119/168 (71%), Gaps = 16/168 (10%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDS---  534
            E +N+RVVLAL +AL SRDV+ V K+ A DLEWWFHGPP+HQF+M +LTG+ TA  +   
Sbjct  50   ENKNQRVVLALYDALKSRDVETVHKILAPDLEWWFHGPPTHQFMMHLLTGSTTASSASQS  109

Query  533  -FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
             F F PL + + GP V  EG D SR I+WVHAWTV DGIITQVREYFNTSLTVTRFG   
Sbjct  110  SFVFVPLSITSFGPIVLAEGCDHSRQISWVHAWTVADGIITQVREYFNTSLTVTRFGKDL  169

Query  356  asaaa------------aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +  +             A I P+HCPSVWESS+ NR GKSVPGLVLA+
Sbjct  170  SGQSQRKKSPPSDFPSTAEINPVHCPSVWESSVSNRDGKSVPGLVLAL  217



>ref|XP_006435847.1| hypothetical protein CICLE_v10033519mg, partial [Citrus clementina]
 gb|ESR49087.1| hypothetical protein CICLE_v10033519mg, partial [Citrus clementina]
Length=217

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 119/168 (71%), Gaps = 16/168 (10%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDS---  534
            E +N+RVVLAL +AL SRDV+ V K+ A DLEWWFHGPP+HQF+M +LTG+ TA  +   
Sbjct  50   ENKNQRVVLALYDALKSRDVETVHKILAPDLEWWFHGPPTHQFMMHLLTGSTTASSASQS  109

Query  533  -FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
             F F PL + + GP V  EG D SR I+WVHAWTV DGIITQVREYFNTSLTVTRFG   
Sbjct  110  SFVFVPLSITSFGPIVLAEGCDHSRQISWVHAWTVADGIITQVREYFNTSLTVTRFGKDL  169

Query  356  asaaa------------aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +  +             A I P+HCPSVWESS+ NR GKSVPGLVLA+
Sbjct  170  SGQSQRKKSPPSDFPSTAEINPVHCPSVWESSVSNRDGKSVPGLVLAL  217



>ref|XP_002520817.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41526.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 124/186 (67%), Gaps = 27/186 (15%)
 Frame = -2

Query  725  NIQETXEET----RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILT  558
            N QE  EE     +N++VVLAL +AL SRDVD V K+ ASD+EWWFHGPPSHQF+MR+LT
Sbjct  23   NSQEILEEESSSRKNQQVVLALYDALKSRDVDTVHKILASDIEWWFHGPPSHQFMMRLLT  82

Query  557  GT--------ATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVRE  402
            G         +++  SF F P  +   G  V  EG D +R+I+WVHAWTVTDGIITQVRE
Sbjct  83   GADTSSFKKSSSSSTSFEFNPEIIRVFGSIVIAEGCDYTRSISWVHAWTVTDGIITQVRE  142

Query  401  YFNTSLTVTRFGNHsa---------------saaaaAITPLHCPSVWESSLPNRVGKSVP  267
            YFNTSLTVTR GN SA               S+ A  I   HCPSVWESS  NRVGKSVP
Sbjct  143  YFNTSLTVTRLGNQSAPSDYSSVASSSSSSSSSPATEIASAHCPSVWESSFSNRVGKSVP  202

Query  266  GLVLAI  249
            GLVLAI
Sbjct  203  GLVLAI  208



>gb|KCW50407.1| hypothetical protein EUGRSUZ_J00155, partial [Eucalyptus grandis]
Length=198

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E  N+ VV  L EAL  RD D V ++ A DLEWWFHGPPSHQFLMR+LTG A   D+F F
Sbjct  36   ELANRTVVHTLYEALRRRDCDAVHRILAPDLEWWFHGPPSHQFLMRLLTGAAEPDDTFLF  95

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNH-sas  351
             P+ V + GPTV  EG D +R+I WVHAWTV+ DGI+TQVREYFNTSLTVTRFG+   + 
Sbjct  96   VPVSVTSFGPTVLAEGSDPARSIFWVHAWTVSADGIVTQVREYFNTSLTVTRFGDSPPSD  155

Query  350  aaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI*P  243
             + A I PLHC S+WESS+ +R GKSVPGLVLAI P
Sbjct  156  PSTAEIAPLHCQSLWESSV-SRAGKSVPGLVLAILP  190



>ref|XP_006591397.1| PREDICTED: wound-induced protein 1-like, partial [Glycine max]
Length=174

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            ++ NKR+VLAL +AL+S D D V K+ A+DLEWWFHGPPSHQFLMR+LTG + A +SFRF
Sbjct  24   DSSNKRLVLALYDALNSGDSDAVVKIVAADLEWWFHGPPSHQFLMRMLTGDSAADNSFRF  83

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             P  + A G TV VEG D +RNI WVHA TVTDGIITQ+REYFNT+LTVTR  +      
Sbjct  84   LPQSIAAFGSTVIVEGCDTARNIAWVHACTVTDGIITQIREYFNTALTVTRIHDSGEIVP  143

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            A++      P VWESS+  RVGKSVPGLVLAI
Sbjct  144  ASS-GAGRLPCVWESSVSGRVGKSVPGLVLAI  174



>ref|XP_004500579.1| PREDICTED: wound-induced protein 1-like, partial [Cicer arietinum]
Length=208

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 115/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            ++ N+++VL L EAL+SRD D V  + ASDLEWWFHGPPSHQFLMR+LTG +TA D+FRF
Sbjct  54   DSSNQKLVLKLYEALNSRDSDTVVNILASDLEWWFHGPPSHQFLMRVLTGDSTADDTFRF  113

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             P  + + G T+ VEG D SR I+WVHA TV DGI+TQVREYFNTSLTVTRF +      
Sbjct  114  VPQSLVSFGSTIIVEGCDTSRAISWVHALTVADGIVTQVREYFNTSLTVTRFAD--VEKD  171

Query  344  aaAITPL-----HCPSVWESSLPNRVGKSVPGLVLAI  249
            +  I P        P VWESS+ +RVGKSVPGLVLAI
Sbjct  172  SGEIVPAAHNSGRFPCVWESSVSDRVGKSVPGLVLAI  208



>ref|XP_003552827.1| PREDICTED: wound-induced protein 1-like [Glycine max]
Length=179

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 114/157 (73%), Gaps = 11/157 (7%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            ++ N R+V+AL +AL+S D + V K+ A+DLEWWFHGPPSHQFLMR+LTG + A +SFRF
Sbjct  29   DSSNTRLVVALYDALNSGDSNAVVKIVAADLEWWFHGPPSHQFLMRMLTGDSAADNSFRF  88

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             P  + A G TV VEG D +RNI WVHAWTVTDG+ITQ+REYFNT+LTVTR  +      
Sbjct  89   VPQSIAAFGSTVIVEGCDSARNIAWVHAWTVTDGMITQIREYFNTALTVTRIHD------  142

Query  344  aaAITPLHC-----PSVWESSLPNRVGKSVPGLVLAI  249
            +  I P        P VWESS+  RVGKSVPGLVLAI
Sbjct  143  SGEIVPARSGAGRLPCVWESSVSGRVGKSVPGLVLAI  179



>gb|AGV54254.1| wound-induced protein 1-like protein [Phaseolus vulgaris]
Length=182

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 113/157 (72%), Gaps = 12/157 (8%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            ++ NKR+V+AL +AL S D   V K+ A+DLEWWFHGPPSHQFLMR+LTG +TA ++FRF
Sbjct  33   DSSNKRLVVALYDALRSGDSAAVVKILAADLEWWFHGPPSHQFLMRMLTGDSTA-ETFRF  91

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             P  V A G TV VEG D +RNI WVHAWTV DGIITQVREYFNT+LTVTRF +      
Sbjct  92   VPQSVAAFGSTVIVEGCDTARNIAWVHAWTVADGIITQVREYFNTALTVTRFEDS-----  146

Query  344  aaAITPLHC-----PSVWESSLPNRVGKSVPGLVLAI  249
               I P        P VWESS+  RVGKSVPGLVLAI
Sbjct  147  -GEIVPASSGAGRFPCVWESSVSGRVGKSVPGLVLAI  182



>ref|XP_006300021.1| hypothetical protein CARUB_v10016246mg, partial [Capsella rubella]
 gb|EOA32919.1| hypothetical protein CARUB_v10016246mg, partial [Capsella rubella]
Length=161

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +N+ VVL L EAL SRDVD V ++   DLE+WFHGPP HQFLMR+LTG  +   SF F
Sbjct  12   EIKNRDVVLKLYEALRSRDVDSVHQILTPDLEYWFHGPPPHQFLMRMLTGGVSP--SFEF  69

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             PL V + G TV  EG D + +++W+HAWTV +GIITQVREY NTSLTVTR GN  A   
Sbjct  70   VPLSVVSFGSTVIAEGCDAATSVSWIHAWTVANGIITQVREYSNTSLTVTRIGNVVAGRR  129

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +  I P HCPSVWES    R GKSVPGLVLAI
Sbjct  130  SPEIAPSHCPSVWESQFSGRAGKSVPGLVLAI  161



>ref|XP_006407482.1| hypothetical protein EUTSA_v10022397mg, partial [Eutrema salsugineum]
 gb|ESQ48935.1| hypothetical protein EUTSA_v10022397mg, partial [Eutrema salsugineum]
Length=155

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 109/152 (72%), Gaps = 4/152 (3%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            ET+N+ VVL L +AL SRDV+ V ++   DLE+WFHGPP HQFLMRILTG +     F F
Sbjct  8    ETKNRDVVLKLYDALRSRDVESVHRILTPDLEYWFHGPPPHQFLMRILTGVSPP---FEF  64

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             PL V + G TV  EG D + +I+W+HAWTV  GIITQVREY NTSLTVTR GN   +  
Sbjct  65   VPLSVVSFGSTVIAEGCDAASSISWIHAWTVAHGIITQVREYSNTSLTVTRIGN-VVAGR  123

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +A I P HCPSVWES L  R GKSVPGLVLAI
Sbjct  124  SAEIAPSHCPSVWESQLSGRAGKSVPGLVLAI  155



>ref|XP_003601011.1| Wound-induced protein [Medicago truncatula]
 gb|AES71262.1| wound-induced-like protein [Medicago truncatula]
Length=200

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 115/162 (71%), Gaps = 5/162 (3%)
 Frame = -2

Query  725  NIQETXEET--RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT  552
            N Q   E+T   N+++VL L ++L+SRD D V ++ A DLEWWFHGPPSHQFLMR LTG 
Sbjct  41   NSQVNTEDTDSSNQKLVLTLYDSLNSRDSDTVVRILAPDLEWWFHGPPSHQFLMRTLTGD  100

Query  551  ATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTR  372
             TA D+FRF P  V + G TV VEG D SR I+WVHA TV DGI+TQVREYFNTSLTVT 
Sbjct  101  TTAVDTFRFVPQSVISFGSTVIVEGCDTSRAISWVHALTVVDGIVTQVREYFNTSLTVTH  160

Query  371  F-GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            F G  S     A     HC  VWESS+ +RVGKSVPGLVLAI
Sbjct  161  FAGKDSGEIVPANPGGFHC--VWESSVSDRVGKSVPGLVLAI  200



>gb|KJB78751.1| hypothetical protein B456_013G015900 [Gossypium raimondii]
Length=198

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 122/176 (69%), Gaps = 24/176 (14%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E  +N++VVL L EA+++RDV  V ++ A DLEWWFHGPP+HQF+MR+LTG A++  +F 
Sbjct  24   ETNKNQQVVLVLYEAINTRDVQTVHQILAPDLEWWFHGPPAHQFMMRLLTG-ASSDQTFI  82

Query  527  FE--PLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGNHs  357
            F+  PL V   G TV VEG D  R+I+WVHAWTV TDGIIT+VREYFNTSLTVTR  N S
Sbjct  83   FDVDPLSVTTFGSTVIVEGCDHKRSISWVHAWTVSTDGIITEVREYFNTSLTVTRLVNSS  142

Query  356  as--------------------aaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             +                    ++ A ITP+HC SVWESS  NRVGKSVPGLVLAI
Sbjct  143  QTPPFNYNSSSSSSSPSPSSGSSSTAEITPVHCFSVWESSFSNRVGKSVPGLVLAI  198



>ref|XP_010264763.1| PREDICTED: uncharacterized protein LOC104602680 [Nelumbo nucifera]
Length=308

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            Q + EE  + RVV AL +ALS RDV+ VQ+L ASD+EWWFHGPPSHQ++MR+LTG ++  
Sbjct  155  QASLEEESSIRVVRALYDALSGRDVETVQRLLASDIEWWFHGPPSHQYMMRLLTGVSS-D  213

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNH  360
            +SF F PL   A G TV VEG D +R ++WVHAWTV DGIITQVREYF+TSLTVTRFGN 
Sbjct  214  ESFVFVPLSFAAFGSTVLVEGCDQNRFVSWVHAWTVADGIITQVREYFDTSLTVTRFGN-  272

Query  359  sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             ++  + + + +  P +W+S      GKSVPGLVLAI
Sbjct  273  -STKLSPSSSSIRFPCMWQSQFTKATGKSVPGLVLAI  308



>gb|EPS71424.1| hypothetical protein M569_03336 [Genlisea aurea]
Length=177

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 109/158 (69%), Gaps = 14/158 (9%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E  EE+  K VV A  EALS+RD D + ++ A DLEWWFHGPPSHQFLMR+LTG      
Sbjct  32   EALEESY-KAVVSAFYEALSARDADKIHRILAPDLEWWFHGPPSHQFLMRLLTGDLL---  87

Query  536  SFRFEPLKV-DAIGPTVFVEGQDLSRNITWVHAWTVTD-GIITQVREYFNTSLTVTRFGN  363
             F F P  +  A G  V VEG D  R+I WVHAWTVTD GIITQVREYFNT LTVTR G 
Sbjct  88   DFEFHPHSIAAAFGNIVLVEGFDHLRSIAWVHAWTVTDHGIITQVREYFNTDLTVTRIGT  147

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            ++          LHCPSVWESSLP RVGKSVPG+VLAI
Sbjct  148  NA--------NALHCPSVWESSLPGRVGKSVPGVVLAI  177



>ref|XP_010257123.1| PREDICTED: uncharacterized protein LOC104597350 [Nelumbo nucifera]
Length=241

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            Q + EE  + RVV AL +AL  RDV+ +Q+L A D+EWWFHGPPSHQ++MR+LTG  ++ 
Sbjct  88   QASLEEESSIRVVRALYDALGVRDVETIQRLLAPDIEWWFHGPPSHQYMMRLLTG-VSSD  146

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNH  360
            +SF F PL   A G TV VEG D +R+++WVHAWTV DGIITQVREYF+TSLTV+RFG  
Sbjct  147  ESFVFVPLSFAAFGSTVLVEGCDQNRSVSWVHAWTVADGIITQVREYFDTSLTVSRFGKS  206

Query  359  sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              S ++++   + CP +W+S      GKSVPGLVLAI
Sbjct  207  GPSPSSSSS--IRCPHLWQSQFTKATGKSVPGLVLAI  241



>ref|XP_010650844.1| PREDICTED: uncharacterized protein LOC100257036 [Vitis vinifera]
Length=223

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E   E  +KRVV AL EALS+RDV+ V +L A DLEWWFHGPP+HQ LM++LTG++++ D
Sbjct  62   EAALEESSKRVVGALYEALSTRDVETVHQLLAPDLEWWFHGPPNHQHLMQLLTGSSSSDD  121

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN--  363
             F F+P+ + A G TV VEG +  R++ WVHAW VTDGIITQVREYFNTS+TVTR  N  
Sbjct  122  PFHFDPVSIVAFGSTVLVEGYEERRSVAWVHAWVVTDGIITQVREYFNTSVTVTRLSNTD  181

Query  362  ---HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                  S +  A   + C  VW+S +   +GKSVPGL+LA+
Sbjct  182  KAAEGPSTSTTAARSVPCTCVWQSKVCESMGKSVPGLLLAL  222



>emb|CDY00985.1| BnaC05g42150D [Brassica napus]
Length=171

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
             ET+N+ VVL L +AL SRDVD V +    DL++WFHGPP HQFLMR LTG +     F 
Sbjct  23   SETKNRDVVLKLYDALRSRDVDSVHRTLTPDLDYWFHGPPPHQFLMRTLTGVSPP---FE  79

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F PL V + G TV  EG D + +++W+HAWTV+ G+ITQVREY NTSLTVTR G+   S 
Sbjct  80   FSPLSVVSFGSTVIAEGCDAASSVSWIHAWTVSHGVITQVREYSNTSLTVTRIGS-VVSG  138

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             +A I   HCPSVWES    R GKSVPGLVLAI
Sbjct  139  RSAEIRASHCPSVWESKFSGRAGKSVPGLVLAI  171



>emb|CBI25404.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 113/167 (68%), Gaps = 15/167 (9%)
 Frame = -2

Query  725  NIQETXEE--TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT  552
            N  E  EE    N+RVV AL EAL SRDVD V +L A+DLEWWFHGPPSHQF+MR+LTG 
Sbjct  341  NSPEILEEVDASNQRVVRALYEALGSRDVDTVHRLLAADLEWWFHGPPSHQFMMRLLTGV  400

Query  551  ATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTR  372
            ++  +SF FEPL   + G TV  EG D S +I WVHAWTVTDG+ITQVREYFNTSLTVTR
Sbjct  401  SS-DESFVFEPLAFASFGSTVLAEGCDHSGSIAWVHAWTVTDGVITQVREYFNTSLTVTR  459

Query  371  FGNHsasaaaaAITPL------------HCPSVWESSLPNRVGKSVP  267
              N   + + ++                HCPSVWESS  +RVGKSVP
Sbjct  460  LSNSDFTTSPSSSISAASSSSTPSPPSRHCPSVWESSFSDRVGKSVP  506



>emb|CDY08559.1| BnaA05g27950D [Brassica napus]
Length=206

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
             ET+N+ VVL L +AL SRDVD V +    DL++WFHGPP HQFLMR LTG +     F+
Sbjct  58   SETKNRDVVLKLYDALRSRDVDSVHRTLTPDLDYWFHGPPPHQFLMRTLTGVSPP---FQ  114

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F PL V + G TV   G D + +++W+HAWTV+ G+ITQVREY NTSLTVTR G+   + 
Sbjct  115  FSPLSVVSFGSTVIAGGCDAASSVSWIHAWTVSHGVITQVREYSNTSLTVTRIGS-VVAG  173

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             +A I   HCPSVWES    R GKSVPGLVLAI
Sbjct  174  RSAEIRASHCPSVWESKFSGRAGKSVPGLVLAI  206



>gb|AAF01523.1|AC009991_19 unknown protein [Arabidopsis thaliana]
Length=531

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTAT-AGDSFR  528
            E +N+ VVL L EAL SRDV  V ++   DLE+WFHGPP HQFLMR+LTG  + +  SF 
Sbjct  378  EIKNRDVVLKLYEALRSRDVKSVHQILTPDLEYWFHGPPPHQFLMRVLTGGVSPSSSSFE  437

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F PL V + G TV  EG D + +I+W+HAWTV +GIITQVREY NTSLTVTR GN  A  
Sbjct  438  FVPLSVVSFGSTVIAEGCDAATSISWIHAWTVANGIITQVREYSNTSLTVTRIGNVVAGR  497

Query  347  aaaAIT-PLHCPSVWESSLPNRVGKSVPGLVLAI  249
             +A I  P HC SVWES    R GK VPGLVLAI
Sbjct  498  RSAEIAPPSHCSSVWESQFSGRAGKPVPGLVLAI  531



>ref|XP_007017022.1| Senescence associated gene 20, putative [Theobroma cacao]
 gb|EOY34641.1| Senescence associated gene 20, putative [Theobroma cacao]
Length=240

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            EE  N+RVV AL +AL+SRDV+ V +L A+DLEWWFHGPPSHQ LMR+LTG+    + F 
Sbjct  90   EEYSNERVVRALYDALNSRDVETVHRLLAADLEWWFHGPPSHQHLMRLLTGST---EPFI  146

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F PL+V A G  V VEG +  R+++WVHAWTVT+GIITQVREYFNTSLTV R  N     
Sbjct  147  FVPLRVAAFGSLVIVEGYNKERDVSWVHAWTVTNGIITQVREYFNTSLTVARLSNSEGGP  206

Query  347  aaaAITP---LHCPSVWESSLPNRVGKSVPGLVLAI  249
             + +  P    +C S+W+S L +   K+VPGLVLA+
Sbjct  207  PSISSAPTVLANCQSIWQSKLCD--DKAVPGLVLAL  240



>ref|XP_007207922.1| hypothetical protein PRUPE_ppa018618mg, partial [Prunus persica]
 gb|EMJ09121.1| hypothetical protein PRUPE_ppa018618mg, partial [Prunus persica]
Length=167

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 106/156 (68%), Gaps = 7/156 (4%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E  EE RNK+ V AL  AL+S DVD+V  L A  LEWWFHGPP+HQ L R+LTG +    
Sbjct  19   EDAEEARNKKTVTALYRALTSNDVDVVHLLLAPYLEWWFHGPPTHQHLNRLLTGASPYDP  78

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            SF+F PL + A G  V VEG D  R+++WVHAWTVTDGIITQVREY+NTS+TVTR  +  
Sbjct  79   SFKFVPLSIVAFGSMVLVEGFDDCRSVSWVHAWTVTDGIITQVREYYNTSVTVTRLSSPE  138

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              + +      +C SVW+S L +    SVPGLVLA+
Sbjct  139  IRSQSG-----NCQSVWQSKLAD--NGSVPGLVLAL  167



>ref|XP_008236282.1| PREDICTED: wound-induced protein 1 [Prunus mume]
Length=160

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 106/156 (68%), Gaps = 7/156 (4%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E  EE RNK  V AL +AL+S DVD+V  L A  LEWWFHGPP+HQ L R+LTG      
Sbjct  12   EDAEEARNKTTVTALYKALTSNDVDVVHLLLAPYLEWWFHGPPTHQHLNRLLTGAPPYDP  71

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            SF+F PL + A G  V VEG D  R+++WVHAWTVTDGIITQVREY+NTS+TVTR  +  
Sbjct  72   SFKFVPLSIVAFGSMVLVEGFDDCRSVSWVHAWTVTDGIITQVREYYNTSVTVTRLSSPE  131

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              + +      +C SVW+S L +   +SVPGLVLA+
Sbjct  132  IRSQSG-----NCQSVWQSKLAD--NESVPGLVLAL  160



>ref|XP_009358318.1| PREDICTED: wound-induced protein 1-like [Pyrus x bretschneideri]
Length=152

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 105/156 (67%), Gaps = 7/156 (4%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E  EE +NK  V AL +AL+S+DVD+V  L A  LEWWFHGPP+HQ L R+LTG      
Sbjct  4    EDSEEAKNKTTVTALYQALTSKDVDVVHLLLAPYLEWWFHGPPTHQHLNRLLTGAPPYDS  63

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            SF+F PL + A G  V  EG D++R+++WVHAWT TDGIITQVREY NTS+TVTR  +  
Sbjct  64   SFKFVPLSIIAFGSMVLAEGYDVARSVSWVHAWTFTDGIITQVREYNNTSVTVTRLSSPH  123

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +      P +C  VW+S L +   KS+PGLVLA+
Sbjct  124  IRSQ-----PGNCQCVWQSKLSD--DKSLPGLVLAL  152



>ref|XP_008356134.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
Length=152

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 7/156 (4%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E  EE +NK  V AL +AL+S+DVD+V  L A  LEWWFHGPP+HQ L R+LTG      
Sbjct  4    EDSEEAKNKTTVTALYQALTSKDVDVVHLLLAPYLEWWFHGPPTHQHLNRLLTGAPPYDS  63

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            SF+F PL + A G  V  EG D  R+++WVHAW  TDGIITQVREY+NTS+TVTR  +  
Sbjct  64   SFKFVPLSIIAFGSMVLAEGYDEVRSVSWVHAWIFTDGIITQVREYYNTSVTVTRLSSXH  123

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +      P +C  +W+S L +   KSVPGLVLA+
Sbjct  124  IRSQ-----PGNCQCLWQSKLSD--NKSVPGLVLAL  152



>ref|XP_010271741.1| PREDICTED: wound-induced protein 1-like [Nelumbo nucifera]
Length=178

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  689  RVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKV  510
            RVV AL EALS  DV+ VQ+L ASD+EWWFHGPPSH +LMR+LTG+ +  +SF F PL  
Sbjct  31   RVVRALYEALSGGDVEKVQRLLASDIEWWFHGPPSHLYLMRLLTGSVSWDESFVFVPLSF  90

Query  509  DAIGPTVFVEGQDLSRNITWVHAWTVTD-GIITQVREYFNTSLTVTRFGNHsasaaaaAI  333
             A G TV VEG D +  ++WVHAWTV D G+ITQ+REYF+TSLTVT FG+ +  + +   
Sbjct  91   AAFGSTVLVEGCDHNPCVSWVHAWTVADGGMITQLREYFDTSLTVTCFGDPTKPSPSPPS  150

Query  332  TPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            + +  P +W+S      GKSVPGL+LAI
Sbjct  151  SSIRFPWLWQSQFTKVTGKSVPGLLLAI  178



>gb|KDO49276.1| hypothetical protein CISIN_1g037228mg [Citrus sinensis]
Length=171

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 108/160 (68%), Gaps = 11/160 (7%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD---  537
            E+  N RVV  L +AL+S DV  V +L  SDLEWWFHGPP HQ LM +LTG++++ +   
Sbjct  16   EDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKR  75

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
             F F PL   A GPTV VEG     +++WVHAWTVTDGIITQVREYFNTS+TVTRFG+  
Sbjct  76   CFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGD--  133

Query  356  asaaaaAITPL----HCPSVWESSLPNRVGKSVPGLVLAI  249
                ++ + P+     C SVW+S L +    SVPGLVLA+
Sbjct  134  PQLLSSPVAPVTVSSSCQSVWQSKLCDN--NSVPGLVLAL  171



>ref|XP_011461439.1| PREDICTED: wound-induced protein 1-like, partial [Fragaria vesca 
subsp. vesca]
Length=200

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 106/152 (70%), Gaps = 7/152 (5%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E+RNKR V +L +A +S+DVD+V  L A  LEWWFHGPP+HQ L R+LTG      SF+F
Sbjct  56   ESRNKRAVKSLYDAFNSKDVDVVHLLLAPYLEWWFHGPPTHQHLNRLLTGAPPYDSSFKF  115

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
             PL + A G  V  EG D  R+++WVHAWTVTDGIITQVREY+NTS+TVTR  +   ++ 
Sbjct  116  APLSIVAFGSMVVAEGYDEGRSVSWVHAWTVTDGIITQVREYYNTSVTVTRLYSPEITSP  175

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            + +     C +VWES L +   KSVPGLVLA+
Sbjct  176  SGS-----CQNVWESKLSDN--KSVPGLVLAL  200



>ref|XP_009785319.1| PREDICTED: wound-induced protein 1 [Nicotiana sylvestris]
Length=107

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = -2

Query  572  MRILTGTATAG-DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MRILTGTA +  D F+F P  +DA G TV VEG D  R+ITWVHAWTVTDGIITQVREYF
Sbjct  1    MRILTGTAKSDTDLFQFIPQTIDAFGSTVLVEGCDPDRSITWVHAWTVTDGIITQVREYF  60

Query  395  NTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR GN+  +   ++ITP HCPS+WESSLPNRVGKSVPGLVLA+
Sbjct  61   NTSLTVTRLGNN--TTDFSSITPRHCPSLWESSLPNRVGKSVPGLVLAL  107



>ref|XP_009421442.1| PREDICTED: uncharacterized protein LOC104001000 [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 105/155 (68%), Gaps = 6/155 (4%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGT--ATAGDSF  531
            E RNK  VL L EAL++RDV+ VQ+L A D+EWWFHGPP HQ +MR+LTG        +F
Sbjct  98   EDRNKWAVLTLYEALNARDVERVQQLLAPDIEWWFHGPPEHQHMMRMLTGAEEEETAATF  157

Query  530  RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHsa  354
            RF+P +V A G TV  EG+  + N  WVHAWTV  DGIITQVREYFNTSLT+TR    SA
Sbjct  158  RFQPERVAAFGSTVVAEGR--APNAAWVHAWTVAPDGIITQVREYFNTSLTITRVAASSA  215

Query  353  saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            S+   A +  HC  +W+S  P    KS PGLVLAI
Sbjct  216  SSKEPAGS-THCLHLWQSRRPVPPEKSFPGLVLAI  249



>ref|XP_006828191.1| hypothetical protein AMTR_s00023p00142590, partial [Amborella 
trichopoda]
 gb|ERM95607.1| hypothetical protein AMTR_s00023p00142590, partial [Amborella 
trichopoda]
Length=181

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 108/180 (60%), Gaps = 28/180 (16%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDS  534
            + E+  ++R VLA  EAL++ D   +Q+L A DLEWWFHGPP+ Q LMR L+G  + G S
Sbjct  5    SLEDQVSERAVLAFYEALAAGDAGKLQQLLAPDLEWWFHGPPTFQHLMRFLSGKGSLG-S  63

Query  533  FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs-  357
            F F P  V ++GP V  EG+  S    WVHAWTV DG+ITQ+REYFNTS+TVTRF   + 
Sbjct  64   FTFSPQSVASLGPVVIAEGRSFS--TFWVHAWTVRDGVITQLREYFNTSVTVTRFSEANP  121

Query  356  ------------------------asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                                    +S + ++   L+C  VWESSLP   G+SVPGLVLAI
Sbjct  122  SADSSLSGRPASLSKSASLSNPVRSSLSNSSTAVLNCSPVWESSLPGAGGRSVPGLVLAI  181



>ref|XP_009614292.1| PREDICTED: wound-induced protein 1 [Nicotiana tomentosiformis]
Length=108

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = -2

Query  572  MRILTGTATAG-DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MRILTGTA +  D F+F P  +DA G TV VEG D  R+ITWVHAWTVTDGIITQVREYF
Sbjct  1    MRILTGTAKSDTDLFQFIPQTIDAFGSTVLVEGCDPDRSITWVHAWTVTDGIITQVREYF  60

Query  395  NTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR  N+  +   ++I P HCPS+WESSLPNRVGKSVPGLVLA+
Sbjct  61   NTSLTVTRLSNN-NNTDFSSIAPRHCPSLWESSLPNRVGKSVPGLVLAL  108



>ref|XP_008369539.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
Length=152

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 98/156 (63%), Gaps = 7/156 (4%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E  EE +NK  V AL +AL+S+DVD+V  L A  LEWWFHGP +HQ L R+L G  +   
Sbjct  4    EDSEEAKNKMTVTALYQALTSKDVDVVHLLLAXYLEWWFHGPLTHQHLNRLLXGAPSYDS  63

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            SF+F PL + A G  V  E  D   +++WVHAW  TDGIITQVRE+++TS+TVTR  +  
Sbjct  64   SFKFVPLSIIAFGSMVLAERYDDVHSVSWVHAWIFTDGIITQVREHYSTSVTVTRLSS--  121

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     P +C  VW+S L +   K VPGLVLA+
Sbjct  122  ---LHIRSQPXNCQCVWQSKLSD--NKFVPGLVLAL  152



>ref|XP_006468253.1| PREDICTED: uncharacterized protein LOC102614777 [Citrus sinensis]
Length=320

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD---  537
            EE  N RVV  L +AL+S DV  V +L  SDLEWWFHGPP HQ LM +LTG++++ +   
Sbjct  16   EEEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKR  75

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
             F F PL   A GPTV VEG     +++WVHAWTVTDGIITQVREYFNTS+TVTRFG+  
Sbjct  76   CFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQ  135

Query  356  asaaaaAITPL--HCPSVWESSLPNRVGKSVP  267
              ++ AA   +   C SVW+S L +    SVP
Sbjct  136  LLSSPAAPVTVSSSCQSVWQSKLCDN--NSVP  165



>ref|XP_006656972.1| PREDICTED: wound-induced protein 1-like [Oryza brachyantha]
Length=201

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 100/171 (58%), Gaps = 18/171 (11%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDS-F  531
            EE   K +VL L EALSS D    Q+L A DL WWFHGPP+HQ +MR+LTG    G++ F
Sbjct  31   EEQLAKFLVLGLYEALSSGDARRAQELLAPDLGWWFHGPPAHQHMMRLLTGADQQGEAGF  90

Query  530  RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHsa  354
             F P  VDA G TV  EG D SR + WVHAWTV  DG+ITQ+REYFNT LTVTR    +A
Sbjct  91   AFSPRSVDAFGDTVIAEGTDGSRQLYWVHAWTVGPDGVITQLREYFNTDLTVTRLATSAA  150

Query  353  saaa----------------aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +                    A  P     +W+S   +R  KS+PGLVLAI
Sbjct  151  AMDTAAISSNLAAAASSSAFPARAPAKLKCLWKSRRADREHKSLPGLVLAI  201



>sp|P20144.1|WUN1_SOLTU RecName: Full=Wound-induced protein 1 [Solanum tuberosum]
Length=105

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  572  MRILTGTATAGD-SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            M+ILTGTA   + SF+F    +D  G  V VEG D +R+ITWVHAWTVTDG+ITQVREYF
Sbjct  1    MQILTGTAKFDNASFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVITQVREYF  60

Query  395  NTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTRFG     +  ++IT LHCPSVWESSLPNRVGKSVPGLVLA+
Sbjct  61   NTSLTVTRFGK----SDISSITTLHCPSVWESSLPNRVGKSVPGLVLAL  105



>ref|XP_002325665.2| hypothetical protein POPTR_0019s14670g, partial [Populus trichocarpa]
 gb|EEF00047.2| hypothetical protein POPTR_0019s14670g, partial [Populus trichocarpa]
Length=176

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 109/165 (66%), Gaps = 14/165 (8%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTG-------T  552
            EE  NKRVV+AL EAL+S+D+    +L   DLEWWFHGPP HQ  L+ +LT        +
Sbjct  14   EEEHNKRVVIALYEALASKDIKTAHRLLPPDLEWWFHGPPIHQQHLISLLTNQSTSPSSS  73

Query  551  ATAGDSFRFEPL-KVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT  375
                 SF F P+  + A G  V VEG +   N++WVHAWTVT+GIITQV+EYFNTS+TVT
Sbjct  74   TRPSKSFIFHPISNIVAFGSMVLVEGFNKDWNVSWVHAWTVTNGIITQVKEYFNTSVTVT  133

Query  374  RFGNHsasaaaaAITP---LHCPSVWESSLPNRVGKSVPGLVLAI  249
            RFG+  + A++  IT     +C SVW+S + +   KSVPGLVLA+
Sbjct  134  RFGDGGSIASSPGITSPPRANCQSVWQSKVSDN--KSVPGLVLAL  176



>dbj|BAB13711.1| elicitor inducible protein [Nicotiana tabacum]
Length=105

 Score =   142 bits (357),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 82/108 (76%), Gaps = 3/108 (3%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            M+ LTGTA   D+F F P  +D  G  V VEG D +R+ITWVHAWTV DG+ITQVREYFN
Sbjct  1    MQTLTGTAK--DAFHFIPKSIDVFGSIVLVEGCDPTRSITWVHAWTVADGVITQVREYFN  58

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSL VTRFG     +   +ITPLHCPSVWESSL NRVGKSVPGLVLA+
Sbjct  59   TSLIVTRFGKK-TQSDFESITPLHCPSVWESSLANRVGKSVPGLVLAL  105



>ref|XP_008457302.1| PREDICTED: wound-induced protein 1-like, partial [Cucumis melo]
Length=169

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 108/161 (67%), Gaps = 8/161 (5%)
 Frame = -2

Query  725  NIQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTAT  546
            N + + E+  +   V AL EAL ++DV+ V +L A DLEWWFHGPPSHQ+LMR+LTG   
Sbjct  15   NPEWSPEQRESVGRVRALYEALGTKDVETVHRLLAPDLEWWFHGPPSHQYLMRLLTG---  71

Query  545  AGDSFRFEPLKVDAIGPT-VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF  369
            A  SF F P+ +  +GPT V  EG    R ++WVHAWT+TDG+IT V+EY NTS+TV RF
Sbjct  72   ASSSFVFAPISLVPLGPTIVLAEGFHPKRAVSWVHAWTITDGVITHVKEYLNTSVTVKRF  131

Query  368  GNHsasaaaaAIT-PLHCPSVWESSLPNRVGKSVPGLVLAI  249
             + +    + +I+ P +C S+W+S +     +S+P LVLA+
Sbjct  132  SSAATDGDSPSISPPPNCESLWQSKV---WRESMPALVLAL  169



>ref|XP_006353404.1| PREDICTED: wound-induced protein 1-like [Solanum tuberosum]
Length=112

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSF-RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MRILTGTA +   F +F P  +DA G TV VEG D  R+ITWVHAWTV DGIITQVREYF
Sbjct  1    MRILTGTANSDHYFFKFIPQSIDAFGSTVLVEGCDPDRSITWVHAWTVNDGIITQVREYF  60

Query  395  NTSLTVTRF--GNHsasaaaaAITP-LHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR    N+  S+  ++I P  HCPS+WESSLPNRVGKSVPGLVLA+
Sbjct  61   NTSLTVTRLDNNNNCPSSDLSSIAPSRHCPSIWESSLPNRVGKSVPGLVLAL  112



>gb|KDP21696.1| hypothetical protein JCGZ_03367 [Jatropha curcas]
Length=128

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 88/128 (69%), Gaps = 20/128 (16%)
 Frame = -2

Query  572  MRILTGTATA----GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVR  405
            MR+LTG  T+    G SF F+P  + A G  V  EG D +R+I+WVHAWTVTDGIITQVR
Sbjct  1    MRLLTGADTSSEKVGKSFEFKPEVIRAFGSVVIAEGCDPTRSISWVHAWTVTDGIITQVR  60

Query  404  EYFNTSLTVTRFGNHsasaa----------------aaAITPLHCPSVWESSLPNRVGKS  273
            EYFNTSLTVTRFGN + S +                 A ITP+HCPSVWESSL NRVGKS
Sbjct  61   EYFNTSLTVTRFGNQNQSESSDYSCSSSSSSSPSSPKAEITPVHCPSVWESSLSNRVGKS  120

Query  272  VPGLVLAI  249
            VPGLVLAI
Sbjct  121  VPGLVLAI  128



>ref|XP_004987041.1| PREDICTED: uncharacterized protein LOC101779217 [Setaria italica]
Length=306

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 105/182 (58%), Gaps = 26/182 (14%)
 Frame = -2

Query  722  IQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA  543
            + E  EE RN+ +VL L EAL++RD    Q+L A+DLEWWFHGPP+ Q +MR+LTG    
Sbjct  127  VVEESEEQRNRFLVLRLYEALNARDARRAQELLAADLEWWFHGPPARQHMMRLLTGAEKG  186

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFG  366
               F F P  VDA G TV  EG D +R + WVHAWTV  DG+ITQ+REYFNT LTVT   
Sbjct  187  NGGFAFTPRSVDAFGSTVIAEGADETRQLYWVHAWTVGPDGVITQLREYFNTDLTVTLLS  246

Query  365  NHsasaaaaAITPL-----------------------HCPSVWESSLPNRVGKSVPGLVL  255
              +++  AAAI                           C  +W+S   +R  KS+PGLVL
Sbjct  247  GAASAKNAAAIAAAPPKQDAASSSSSSPSSASSSAGPKC--LWQSRRADRAHKSLPGLVL  304

Query  254  AI  249
            AI
Sbjct  305  AI  306



>ref|XP_011076629.1| PREDICTED: wound-induced protein 1 [Sesamum indicum]
Length=108

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG   +   F F P  + A G TV  EG D SR+I WVHAWTVTDGIITQVREYFN
Sbjct  1    MRLLTGEQES--DFTFVPHSISAFGSTVLAEGFDQSRSIAWVHAWTVTDGIITQVREYFN  58

Query  392  TSLTVTRFG--NHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTRFG  + S     ++I  L+CPSVWESSLP+RVGKSVPGLVLAI
Sbjct  59   TSLTVTRFGKTDQSDCTTTSSIASLNCPSVWESSLPDRVGKSVPGLVLAI  108



>ref|NP_001049849.1| Os03g0299600 [Oryza sativa Japonica Group]
 dbj|BAF11763.1| Os03g0299600, partial [Oryza sativa Japonica Group]
Length=228

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 103/172 (60%), Gaps = 15/172 (9%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            ++  EE   K +VL L EAL+S D    Q+L A DLEWWFHGPP+HQ +MR+LTG     
Sbjct  57   RDQPEEQDAKFLVLRLYEALNSGDARRAQELLAPDLEWWFHGPPAHQHMMRLLTGADHGE  116

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRF--  369
              F F P  VDA G TV  EG D +R + WVHAWTV  DG+ITQ+REYFNT LTVTR   
Sbjct  117  SRFLFSPRSVDAFGSTVIAEGTDDTRQLYWVHAWTVGPDGVITQLREYFNTDLTVTRLSA  176

Query  368  ------------GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                         ++ AS++A    P     +W+S   +R  KS+PGLVLAI
Sbjct  177  SAAKTTAAISSSNSNHASSSAPPPPPSKPKCLWQSRRADRAHKSLPGLVLAI  228



>ref|XP_002312192.1| wound-responsive family protein [Populus trichocarpa]
 gb|EEE89559.1| wound-responsive family protein [Populus trichocarpa]
Length=118

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 85/118 (72%), Gaps = 10/118 (8%)
 Frame = -2

Query  572  MRILTGTATAGD-SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MR+LTG     D  F F PL + + G  V VEG D SR+I+WVHAWTVTDG+ITQVREYF
Sbjct  1    MRLLTGEQKDNDVPFEFSPLSITSFGNIVVVEGCDTSRSISWVHAWTVTDGVITQVREYF  60

Query  395  NTSLTVTRFGNH---------sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR GN          S S++   I+P+HCPSVWESSL +R+GKSVPGLVLAI
Sbjct  61   NTSLTVTRLGNQSQSSDFKSKSKSSSTTEISPVHCPSVWESSLSDRIGKSVPGLVLAI  118



>ref|XP_006651290.1| PREDICTED: uncharacterized protein LOC102719942 [Oryza brachyantha]
Length=283

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = -2

Query  686  VVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVD  507
            +VL L EAL+  D    Q+L A DLEWWFHGPP+HQ +MR+LTG       F F P  V+
Sbjct  133  LVLRLYEALNFGDARRAQELLAPDLEWWFHGPPAHQHMMRLLTGADRGKARFLFVPRSVE  192

Query  506  AIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRF----GNHsasaaa  342
            A G TV  EG D SR + WVHAWTV  DG+ITQ+REYFNT LTVTR       ++A +++
Sbjct  193  AFGSTVIAEGTDDSRQLYWVHAWTVGPDGVITQLREYFNTDLTVTRLSASAAKNTAISSS  252

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            AA  P     +W+S   +   KS+PGLVLAI
Sbjct  253  AAPAPAKPKCLWQSRRADSAHKSLPGLVLAI  283



>ref|XP_003561721.1| PREDICTED: uncharacterized protein LOC100834985 [Brachypodium 
distachyon]
Length=232

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 101/182 (55%), Gaps = 30/182 (16%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            +E R K +VL L EAL++RD    Q+L A DLEWWFHGPP+HQ +MR+LTG  T  + FR
Sbjct  52   DEQRGKFLVLRLYEALNARDARRAQELLAPDLEWWFHGPPAHQHMMRLLTGAGTNAE-FR  110

Query  527  FEPLKVDAIGPTVFVEG---QDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNH  360
            F P  VDA G TV  EG         + WVHAWTV  DG+ITQ+REYFNT LTVTR    
Sbjct  111  FSPRSVDAFGSTVIAEGGADDAAGGQLYWVHAWTVGPDGVITQLREYFNTDLTVTRLSAA  170

Query  359  sasaaaaAI-------------------------TPLHCPSVWESSLPNRVGKSVPGLVL  255
            +A+ +                             TP     +W+S   +R  KS+PGLVL
Sbjct  171  AAAISPNNASSSSPPSSSSSPSSSSSSAASSPAHTPKWPKCLWQSRRADRAHKSLPGLVL  230

Query  254  AI  249
            AI
Sbjct  231  AI  232



>ref|XP_011006090.1| PREDICTED: wound-induced protein 1-like [Populus euphratica]
Length=118

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 85/118 (72%), Gaps = 10/118 (8%)
 Frame = -2

Query  572  MRILTGTATAGD-SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MR+LTG     D  F F P+ +++ G  V VEG D SR+I+WVHAWTVTDG ITQVREYF
Sbjct  1    MRLLTGEQKDNDVPFEFSPISINSFGNIVVVEGCDTSRSISWVHAWTVTDGGITQVREYF  60

Query  395  NTSLTVTRFGNH---------sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR GN          S S++   I+P+HCPSVWESSL +R+GKSVPGLVLAI
Sbjct  61   NTSLTVTRLGNQPQPSDLKSRSKSSSTTEISPVHCPSVWESSLSDRIGKSVPGLVLAI  118



>ref|XP_010558057.1| PREDICTED: wound-induced protein 1-like [Tarenaya hassleriana]
Length=112

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFE--PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREY  399
            MRILTG A +   F FE  PL V + GPTV  EG D +R+I+W+HAWTVT GIITQVREY
Sbjct  1    MRILTGDAPSSPPFEFEFVPLSVVSFGPTVIAEGCDSTRSISWIHAWTVTHGIITQVREY  60

Query  398  FNTSLTVTRFGNHs--asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            FNTSL VTR GN +       A I+P+HCPSVWES    + GKSVPGLVLAI
Sbjct  61   FNTSLVVTRIGNSAVGQKKPTAEISPVHCPSVWESQFSGQAGKSVPGLVLAI  112



>ref|XP_009407116.1| PREDICTED: uncharacterized protein LOC103989899 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD--SF  531
            E +NK VV  L EA++ RDV  V +L A DLEWWFHGPP  Q L R+LTG    GD  +F
Sbjct  69   EAKNKAVVRELYEAINRRDVARVHRLLAPDLEWWFHGPPERQHLRRLLTGEEEEGDIVTF  128

Query  530  RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGNHsa  354
            +  P +V A G  V  EG      + W+HAWTV   G+ITQVREYFNTSLTVTR G  SA
Sbjct  129  QPGPQEVAAFGSIVLAEGCGPG-AVVWIHAWTVGPGGVITQVREYFNTSLTVTRLGGDSA  187

Query  353  saaa--aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             A    +A +   C  VW+S L  R  KS+PGLVLAI
Sbjct  188  PAPTDGSAGSTQCCLPVWQSRLHRRAPKSLPGLVLAI  224



>ref|XP_010031140.1| PREDICTED: wound-induced protein 1-like [Eucalyptus grandis]
Length=119

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYF  396
            MR+LTG A   D+F F P+ V + GPTV  EG D +R+I WVHAWTV+ DGI+TQVREYF
Sbjct  1    MRLLTGAAEPDDTFLFVPVSVTSFGPTVLAEGSDPARSIFWVHAWTVSADGIVTQVREYF  60

Query  395  NTSLTVTRFGNH-sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI*P  243
            NTSLTVTRFG+   +  + A I PLHC S+WESS+ +R GKSVPGLVLAI P
Sbjct  61   NTSLTVTRFGDSPPSDPSTAEIAPLHCQSLWESSV-SRAGKSVPGLVLAILP  111



>ref|XP_006376550.1| hypothetical protein POPTR_0013s14990g, partial [Populus trichocarpa]
 gb|ERP54347.1| hypothetical protein POPTR_0013s14990g, partial [Populus trichocarpa]
Length=154

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSH-QFLMRILTGTATAGDSFRFE  522
             NKRVV+AL +AL ++D++   +L A DLEWWFHGPP H Q LM +LT +     S  + 
Sbjct  2    HNKRVVVALYDALVNKDIETAHRLLAPDLEWWFHGPPIHQQHLMSLLT-SQPPSSSSSYP  60

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
               V A G  V VEG +   N++WVHAWTVT+GIITQVREYFNTS+TVTRFG+  +S ++
Sbjct  61   LSNVVAFGSMVLVEGFNKDWNVSWVHAWTVTNGIITQVREYFNTSVTVTRFGDGGSSISS  120

Query  341  aAI-----TPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +       +   C SVW+S + +   KS+PGLVLA+
Sbjct  121  SPAISTSQSRASCQSVWQSKVSDN--KSLPGLVLAL  154



>ref|XP_004138405.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus]
Length=118

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 10/118 (8%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG ++ G SF+F P  + + G TV VEG D SR+I+W+HAWTVTDGIITQ+REYFN
Sbjct  1    MRLLTGASSNGQSFQFVPQSITSFGSTVLVEGCDPSRSISWIHAWTVTDGIITQLREYFN  60

Query  392  TSLTVTRFGNHsasaaaaAITPL----------HCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G+ S   + ++ +            HCPSVWESS+ N+VGKSVPGLVLAI
Sbjct  61   TSLTVTRVGDPSEYPSTSSSSASSEISSAASLHHCPSVWESSVSNQVGKSVPGLVLAI  118



>ref|XP_008456749.1| PREDICTED: wound-induced protein 1 [Cucumis melo]
Length=117

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG ++ G SF+F P  + + G TV VEG D SR+I+W+HAWT+TDGIITQ+REYFN
Sbjct  1    MRLLTGASSNGQSFQFVPQSITSFGSTVLVEGCDPSRSISWIHAWTITDGIITQLREYFN  60

Query  392  TSLTVTRFGNHsasaaaaAITPL---------HCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G+ +   + ++ +           HCPSVWESS+ N+VGKSVPGLVLAI
Sbjct  61   TSLTVTRVGDPTEYPSTSSSSASEISTAPSLHHCPSVWESSVSNQVGKSVPGLVLAI  117



>ref|XP_004307702.1| PREDICTED: wound-induced protein 1 [Fragaria vesca subsp. vesca]
Length=109

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG     +SF F P  V ++GP V VEG D ++ I+WVHAWTVTDGI+TQVREYFN
Sbjct  1    MRMLTGEKN-DESFVFRPQSVCSVGPVVLVEGSDPAKEISWVHAWTVTDGIVTQVREYFN  59

Query  392  TSLTVTRFGNHsa----saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR GN +     S + A IT  HCPSVWESS P  VGKSVPGLVLAI
Sbjct  60   TSLTVTRLGNSTTKSKISKSTAEITSYHCPSVWESSNP--VGKSVPGLVLAI  109



>ref|XP_004240897.1| PREDICTED: wound-induced protein 1-like [Solanum lycopersicum]
Length=115

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 83/115 (72%), Gaps = 7/115 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSF-RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MRILTGTA +   F +F P  VDA G TV VEG D   +ITWVHAWTV DGIITQVREYF
Sbjct  1    MRILTGTANSDHYFFKFIPQSVDAFGSTVLVEGCDPDHSITWVHAWTVDDGIITQVREYF  60

Query  395  NTSLTVTRFGNHs------asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR  N +      +S  ++     HCPS+WESSLPNRVGKSVPGLVLA+
Sbjct  61   NTSLTVTRLDNSNNNNNCPSSDLSSIAATRHCPSLWESSLPNRVGKSVPGLVLAL  115



>gb|KDP22807.1| hypothetical protein JCGZ_00394 [Jatropha curcas]
Length=161

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (63%), Gaps = 8/152 (5%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E  NK +V AL +AL+   ++ V KL ASDLEWWFHGPP  Q +MR+LTG A+  D FRF
Sbjct  18   EMLNKGMVEALYKALAKGHIETVAKLLASDLEWWFHGPPQCQHMMRVLTGEASP-DEFRF  76

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  ++ +G  V VEG + ++ + WVH WT+ DG+ITQ REYFNT LTV     HS    
Sbjct  77   EPRSIEVVGDCVIVEGWEGAK-VYWVHVWTLKDGLITQFREYFNTWLTVKDIKPHSLEIG  135

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                T      +W+S   +   +S+PGL+LAI
Sbjct  136  HQTHT------LWQSQPRDLFNRSLPGLLLAI  161



>ref|XP_010543692.1| PREDICTED: wound-induced protein 1 [Tarenaya hassleriana]
Length=115

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 81/115 (70%), Gaps = 7/115 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFE--PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREY  399
            MRILTG A +   F FE  PL V + G TV  EG D S +I+WVHAWTVT GIITQVREY
Sbjct  1    MRILTGDAPSSPPFEFEFIPLSVVSFGSTVIAEGCDSSGSISWVHAWTVTHGIITQVREY  60

Query  398  FNTSLTVTRFGNHs-----asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            FNTSLTVT+ GN S        +AA I+P+HCP VWES L  R GKSVPGLVLAI
Sbjct  61   FNTSLTVTKIGNSSGGAVGQKTSAAEISPVHCPYVWESQLSGRAGKSVPGLVLAI  115



>dbj|BAJ98748.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 93/156 (60%), Gaps = 25/156 (16%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILT-GTATAGDSF  531
            EE RNK +VL L EAL+ RD           LEWWFHGPP+HQ +MR+LT GT+ +  SF
Sbjct  45   EEQRNKFLVLRLYEALNGRD-----------LEWWFHGPPAHQHMMRLLTGGTSPSSSSF  93

Query  530  RFEPLKVDAIGPTVFVEG-QDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGNHs  357
             F+P  VDA G TV  EG  D +    WVHAWTV  DG+ITQ+REYFNT LTVTR     
Sbjct  94   IFQPRSVDAFGSTVIAEGVDDKATKAYWVHAWTVGGDGVITQLREYFNTDLTVTRLA---  150

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                           VW+S  P+R   S+PGLVLA+
Sbjct  151  --------AAAASKCVWQSRRPDRARNSLPGLVLAL  178



>ref|XP_002882707.1| hypothetical protein ARALYDRAFT_897298 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58966.1| hypothetical protein ARALYDRAFT_897298 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -2

Query  572  MRILTGTAT-AGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MR+LTG  + +  SF F PL V + G TV  EG D + +I+W+HAWTV +GIITQVREY 
Sbjct  1    MRVLTGGVSPSSSSFEFVPLSVVSFGSTVIAEGCDAATSISWIHAWTVANGIITQVREYS  60

Query  395  NTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR GN  A   +A I P HCPSVWES    R GKSVPGLVLAI
Sbjct  61   NTSLTVTRIGNVVAGRRSAEIAPSHCPSVWESQFSGRAGKSVPGLVLAI  109



>ref|XP_009402774.1| PREDICTED: uncharacterized protein LOC103986478 [Musa acuminata 
subsp. malaccensis]
Length=202

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 96/152 (63%), Gaps = 5/152 (3%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            R + VV  L EA+++RDV  + +L   DLEW FHG P HQ L R+LTG      +F+FEP
Sbjct  54   RPEVVVRELYEAINARDVAKLHRLLKPDLEWRFHGQPKHQHLKRLLTGEEET-IAFKFEP  112

Query  518  LKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFG-NHsasaa  345
             +V A G TV  EG  L     WVHAWTV  +G+ITQVREYFNTSLTV R G +  AS++
Sbjct  113  QEVAAFGSTVVAEGCGL--GALWVHAWTVEPEGVITQVREYFNTSLTVARVGADSPASSS  170

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   HC  VW+S L  R  KS+PGLVLAI
Sbjct  171  EDHDRSTHCLPVWQSRLHRRARKSLPGLVLAI  202



>ref|XP_002323036.2| hypothetical protein POPTR_0016s13720g [Populus trichocarpa]
 gb|EEF04797.2| hypothetical protein POPTR_0016s13720g [Populus trichocarpa]
Length=162

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = -2

Query  722  IQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA  543
            + +   E +NK +V AL + LS+ +++ V +  ASDLEWWFHGPP  Q +MR+LTG ++ 
Sbjct  13   VSDLNAEMQNKAIVDALYKGLSNGEIETVARFIASDLEWWFHGPPKCQHMMRMLTGESSQ  72

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN  363
               FRFEP  ++AIG  V +EG + ++ + WVH WT+ DG+IT +REYFNT LTVT    
Sbjct  73   -TKFRFEPRNIEAIGDCVIIEGWEGAQ-VYWVHVWTLKDGVITHLREYFNTWLTVTDISP  130

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            H         T      +WES   +   +S+PGLVL I
Sbjct  131  HGWKIRHENHT------LWESHPRDLFNRSLPGLVLGI  162



>ref|XP_009385278.1| PREDICTED: uncharacterized protein LOC103972661 [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 95/149 (64%), Gaps = 10/149 (7%)
 Frame = -2

Query  674  LXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVDAIGP  495
            L EA++ RDV  + +L A DLEWWFHG P HQ L R+LTG A    +F FEP +V + G 
Sbjct  74   LYEAINGRDVGRLHQLLAPDLEWWFHGQPEHQHLKRLLTGEAEY-IAFEFEPQEVASFGS  132

Query  494  TVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGNHsasaaaaAITPL--  324
            TV  EG   S    WVHAWTV  +G+ITQVREYFNTSLTVTR G  SA ++ A+ +    
Sbjct  133  TVVAEG--CSPGAVWVHAWTVDPEGVITQVREYFNTSLTVTRLGGDSALSSPASSSSKDS  190

Query  323  ----HCPSVWESSLPNRVGKSVPGLVLAI  249
                 C  VWES L  R  KS+PGLVLAI
Sbjct  191  AGSTQCLPVWESRLHQRARKSLPGLVLAI  219



>gb|AFW77785.1| hypothetical protein ZEAMMB73_323824 [Zea mays]
Length=204

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 97/163 (60%), Gaps = 8/163 (5%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ--FLMRILTGTATA  543
            E      +K VV  L  AL   DVD V++L   D++WWFHGP +HQ   LMR+LTGT  A
Sbjct  43   EDSSAVSSKAVVEELYRALERGDVDAVRRLLNPDVDWWFHGPRAHQHLVLMRLLTGTG-A  101

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFG  366
            G    F+   +DA GPTV  EG D +  + WVHAWTV   G +T VREY NT+L VTR G
Sbjct  102  GAGLPFKIRSLDAFGPTVLAEGADATGALYWVHAWTVGPGGRVTGVREYCNTALVVTRLG  161

Query  365  NHsasaaaaAITPLHCPS----VWESSLPNRVGKSVPGLVLAI  249
               A+   A  T    PS    VW+S LP+R  +++PGLVLAI
Sbjct  162  GGGAAVERAKATCSLSPSPSKQVWQSRLPDRARRNLPGLVLAI  204



>ref|XP_010464791.1| PREDICTED: wound-induced protein 1-like [Camelina sativa]
 ref|XP_010486721.1| PREDICTED: wound-induced protein 1-like [Camelina sativa]
Length=106

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG  +   SF F PL V + G TV  EG D + +++W+HAWTV +GIITQVREY N
Sbjct  1    MRMLTGGVS--PSFEFVPLSVVSFGSTVIAEGCDAATSVSWIHAWTVANGIITQVREYSN  58

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR GN  A   +A I P HCPSVWES    R GKSVPGLVLAI
Sbjct  59   TSLTVTRIGNVVAGRRSAEIAPSHCPSVWESQFSGRAGKSVPGLVLAI  106



>ref|XP_008650816.1| PREDICTED: uncharacterized protein LOC100191899 isoform X1 [Zea 
mays]
Length=224

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 95/159 (60%), Gaps = 20/159 (13%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSH-QFLMRIL--TGTATAGDS  534
            E RNK +VL L EAL++RD   VQ L A DLEWWFHGPP H Q +MR+L  T T T   S
Sbjct  79   EQRNKFLVLRLYEALNARDHAAVQSLLAPDLEWWFHGPPKHQQHMMRLLTTTTTTTTTGS  138

Query  533  FRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFG  366
            FRF P  VDA+     TV  EG +  R   WVHAWTV  DG+ITQ+REYFNT LTVTR  
Sbjct  139  FRFVPRSVDALAASSGTVIAEGHE--RGCYWVHAWTVGPDGVITQLREYFNTDLTVTRLA  196

Query  365  NHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                         +    VW+S  P+    S+PGL+LA+
Sbjct  197  -----------AAVAAKCVWQSRRPDSATNSLPGLLLAL  224



>ref|XP_010489944.1| PREDICTED: wound-induced protein 1-like [Camelina sativa]
Length=106

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG  +   SF F PL V + G TV  EG D + +++W+HAWTV +GIITQVREY N
Sbjct  1    MRMLTGGVS--PSFEFVPLSVVSFGSTVIAEGCDAATSVSWIHAWTVANGIITQVREYSN  58

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR GN  A   +A I P HCPSVWES    R GKSVPGLVLAI
Sbjct  59   TSLTVTRIGNVVAGRRSAEIAPSHCPSVWESQFSGRSGKSVPGLVLAI  106



>ref|XP_010094677.1| hypothetical protein L484_003306 [Morus notabilis]
 gb|EXB56619.1| hypothetical protein L484_003306 [Morus notabilis]
Length=453

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -2

Query  722  IQETXEETRNKRVVLALXEALSS-RDVDL-VQKLXASDLEWWFHGPPSHQFLMRILTGTA  549
            I    +E RNK ++  L EA ++  ++D  V  L A  LEWWFHGPPSHQ L R+LTGT+
Sbjct  36   ITSLIQEERNKSIITTLYEAFNNFNNIDQSVHLLFAPYLEWWFHGPPSHQHLKRLLTGTS  95

Query  548  TAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTR  372
                SF F PL V A   TV VEG DL R+++WVHAWT++ DGIIT VREY+NTS+TVTR
Sbjct  96   PNNMSFPFVPLSVAAFESTVIVEGCDLERSVSWVHAWTISPDGIITHVREYYNTSVTVTR  155

Query  371  FGNHsasaaaaAITPL--------HCPSVWESSL  294
             GN  A ++ ++ +          +C SVW+S L
Sbjct  156  LGNSEAMSSRSSSSSSSEITAANKNCQSVWKSKL  189



>gb|AFV36703.1| wound-inducible protein 12 [Glycine max]
 gb|AFV36708.1| wound-inducible protein 12 [Glycine max]
 gb|AFV36712.1| wound-inducible protein 12 [Glycine max]
 gb|AFV36715.1| wound-inducible protein 12 [Glycine max]
Length=107

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 77/113 (68%), Gaps = 11/113 (10%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG + A +SFRF P  + A G TV VEG D +RNI WVHAWTVTDG+ITQ+REYFN
Sbjct  1    MRMLTGDSAADNSFRFVPQSIAAFGSTVIVEGCDSARNIAWVHAWTVTDGMITQIREYFN  60

Query  392  TSLTVTRFGNHsasaaaaAITPLHC-----PSVWESSLPNRVGKSVPGLVLAI  249
            T+LTVTR  +         I P        P VWESS+  RVGKSVPGLVLAI
Sbjct  61   TALTVTRIHDS------GEIVPARSGAGRLPCVWESSVSGRVGKSVPGLVLAI  107



>ref|XP_007163595.1| hypothetical protein PHAVU_001G247700g [Phaseolus vulgaris]
 gb|ESW35589.1| hypothetical protein PHAVU_001G247700g [Phaseolus vulgaris]
Length=106

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 78/113 (69%), Gaps = 12/113 (11%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG +TA ++FRF P  V A G TV VEG D +RNI WVHAWTV DGIITQVREYFN
Sbjct  1    MRMLTGDSTA-ETFRFVPQSVAAFGSTVIVEGCDTARNIAWVHAWTVADGIITQVREYFN  59

Query  392  TSLTVTRFGNHsasaaaaAITPLHC-----PSVWESSLPNRVGKSVPGLVLAI  249
            T+LTVTRF +         I P        P VWESS+  RVGKSVPGLVLAI
Sbjct  60   TALTVTRFEDS------GEIVPASSGAGRFPCVWESSVSGRVGKSVPGLVLAI  106



>ref|XP_011032575.1| PREDICTED: wound-induced protein 1-like [Populus euphratica]
Length=162

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 98/167 (59%), Gaps = 26/167 (16%)
 Frame = -2

Query  722  IQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA  543
            + +   E +NK +V AL + LS+ ++  V K  ASDLEWWFHGPP  Q +MR+LTG ++ 
Sbjct  13   VSDLNAEMQNKAIVDALYKGLSNGEMATVAKFIASDLEWWFHGPPKCQHMMRMLTGDSSQ  72

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT----  375
               FRFEP  ++AIG  V +EG + ++ + WVH WT+ DG+ITQ REYFNT LTVT    
Sbjct  73   -TQFRFEPRNIEAIGDCVIIEGWEGAQ-VYWVHVWTLKDGVITQFREYFNTWLTVTDTSP  130

Query  374  -----RFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                 R  NH               ++W+S   +   +S+PGLVL I
Sbjct  131  QGWKIRHENH---------------TLWQSHPRDLFNRSLPGLVLGI  162



>ref|XP_006486226.1| PREDICTED: wound-induced protein 1-like [Citrus sinensis]
Length=125

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 83/125 (66%), Gaps = 16/125 (13%)
 Frame = -2

Query  575  LMRILTGTATAGDS----FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQV  408
            +M +LTG+ TA  +    F F PL + + GP V  EG D SR I+WVHAWTV DGIITQV
Sbjct  1    MMHLLTGSTTASSASQSSFVFVPLSITSFGPIVLAEGCDHSRQISWVHAWTVADGIITQV  60

Query  407  REYFNTSLTVTRFGNHsasa------------aaaAITPLHCPSVWESSLPNRVGKSVPG  264
            REYFNTSLTVTRFG   +              + A I P+HCPSVWESS+ NR GKSVPG
Sbjct  61   REYFNTSLTVTRFGKDLSGQSQRKKSPPSDFPSTAEINPVHCPSVWESSVSNRDGKSVPG  120

Query  263  LVLAI  249
            LVLA+
Sbjct  121  LVLAL  125



>ref|XP_010658205.1| PREDICTED: wound-induced protein 1 [Vitis vinifera]
Length=120

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 81/121 (67%), Gaps = 13/121 (11%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            +MR+LTG  ++ +SF FEPL   + G TV  EG D S +I WVHAWTVTDG+ITQVREYF
Sbjct  1    MMRLLTG-VSSDESFVFEPLAFASFGSTVLAEGCDHSGSIAWVHAWTVTDGVITQVREYF  59

Query  395  NTSLTVTRFGNHsasaaaaAITPL------------HCPSVWESSLPNRVGKSVPGLVLA  252
            NTSLTVTR  N   + + ++                HCPSVWESS  +RVGKSVPGLVLA
Sbjct  60   NTSLTVTRLSNSDFTTSPSSSISAASSSSTPSPPSRHCPSVWESSFSDRVGKSVPGLVLA  119

Query  251  I  249
            I
Sbjct  120  I  120



>ref|XP_007142081.1| hypothetical protein PHAVU_008G251000g [Phaseolus vulgaris]
 gb|ESW14075.1| hypothetical protein PHAVU_008G251000g [Phaseolus vulgaris]
Length=209

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 98/156 (63%), Gaps = 9/156 (6%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTGTATAGDSF  531
            +E RNK+ V  L +A++S+D + + +L A DLEWWFHGPPSH+  L+ +LT TAT+  S 
Sbjct  60   QEDRNKKTVTDLYKAITSKDTNTMYRLLAPDLEWWFHGPPSHRHHLIPLLTATATSSPSK  119

Query  530  R-FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHs  357
                P  +   G     EG D +  + WVHAWT T DG+IT+VREY NTS+TVTR G H 
Sbjct  120  PVLVPDHIVGFGSVTIAEGFDETNLVWWVHAWTTTADGVITEVREYVNTSVTVTRLGFH-  178

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
               +   +    C SVW+S+L     +SVPGL+LAI
Sbjct  179  --GSDDVVASAMCQSVWQSTL---CDESVPGLILAI  209



>ref|XP_008369311.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
 ref|XP_008345315.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
Length=126

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 82/128 (64%), Gaps = 22/128 (17%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MRILTG+    + F+F P    + GPTV VEG D   +I+WVHAWTV +G+IT VREYFN
Sbjct  1    MRILTGSQK--EPFQFVPQSFASFGPTVLVEGCDCDCSISWVHAWTVANGVITGVREYFN  58

Query  392  TSLTVTRFGNHsasaa--------------------aaAITPLHCPSVWESSLPNRVGKS  273
            TSLTVTR GN++ + +                     A IT  HCPSVWESS+ NRVGKS
Sbjct  59   TSLTVTRLGNNTQNNSPASSSKSSPSGFSSNSSSSSTAEITSFHCPSVWESSVSNRVGKS  118

Query  272  VPGLVLAI  249
            VPGLVLAI
Sbjct  119  VPGLVLAI  126



>tpg|DAA44925.1| TPA: hypothetical protein ZEAMMB73_311719 [Zea mays]
Length=262

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 99/176 (56%), Gaps = 26/176 (15%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E+ EE RN+ +VL L EAL++RD    Q+L A DLEWWFHGPP+ Q +MR+LTG A    
Sbjct  93   ESAEE-RNRFLVLRLYEALNARDARRAQELLAPDLEWWFHGPPARQHMMRLLTG-ALDHR  150

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGNH  360
             F F P  VDA G TV  EG D +R + WVHAWTV   G+ITQ+REYFNT LT+      
Sbjct  151  GFVFSPRSVDAFGSTVVAEGADDARQLYWVHAWTVGPHGVITQLREYFNTDLTL--LSGQ  208

Query  359  sasaaaaAITPLH-------------------CPSVWESSLPNRVGKSVPGLVLAI  249
                AA A  P                     C  +W+S   +   KS+PGLVLAI
Sbjct  209  PDVVAAGAAPPKQKDAASSSSPSVAAPAAGPKC--LWQSRRADSAHKSLPGLVLAI  262



>gb|ADJ67179.1| hypothetical protein [Jatropha curcas]
Length=105

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 74/104 (71%), Gaps = 16/104 (15%)
 Frame = -2

Query  512  VDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa----  345
            + A G  V  EG D +R+I+WVHAWTVTDGIITQVREYFNTSLTVTRFGN + S +    
Sbjct  2    IRAFGSVVIAEGCDPTRSISWVHAWTVTDGIITQVREYFNTSLTVTRFGNQNQSESSDYS  61

Query  344  ------------aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                         A ITP+HCPSVWESSL NRVGKSVPGLVLAI
Sbjct  62   CSSSSSSSPSSPKAEITPVHCPSVWESSLSNRVGKSVPGLVLAI  105



>ref|XP_003559751.1| PREDICTED: uncharacterized protein LOC100839760 [Brachypodium 
distachyon]
Length=224

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 92/160 (58%), Gaps = 16/160 (10%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            Q    E R+K +VL L EAL + D   V  L A DLEWWFHGPP HQ +M +LTGT ++ 
Sbjct  78   QRETAEQRDKFLVLRLYEALGAGDRAAVHSLLAPDLEWWFHGPPKHQHMMHLLTGTPSS-  136

Query  539  DSFRFEPLKVDAI--GPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRF  369
             SF F P  VDA+    TV  EG        WVHAWTV  DG+ITQ+REYFNT LTVTR 
Sbjct  137  -SFAFVPHSVDALPGSGTVIAEGAGEHGGCYWVHAWTVGPDGVITQLREYFNTDLTVTRL  195

Query  368  GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +S               VW+S  P++   S+P L+LA+
Sbjct  196  LANSGKC-----------CVWQSRRPDQAQNSLPCLLLAL  224



>ref|XP_002468012.1| hypothetical protein SORBIDRAFT_01g038035 [Sorghum bicolor]
 gb|EER95010.1| hypothetical protein SORBIDRAFT_01g038035 [Sorghum bicolor]
Length=224

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 104/180 (58%), Gaps = 29/180 (16%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR-  528
            E RN+ +VL L EAL++RD    Q+L A DLEWWFHGPP+ Q +MR+LTG A   D  R 
Sbjct  46   EQRNRFLVLWLYEALNARDARRAQELLAPDLEWWFHGPPTRQHMMRLLTG-ADQRDKSRG  104

Query  527  -------FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVT-  375
                   F P  VDA G TV  EG D +R + WVHAWTV  DG+ITQ+REYFNT LTVT 
Sbjct  105  GGGVGFVFSPRSVDAFGSTVIAEGADDARQLYWVHAWTVGPDGVITQLREYFNTDLTVTL  164

Query  374  -----------------RFGNHsasaaaaAITPLHCPS-VWESSLPNRVGKSVPGLVLAI  249
                             R    +AS++ ++ +    P  +W+S   +   KS+PGLVLAI
Sbjct  165  LSGAAASAKKADIAGAPRKQQDAASSSFSSPSAAAGPKCLWQSRRGDSAHKSLPGLVLAI  224



>ref|XP_011032574.1| PREDICTED: wound-induced protein 1-like [Populus euphratica]
Length=161

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 91/152 (60%), Gaps = 8/152 (5%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +NK +V AL + LS+  +  V KL ASDLEWWFHGPP  Q++MRILTG ++    F+F
Sbjct  18   EMQNKGIVDALYKGLSNGHMGTVAKLIASDLEWWFHGPPQCQYMMRILTGKSSH-TKFKF  76

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  ++ +G  V  EG + ++ + WVH WT+ D +ITQ REYFNT LTV     H     
Sbjct  77   EPRSIEVVGDCVIAEGWEGAQ-VYWVHVWTLKDSVITQFREYFNTWLTVKDISPHGWEIR  135

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                T      +W+S   +   +S+PGL+L I
Sbjct  136  HENHT------LWQSHPRDLFSRSLPGLILGI  161



>gb|ACJ85651.1| unknown [Medicago truncatula]
 gb|ACJ85969.1| unknown [Medicago truncatula]
 gb|AFK37668.1| unknown [Medicago truncatula]
Length=107

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 76/109 (70%), Gaps = 3/109 (3%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR LTG  TA D+FRF P  V + G TV VEG D SR I+WVHA TV DGI+TQVREYFN
Sbjct  1    MRTLTGDTTAVDTFRFVPQSVISFGSTVIVEGCDTSRAISWVHALTVVDGIVTQVREYFN  60

Query  392  TSLTVTRF-GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVT F G  S     A     HC  VWESS+ +RVGKSVPGLVLAI
Sbjct  61   TSLTVTHFAGKDSGEIVPANPGGFHC--VWESSVSDRVGKSVPGLVLAI  107



>ref|XP_010256988.1| PREDICTED: wound-induced protein 1 [Nelumbo nucifera]
Length=160

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 8/153 (5%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            EE RNK  +  L + L+  D + V +L A+DLEWWFHGPP  Q +MR+LTG +T  + F+
Sbjct  16   EEMRNKVTLKELYDGLAWEDTETVARLLATDLEWWFHGPPRCQHMMRLLTGQSTRAE-FK  74

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            FEP  + AI   V VEG + ++   WVH WT+ DG+ITQ REYFNT LTV          
Sbjct  75   FEPRSITAIDDRVIVEGWEGTQAY-WVHVWTLKDGLITQFREYFNTWLTVKDLRPPVWEI  133

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                      P++W+S     + +S+PGLVLAI
Sbjct  134  GQDR------PTLWQSEPEKHLHRSLPGLVLAI  160



>ref|XP_008809984.1| PREDICTED: wound-induced protein 1-like [Phoenix dactylifera]
Length=107

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (74%), Gaps = 4/110 (4%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREY  399
            +MR+LTG A+  +SF F PL ++A G TV VEG D  R++ WVHAWTVT DGIITQVREY
Sbjct  1    MMRLLTG-ASPEESFEFAPLSIEAFGSTVLVEGTDRPRSVYWVHAWTVTPDGIITQVREY  59

Query  398  FNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            FNTSLTVTR G   +S++   +   HC  VW+S LP+R  KS+PGLVLAI
Sbjct  60   FNTSLTVTRIGARDSSSSNVPMP--HCLPVWQSKLPDRDRKSLPGLVLAI  107



>ref|NP_001131159.1| uncharacterized protein LOC100192467 [Zea mays]
 gb|ACF79454.1| unknown [Zea mays]
 gb|AFW88654.1| hypothetical protein ZEAMMB73_923403 [Zea mays]
Length=203

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 98/184 (53%), Gaps = 32/184 (17%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTG-------TAT  546
            E RN+ +VL L EAL S D    +KL A DLEWWFHGPP+ Q +MR+LTG       +  
Sbjct  20   EQRNRFLVLRLYEALGSCDARRARKLLAPDLEWWFHGPPTRQHMMRLLTGADHQRHMSGG  79

Query  545  AGDSFRFEPLKVDAIGPTVFVE-GQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTR  372
             G  F F P  VDA G TV  E G D +R + WVHAWTV  DG+ITQ+REYFNT LTVT 
Sbjct  80   GGGGFAFSPRSVDAFGSTVVAEGGADDARQLYWVHAWTVGPDGVITQLREYFNTDLTVTL  139

Query  371  FGNHsasaaaa-----------------------AITPLHCPSVWESSLPNRVGKSVPGL  261
                +++  AA                       +        +W+S   +   KS+PGL
Sbjct  140  LAGTASAKKAAPPKKQQDAASSSTSSSSPPSAASSSAAAGSKCLWQSRRADSAHKSLPGL  199

Query  260  VLAI  249
            VLAI
Sbjct  200  VLAI  203



>ref|XP_003544323.2| PREDICTED: uncharacterized protein LOC100792027 [Glycine max]
Length=160

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 94/155 (61%), Gaps = 12/155 (8%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTGTATAGDSF  531
            +E  NKR V+ L  A+ S D D +Q+L A DLEWWFHGPP H+  L+ +LTG++    S 
Sbjct  16   QEDPNKRGVIDLYNAILSNDTDTMQRLLAPDLEWWFHGPPCHRHHLVPLLTGSS----SK  71

Query  530  RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTD-GIITQVREYFNTSLTVTRFGNHsa  354
               P  V   G     EG D S  + WVHAWT TD GIIT+VREY NTS+TVT+ G H  
Sbjct  72   PLVPDLVVGFGSVTIAEGFDESNLVWWVHAWTTTDEGIITEVREYVNTSVTVTKLGLHVN  131

Query  353  saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +    + T   C SVW+S L     +SVPGL+LAI
Sbjct  132  NDDVVSAT---CQSVWQSKL---CDESVPGLILAI  160



>ref|XP_008370220.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
 ref|XP_009373116.1| PREDICTED: wound-induced protein 1 [Pyrus x bretschneideri]
Length=140

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 13/151 (9%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +NK +V AL +AL+    D V KL ASDLEWWFHGPP  Q +MR+LTG ++  D FRFEP
Sbjct  2    QNKAIVEALYKALAQGKTDTVGKLLASDLEWWFHGPPKSQHMMRVLTGKSSHTD-FRFEP  60

Query  518  LKVDAIGPTVFV-EGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
              +  IG  V + EG + ++   WVHAWT+ DG+ITQ REYFNT LTV            
Sbjct  61   RSITEIGDGVIIAEGWEGAKAY-WVHAWTLKDGLITQFREYFNTWLTVRDL---------  110

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +      +VWES   +   +S+P L+LAI
Sbjct  111  -KLEGWESFTVWESMPNDLFHRSLPALLLAI  140



>gb|AAD23999.1|AF117224_1 wound-induced protein WI12 [Mesembryanthemum crystallinum]
Length=119

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            M +LTG   +  SF+F P  + A G  V  EG D +R+I+WVHAWTVTDGIITQVREYFN
Sbjct  1    MLLLTGADLSPSSFQFNPQSIVAFGSLVLAEGCDPTRSISWVHAWTVTDGIITQVREYFN  60

Query  392  TSLTVTRFG---NHsasaaaaAITPL--------HCPSVWESSLPNRVGKSVPGLVLAI  249
            TS+TVTR G   N++ S  +  I P         HC  VWESSL NR GKSVPGL++A+
Sbjct  61   TSVTVTRLGAGNNNTQSQPSDQIVPAAAHSSHLHHCQPVWESSLANRAGKSVPGLIVAL  119



>emb|CDX73898.1| BnaA03g31490D [Brassica napus]
Length=104

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 75/108 (69%), Gaps = 4/108 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR LTG +    +F F PL V + G TV  EG D++ +I+W+HAWTV  GIITQVREY N
Sbjct  1    MRTLTGVS---PTFEFVPLSVVSFGSTVIAEGCDVASSISWIHAWTVAHGIITQVREYSN  57

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G+   +  +A I P HCPSVWES    R GKSVPGLVLAI
Sbjct  58   TSLTVTRVGD-VVAGRSAEIAPSHCPSVWESQFSGRAGKSVPGLVLAI  104



>gb|KFK38485.1| hypothetical protein AALP_AA3G119100 [Arabis alpina]
Length=104

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 75/108 (69%), Gaps = 4/108 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MRILTG +    +F F PL V + G TV  EG D + +I+W+HAWTV+ GI+TQVREY N
Sbjct  1    MRILTGVS---PTFDFLPLSVVSFGSTVIAEGCDPASSISWIHAWTVSHGIVTQVREYSN  57

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            T+LTVTR GN   +   A I P HCPSVWES    R GKSVPGLVLAI
Sbjct  58   TALTVTRIGN-VVAGRTAEIKPSHCPSVWESQFSGRAGKSVPGLVLAI  104



>ref|XP_010921069.1| PREDICTED: wound-induced protein 1-like [Elaeis guineensis]
Length=109

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREY  399
            +MR+LTG A+  ++F+F PL ++A+G TV VEG D +R++ WVHAWTV+ DGIITQVREY
Sbjct  1    MMRLLTG-ASPAETFKFVPLSIEALGSTVLVEGTDPARSVYWVHAWTVSADGIITQVREY  59

Query  398  FNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            FNTS+TVTR G+  +S++ + +   HC  VW+S LP++  KS+PGLVLAI
Sbjct  60   FNTSVTVTRVGSGDSSSSTSKVPKTHCLPVWQSRLPDQARKSLPGLVLAI  109



>ref|XP_002323037.1| hypothetical protein POPTR_0016s13730g [Populus trichocarpa]
 gb|EEF04798.1| hypothetical protein POPTR_0016s13730g [Populus trichocarpa]
Length=143

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 8/150 (5%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +NK +V AL + LS+     V KL ASDLEWWFHGPP  Q +MRILTG ++    F+FEP
Sbjct  2    QNKGIVDALYKGLSNGHTGTVAKLIASDLEWWFHGPPRCQHMMRILTGESSH-TKFKFEP  60

Query  518  LKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaa  339
              ++ +G  V  EG + ++ + WVH WT+ DG+ITQ REYFNT LTV     H       
Sbjct  61   RSIEVVGDCVIAEGWEGAQ-VYWVHVWTLKDGVITQFREYFNTWLTVKDISPHGWEIRHE  119

Query  338  AITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              T      +W+S   +   +S+PGL+L I
Sbjct  120  NHT------LWQSHPRDLFSRSLPGLILGI  143



>ref|XP_009392731.1| PREDICTED: wound-induced protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=144

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 89/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
             K +V +L ++L+  D+  V  L A D+EWWFHGP   Q++ R+LTG A  GD FRF P 
Sbjct  3    TKGLVESLYDSLARGDMKAVAALMAEDVEWWFHGPRRCQYMRRLLTGEAGHGD-FRFRPR  61

Query  515  KVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaA  336
             V AIG  V  EG +  ++  WVHAW V  G+IT+ REYFNTS+TV   G    S  +  
Sbjct  62   TVTAIGGWVVAEGWE-GKHAYWVHAWAVDGGVITRFREYFNTSVTVRECGGGCTSTVSGD  120

Query  335  ITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
               L     W+S  P + G+S+PGLVLA+
Sbjct  121  GGTL-----WQSRAPAQGGRSLPGLVLAV  144



>ref|NP_974279.1| senescence associated protein 20 [Arabidopsis thaliana]
 gb|AAK76646.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14294.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67338.1| wound-induced protein WI12 [Arabidopsis thaliana]
 gb|AAN31907.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74988.1| senescence associated protein 20 [Arabidopsis thaliana]
Length=110

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -2

Query  572  MRILTGTAT-AGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            MR+LTG  + +  SF F PL V + G TV  EG D + +I+W+HAWTV +GIITQVREY 
Sbjct  1    MRVLTGGVSPSSSSFEFVPLSVVSFGSTVIAEGCDAATSISWIHAWTVANGIITQVREYS  60

Query  395  NTSLTVTRFGNHsasaaaaAIT-PLHCPSVWESSLPNRVGKSVPGLVLAI  249
            NTSLTVTR GN  A   +A I  P HC SVWES    R GK VPGLVLAI
Sbjct  61   NTSLTVTRIGNVVAGRRSAEIAPPSHCSSVWESQFSGRAGKPVPGLVLAI  110



>ref|XP_003615958.1| Wound-induced protein [Medicago truncatula]
 gb|AES98916.1| wound-induced-like protein [Medicago truncatula]
Length=153

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 96/156 (62%), Gaps = 10/156 (6%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTGTATAGDSF  531
            +E  NK++V  L +AL S+D + +Q L ASDLEWWFHGPP H+ +L+ ILTG++++    
Sbjct  5    QEDHNKKLVTDLYKALISKDTNTMQHLLASDLEWWFHGPPCHRHYLVPILTGSSSSSSIS  64

Query  530  R--FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            +    P  +   G  +  EG D    + WVHAW+++DGIIT+VREY NTS+ VT+ G H 
Sbjct  65   QESLVPNLIIGFGSVIVAEGYDEKNMVWWVHAWSISDGIITEVREYVNTSVYVTKLGLH-  123

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
               +   +    C  +W+S L +    SVPGL+L I
Sbjct  124  ---SEDVVVGSSCRCIWQSKLCD---GSVPGLILTI  153



>ref|XP_009369237.1| PREDICTED: wound-induced protein 1 [Pyrus x bretschneideri]
Length=126

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 82/128 (64%), Gaps = 22/128 (17%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MRILTG+    + F+F P  + + GPTV VEG D   +I+WVHAWTV +G+IT VREYFN
Sbjct  1    MRILTGSQK--EPFQFVPQSIASFGPTVLVEGCDRDCSISWVHAWTVANGVITGVREYFN  58

Query  392  TSLTVTRFGNHsasaaaaAITP--------------------LHCPSVWESSLPNRVGKS  273
            TSLTVTR GN++ + + A+                        HCPSVWESS+ NRVGKS
Sbjct  59   TSLTVTRLGNNTENTSPASSAKSSPSGFSSKSSSSSTSEITSFHCPSVWESSVSNRVGKS  118

Query  272  VPGLVLAI  249
            VPGLVLAI
Sbjct  119  VPGLVLAI  126



>ref|XP_008374432.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
Length=124

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 82/126 (65%), Gaps = 20/126 (16%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR+LTG+    +SF+F P  + + GPTV VEG D   +I+WVHAWTV  G++T VREYFN
Sbjct  1    MRLLTGSQN--ESFQFVPQSIASFGPTVLVEGCDRDCSISWVHAWTVASGVVTGVREYFN  58

Query  392  TSLTVTRFGN------------------HsasaaaaAITPLHCPSVWESSLPNRVGKSVP  267
            T+LTVTR GN                  + AS++AA IT  H PSVWESS  NR GKS+P
Sbjct  59   TTLTVTRLGNNSHRNSPASSAKSSSGFSYEASSSAAEITSFHFPSVWESSXSNRAGKSMP  118

Query  266  GLVLAI  249
            GLVLAI
Sbjct  119  GLVLAI  124



>ref|XP_007134612.1| hypothetical protein PHAVU_010G061500g [Phaseolus vulgaris]
 gb|ESW06606.1| hypothetical protein PHAVU_010G061500g [Phaseolus vulgaris]
Length=166

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 86/154 (56%), Gaps = 9/154 (6%)
 Frame = -2

Query  707  EETRNKRVVLALXEAL-SSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSF  531
            EE +N+  V  L +AL     +D V  + ASDLEWWFHGPP  Q +MR+LTG     + F
Sbjct  21   EEMQNRETVETLYKALLGEGQMDTVANMLASDLEWWFHGPPQCQHMMRVLTGETALNNGF  80

Query  530  RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsas  351
            RFEP  + AIG  V  EG +      WVH WTV +G ITQ REYFNT L V    + +  
Sbjct  81   RFEPRSLTAIGDCVIAEGWE--GKAYWVHVWTVKNGTITQFREYFNTWLVVRDLRSQTWE  138

Query  350  aaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                 +T      +W+S   +   +S+PGLVLAI
Sbjct  139  KRLENMT------LWQSQPRDLYRRSLPGLVLAI  166



>ref|XP_010938273.1| PREDICTED: wound-induced protein 1 [Elaeis guineensis]
Length=157

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 3/151 (2%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
            NKR+V +L EALS  D + V  L A DLEWWFHGP   + + R+LTG A  GD FRF P 
Sbjct  8    NKRLVESLYEALSRGDTEAVAGLMAEDLEWWFHGPRRCEHMRRVLTGEAGHGDHFRFVPR  67

Query  515  KVDAIGPT--VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            +V  +G    V  EG +      WVHAW V DG+IT+ REYFNT +TV        + A+
Sbjct  68   RVTEVGEGGWVVAEGWE-GDQAYWVHAWAVEDGVITRFREYFNTWVTVRELSPRMPTEAS  126

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            ++      P++W+S     + +S+P LVLAI
Sbjct  127  SSRGSREAPALWQSEALVHLRRSLPTLVLAI  157



>ref|XP_010067573.1| PREDICTED: wound-induced protein 1-like [Eucalyptus grandis]
 gb|KCW65734.1| hypothetical protein EUGRSUZ_G03106 [Eucalyptus grandis]
Length=115

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = -2

Query  572  MRILTGTATAGDS-------FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIIT  414
            MR+LTG +++  S       F F P  + +IG  V  EG D  R+I W+HAWTV DGI+T
Sbjct  1    MRLLTGASSSPSSAAASDDSFEFVPDSITSIGSIVLAEGCDQKRSIYWIHAWTVADGIVT  60

Query  413  QVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            QVREYFNTSLTVTR G  + S  A A    HC S+WES+L NRVGKSVPGLVLAI
Sbjct  61   QVREYFNTSLTVTRLGGATRSEIAPAAGFHHCTSIWESNLSNRVGKSVPGLVLAI  115



>ref|XP_008809983.1| PREDICTED: LOW QUALITY PROTEIN: wound-induced protein 1 [Phoenix 
dactylifera]
Length=157

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 92/151 (61%), Gaps = 3/151 (2%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
            NKR+V +L EAL+  D + V  + A D+EWWFHGP   + + R+LTG A  GD FRF+P 
Sbjct  8    NKRLVESLYEALARGDAEAVAGMMAEDVEWWFHGPRRCEHMRRVLTGEAGHGDHFRFDPR  67

Query  515  KVDAIGPTVFV--EGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            +V   G   +V  EG +      WVHAW V DG+IT+ REYFNT +TV      S  A++
Sbjct  68   RVTXGGGGGWVVAEGWE-GDQAYWVHAWAVEDGVITRFREYFNTWVTVRELSQISLGASS  126

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            AA      P+VW+S     + +S+PGLVLAI
Sbjct  127  AARGSRDSPAVWQSEARVHLRRSLPGLVLAI  157



>ref|XP_009135140.1| PREDICTED: wound-induced protein 1-like [Brassica rapa]
 ref|XP_009135141.1| PREDICTED: wound-induced protein 1-like [Brassica rapa]
Length=104

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR LTG +    +F F PL V + G TV  EG D++ +I+W+HAWTV  GIITQVREY N
Sbjct  1    MRTLTGVS---PTFEFVPLSVVSFGSTVIAEGCDVASSISWIHAWTVAHGIITQVREYSN  57

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G+   S  +A I P HC SVWES    R GKSVPGLVLAI
Sbjct  58   TSLTVTRVGD-VVSGRSAEIAPSHCLSVWESQFSGRAGKSVPGLVLAI  104



>emb|CDY00710.1| BnaC03g36940D [Brassica napus]
Length=104

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR LTG +    +F F PL V + G TV  EG D++ +I+W+HAWTV  GIITQVREY N
Sbjct  1    MRTLTGVS---PTFEFVPLSVVSFGSTVIAEGCDVASSISWIHAWTVAHGIITQVREYSN  57

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G+   +  +A I P HC SVWES    R GKSVPGLVLAI
Sbjct  58   TSLTVTRVGD-VVAGWSAEIAPSHCLSVWESQFSGRAGKSVPGLVLAI  104



>ref|XP_010695470.1| PREDICTED: wound-induced protein 1 [Beta vulgaris subsp. vulgaris]
Length=116

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 79/116 (68%), Gaps = 8/116 (7%)
 Frame = -2

Query  572  MRILTGTATAG--DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREY  399
            MR+LTG  + G   SF F P    A G  V  EG D SR+I+WVHAWTVTDGIITQV+EY
Sbjct  1    MRLLTGITSDGQDSSFVFTPQSTVAFGSLVIAEGCDHSRSISWVHAWTVTDGIITQVKEY  60

Query  398  FNTSLTVTRFGNHsasaaaaA------ITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             NTS+TVTR GN+++S  A A      I   +C  +WESS+ NR GKSVPGLVLA+
Sbjct  61   LNTSVTVTRLGNNNSSNIATASSEQNQIRHHYCQPLWESSVANRGGKSVPGLVLAL  116



>ref|XP_009122489.1| PREDICTED: wound-induced protein 1-like [Brassica rapa]
Length=104

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR LTG +     F F PL V + G TV  EG D + +++W+HAWTV+ GIITQVREY N
Sbjct  1    MRTLTGVS---PPFEFVPLSVVSFGSTVIAEGCDAASSVSWIHAWTVSHGIITQVREYSN  57

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G    +  +A I   HCPSVWES    R GKSVPGLVLAI
Sbjct  58   TSLTVTRIGG-VVAGRSAEIARSHCPSVWESKFSGRAGKSVPGLVLAI  104



>ref|XP_004490683.1| PREDICTED: uncharacterized protein LOC101505732 [Cicer arietinum]
Length=161

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 94/159 (59%), Gaps = 10/159 (6%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSH-QFLMRILTGTATAGDSF  531
            +E  NK++V  L +AL ++D + +Q L ASDLEWWFHGPP H  +L+  LT  +++    
Sbjct  7    KEDHNKKLVTDLYKALVTKDTNTMQNLLASDLEWWFHGPPCHSHYLVSYLT-CSSSSSKK  65

Query  530  RFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsas  351
               P  +   G  +  EG D    + WVHAW++ +GIIT+VREY NTSLTVT+ GN    
Sbjct  66   SLVPNIIIGFGSVIVAEGFDEENKVWWVHAWSICNGIITEVREYVNTSLTVTKLGNLHFP  125

Query  350  aaaaAITPLH-----CPSVWESSLPNRVGKSVPGLVLAI  249
             + + ++        C  +W+S L +   +SVPGL+L +
Sbjct  126  MSQSVVSKEDVVGSTCRCIWQSKLCD---ESVPGLILTV  161



>ref|XP_009416311.1| PREDICTED: wound-induced protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=147

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 87/148 (59%), Gaps = 4/148 (3%)
 Frame = -2

Query  692  KRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLK  513
            K VV +L EALS  D      L A D+EWWFHGP   Q++ R+LTG A   D FRF P +
Sbjct  4    KEVVESLYEALSRDDAAAAAALMAEDVEWWFHGPRRCQYMRRLLTGEAGHRD-FRFRPRR  62

Query  512  VDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaAI  333
            V  +G  V  EG +  ++  WVHAW V  G+IT+ REYFNT++TV       A A   ++
Sbjct  63   VAEVGGWVVAEGWE-GKHAYWVHAWVVEGGVITRFREYFNTAVTVQEL--RPAEAGMDSV  119

Query  332  TPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                  +VW+S     +G+S+PGLVLAI
Sbjct  120  ARGGGSAVWQSEARAHLGRSLPGLVLAI  147



>ref|XP_003522016.2| PREDICTED: wound-induced protein 1-like [Glycine max]
Length=168

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 88/156 (56%), Gaps = 11/156 (7%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSR-DVDLVQ-KLXASDLEWWFHGPPSHQFLMRILTGTATA-GD  537
            EE  NK  V AL +AL  +  +D V   + ASDLEWWFHGPP  Q +MR+LTG  T   +
Sbjct  21   EEMHNKATVEALYKALLGQGQMDTVATNMLASDLEWWFHGPPQCQHMMRVLTGETTLDNN  80

Query  536  SFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
             FRFEP  V AIG  V  EG +      WVH WTV +G+ITQ REYFNT L V    +  
Sbjct  81   GFRFEPRSVTAIGDCVIAEGWE--GKAYWVHVWTVRNGLITQFREYFNTWLVVRDLRSQR  138

Query  356  asaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   +T      +W+S   +   +S+PGLVLAI
Sbjct  139  WENKLDNMT------LWQSQPRDLYRRSLPGLVLAI  168



>ref|XP_009146785.1| PREDICTED: wound-induced protein 1 [Brassica rapa]
Length=104

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 73/108 (68%), Gaps = 4/108 (4%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            MR L G +     F+F PL V + G TV  EG D + +++W+HAWTV+ G+ITQVREY N
Sbjct  1    MRTLPGVS---PPFQFSPLSVVSFGSTVIAEGCDAASSVSWIHAWTVSHGVITQVREYSN  57

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            TSLTVTR G+   +  +A I   HCPSVWES    R GKSVPGLVLAI
Sbjct  58   TSLTVTRIGS-VVAGRSAEIRASHCPSVWESKFSGRAGKSVPGLVLAI  104



>ref|XP_007206125.1| hypothetical protein PRUPE_ppa013113mg [Prunus persica]
 gb|EMJ07324.1| hypothetical protein PRUPE_ppa013113mg [Prunus persica]
Length=139

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +N  +V AL +AL+    + V KL ASDLEWWFHGPP  Q +MR+LTG A+  D FRFEP
Sbjct  2    QNNAIVEALYKALAQGHTEAVAKLLASDLEWWFHGPPQSQHMMRVLTGEASHTD-FRFEP  60

Query  518  LKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaa  339
              +  +G  V VEG + ++   WVH WT+ +G+IT  REYFNT LTV             
Sbjct  61   RSITEVGDCVIVEGWEGAKAY-WVHVWTLKEGLITHFREYFNTWLTVRDLKPQGWENF--  117

Query  338  AITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                    +VW+S   +   +S+P ++LAI
Sbjct  118  --------TVWQSMPRDLFHRSLPSILLAI  139



>ref|XP_008464249.1| PREDICTED: wound-induced protein 1 [Cucumis melo]
Length=168

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 86/152 (57%), Gaps = 6/152 (4%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E RN+     L ++L++     V K  A+DLEWWFHGPP  Q++MRILTG ++ G+ FRF
Sbjct  23   EQRNRATAETLYKSLAAGRTHAVAKFLAADLEWWFHGPPHCQYMMRILTGESSHGE-FRF  81

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  + AIG +V V        + WVH WT+ DG+ITQ REYFNT L VT     +    
Sbjct  82   EPRSITAIGDSVIVAEGWEGAQVYWVHVWTLKDGLITQFREYFNTWLVVTDLRQPAWEEI  141

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                      +VW S   +   +S+P +VLA+
Sbjct  142  RHD-----GMTVWRSQPRDLFHRSLPAIVLAL  168



>ref|XP_010039519.1| PREDICTED: wound-induced protein 1-like [Eucalyptus grandis]
Length=157

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 9/151 (6%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +NK  V AL  AL+  D D+V KL ASDLEWWFHGPP  Q +MR+LTG +   + F F P
Sbjct  15   KNKATVEALYSALALGDSDVVAKLLASDLEWWFHGPPRCQHMMRVLTGESDYSE-FTFHP  73

Query  518  LKVDAIG-PTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
              + AIG   V  EG + +++  WVHAWT+ +G+ITQ REYFNT LTV    +       
Sbjct  74   RSITAIGDDCVIAEGWEGAQSY-WVHAWTLKNGLITQFREYFNTWLTVREVSSPRWEVRR  132

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            A+ T      +W+S       +S+PGL+LAI
Sbjct  133  ASHT------LWQSRKRELFDQSLPGLLLAI  157



>ref|XP_006359800.1| PREDICTED: wound-induced protein 1-like [Solanum tuberosum]
Length=150

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 90/158 (57%), Gaps = 13/158 (8%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEALSSR--DVDLVQKLXASDLEWWFHGPPSHQFLMRILTG-TATA  543
            +  E  NK +V  L +AL+    D   V  +   DLEWWFHGP +  +LM++LTG  +  
Sbjct  3    SERENNNKAIVKTLYKALACTCGDTKKVTGIIVDDLEWWFHGPQNCHYLMKLLTGEQSNN  62

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN  363
             +SF+FEP  VDAI   V VEG + ++   WVH WT  DG+ITQ REYFNT LTVT    
Sbjct  63   NNSFKFEPRSVDAIDDRVIVEGWEGAK-AYWVHVWTFKDGVITQFREYFNTWLTVTEL--  119

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     +  L   ++W+S   +   +S+PGL+LAI
Sbjct  120  -------RPMGWLRSTTLWQSHPRDLAKRSLPGLMLAI  150



>ref|XP_003632589.1| PREDICTED: wound-induced protein 1 [Vitis vinifera]
Length=159

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 8/152 (5%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E+++K  V+ L  AL++ D  +V  L ASDLEWWFHGPP  Q +MR+LTG +   + F+F
Sbjct  16   ESQDKANVIELYNALANGDTQIVAGLLASDLEWWFHGPPLCQHMMRVLTGESVHTE-FKF  74

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  + AI   V  EG + ++   WVH WT+ +G+ITQ REYFNT LTV           
Sbjct  75   EPRSITAIDGCVIAEGWEGAQAY-WVHVWTLKNGLITQFREYFNTWLTVRDLRPAEWEVR  133

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     P++W+S   +   +S+PGL+LAI
Sbjct  134  H------ESPTLWQSQPRDLAKRSLPGLLLAI  159



>ref|XP_008244813.1| PREDICTED: wound-induced protein 1-like [Prunus mume]
Length=139

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 86/150 (57%), Gaps = 12/150 (8%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +N  +V AL +AL+    + V KL ASDLEWWFHGPP  Q +MR+LTG A+  D FRFEP
Sbjct  2    QNNAIVEALYKALAQGHTEAVAKLLASDLEWWFHGPPQSQHMMRVLTGEASHTD-FRFEP  60

Query  518  LKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaa  339
              +  +G  V VEG + ++   WVH WT+ +G+IT  REYFNT LTV             
Sbjct  61   RSITEVGDCVIVEGWEGAKAY-WVHVWTLKEGLITHFREYFNTWLTVRDLKPQGWENFI-  118

Query  338  AITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     VW+S   +   +S+P ++LAI
Sbjct  119  ---------VWQSMPRDLFHRSLPSIMLAI  139



>ref|XP_006828190.1| hypothetical protein AMTR_s00023p00141210 [Amborella trichopoda]
 gb|ERM95606.1| hypothetical protein AMTR_s00023p00141210 [Amborella trichopoda]
Length=159

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 6/153 (4%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            EE  NK  V+AL  AL   D   V ++ A DLEWWFHGPP  Q++  +LTG +    +F 
Sbjct  13   EEDANKATVMALYAALDGGDCSRVAEILAPDLEWWFHGPPHCQYMKHMLTGESIH-HNFT  71

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F+P  V AIG  +  EG +   ++ WVH W+V +G+ITQVREYFNT + V       +  
Sbjct  72   FKPQSVRAIGSMILAEGWE-GEHMYWVHVWSVVNGLITQVREYFNTWIIVRDL----SPV  126

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
               A       ++W S +  R  KS+PGLVLAI
Sbjct  127  VLKAQDGCEGLTLWRSEVEGRWEKSLPGLVLAI  159



>gb|KCW88252.1| hypothetical protein EUGRSUZ_A00639 [Eucalyptus grandis]
Length=147

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 87/151 (58%), Gaps = 19/151 (13%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +NK  V AL  AL+  D D+V KL ASDLEWWFHGPP  Q +MR+LTG +   + F F P
Sbjct  15   KNKATVEALYSALALGDSDVVAKLLASDLEWWFHGPPRCQHMMRVLTGESDYSE-FTFHP  73

Query  518  LKVDAIG-PTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
              + AIG   V  EG + +++  WVHAWT+ +G+ITQ REYFNT LTV    +       
Sbjct  74   RSITAIGDDCVIAEGWEGAQSY-WVHAWTLKNGLITQFREYFNTWLTVREVSS-------  125

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                       WES       +S+PGL+LAI
Sbjct  126  ---------PRWESRKRELFDQSLPGLLLAI  147



>gb|KJB17136.1| hypothetical protein B456_002G267300 [Gossypium raimondii]
Length=166

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 8/152 (5%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +NK +V  L +AL+  D   V KL  +DLEWWFHGPP    +MR+LTG ++  + FRF
Sbjct  23   EMQNKAIVDTLYKALAHGDTSTVVKLLTTDLEWWFHGPPRCHHMMRMLTGESSHRE-FRF  81

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  ++ +G  V  EG + ++ + WVH WT+ DG+ITQ REYFNT LTV           
Sbjct  82   EPRSIEVVGDCVIAEGWEGAQ-VYWVHVWTLKDGLITQFREYFNTWLTVRDVKPPRWEIG  140

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +   T      +W+S   +   +S+PGL+LAI
Sbjct  141  SDNHT------LWQSQPRDLARRSLPGLLLAI  166



>ref|XP_008782589.1| PREDICTED: wound-induced protein 1-like [Phoenix dactylifera]
Length=109

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREY  399
            +MR+LTG A+  ++F F PL ++A G TV VEG D +R+  WVHAWTV+ DGIITQVREY
Sbjct  1    MMRLLTG-ASPEETFEFLPLSIEAFGSTVLVEGTDRARSSCWVHAWTVSADGIITQVREY  59

Query  398  FNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            F+TS+TVTR G+  +S++ + +   HC  VW+S LP+R  KS+PGLVLAI
Sbjct  60   FDTSVTVTRVGSGDSSSSTSNVPNPHCLPVWQSRLPDRGRKSLPGLVLAI  109



>ref|XP_004492524.1| PREDICTED: wound-induced protein 1-like [Cicer arietinum]
Length=162

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 95/167 (57%), Gaps = 19/167 (11%)
 Frame = -2

Query  722  IQETXEET---RNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTG  555
            +QET +E    +NK +V  L +AL  +  +++V KL ASDLE+WFHGPP  Q +M++LTG
Sbjct  6    LQETHQENFEIQNKGIVEKLYKALLGQGTMEMVSKLLASDLEYWFHGPPKCQHMMKVLTG  65

Query  554  TATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT  375
                   F+FEP  V +I   V +EG +      WVH WT+ +G+ITQ REYFNT L V 
Sbjct  66   EIDHKKGFKFEPRSVTSICECVIIEGWE--GQAYWVHVWTLKNGLITQFREYFNTWLVVR  123

Query  374  -----RFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                 R+ +H            H  ++W S   +   +S+PGLVLAI
Sbjct  124  DLRPPRWEDHKHHD--------HSMTLWRSQPRDLYRRSLPGLVLAI  162



>ref|XP_008388310.1| PREDICTED: wound-induced protein 1-like [Malus domestica]
Length=140

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 87/151 (58%), Gaps = 13/151 (9%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEP  519
            +NK  V AL +AL+    D V KL ASDLEWWFHGPP  Q +M +LTG ++  D FRFEP
Sbjct  2    QNKATVEALYKALAQSQTDTVGKLLASDLEWWFHGPPKSQHMMXVLTGDSSHTD-FRFEP  60

Query  518  LKVDAIGPTVFV-EGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
              +  IG  V + EG + ++   WVH WT+ DG+ITQ REYFNT LTV            
Sbjct  61   RSITEIGGGVIIAEGWEGAKAY-WVHVWTLKDGLITQFREYFNTWLTVKDLKPEG-----  114

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     +VW+S   +   +S+P L+LAI
Sbjct  115  -----WESFTVWQSMPRDLFHRSLPTLLLAI  140



>ref|XP_003552291.1| PREDICTED: wound-induced protein 1-like [Glycine max]
Length=144

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 85/151 (56%), Gaps = 9/151 (6%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFE  522
            +NK  V  L  AL  ++ +D V KL ASDLEWWFHGPP    +M++LTG       FRFE
Sbjct  2    QNKATVEMLYMALLGQETMDNVAKLLASDLEWWFHGPPQCHHMMKVLTGETDHTKGFRFE  61

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            P +V AIG  V  EG +      WVH WT+ +G+ITQ REYFNT L V          + 
Sbjct  62   PKQVTAIGDCVIAEGWE--GKAYWVHVWTLKNGLITQFREYFNTWLVVRDLRTPRREDSK  119

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             ++T      +WES   +   +S+PGLVL I
Sbjct  120  DSMT------LWESQPRDLYHRSLPGLVLTI  144



>ref|XP_006602069.1| PREDICTED: uncharacterized protein LOC102664858 [Glycine max]
Length=163

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 92/161 (57%), Gaps = 15/161 (9%)
 Frame = -2

Query  719  QETXEE--TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTGTA  549
            QE  EE   RN RVV  L +AL+S+D + +  L   DLEWWFHGPP H+  L+  LTG++
Sbjct  14   QECLEEYVERNTRVVTELYKALTSKDPETLHGLVTQDLEWWFHGPPCHRHHLVPWLTGSS  73

Query  548  TAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTR  372
             +  +    P  +   GP V  EG D    + WVHAWTVT DG+ITQV+EY NTS+TVT 
Sbjct  74   PSSKALV--PQHMVGFGPVVIAEGFDDDHLVWWVHAWTVTADGLITQVKEYVNTSVTVTL  131

Query  371  FGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                    A+       C  +W+S L     +SVPGL+L I
Sbjct  132  LSQQVLPNASK------CQCIWQSRL---CDESVPGLILPI  163



>gb|KHN40672.1| Wound-induced protein 1 [Glycine soja]
Length=144

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 85/151 (56%), Gaps = 9/151 (6%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFE  522
            +NK  V  L  AL  ++ +D V KL ASDLEWWFHGPP    +M++LTG       FRFE
Sbjct  2    QNKATVEMLYMALLGQETMDNVAKLLASDLEWWFHGPPQCHHMMKVLTGETGHTKGFRFE  61

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            P +V AIG  V  EG +      WVH WT+ +G+ITQ REYFNT L V          + 
Sbjct  62   PKQVTAIGDCVIAEGWE--GKAYWVHVWTLKNGLITQFREYFNTWLVVRDLRTPRREDSK  119

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             ++T      +WES   +   +S+PGLVL I
Sbjct  120  DSMT------LWESQPRDLYHRSLPGLVLTI  144



>ref|XP_010039617.1| PREDICTED: wound-induced protein 1-like [Eucalyptus grandis]
Length=155

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 93/160 (58%), Gaps = 10/160 (6%)
 Frame = -2

Query  725  NIQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTAT  546
             I+ T  E+ NK  V AL   L+    DLV KL ASDLEWWFHGPP  Q +MR+LTG + 
Sbjct  5    GIEPTMPES-NKATVEALYAKLALGHSDLVAKLLASDLEWWFHGPPGCQHMMRVLTGKSD  63

Query  545  AGDSFRFEPLKVDAIGP-TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF  369
               +F F P  + AIG   V  EG + ++   WVH WT+ +G+ITQ+REYFNT LTV   
Sbjct  64   Y-SAFPFHPRSITAIGDGYVIAEGWEGAQAY-WVHVWTLKNGVITQLREYFNTWLTVREV  121

Query  368  GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     A  T      +W+S + +R  +S+PGL+LAI
Sbjct  122  SLPRWEVVRANQT------LWQSQVGDRFDRSLPGLLLAI  155



>ref|XP_004149930.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus]
 ref|XP_004171143.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus]
 gb|KGN54427.1| hypothetical protein Csa_4G325520 [Cucumis sativus]
Length=168

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 85/152 (56%), Gaps = 6/152 (4%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E RN+     L ++L++     V K  A DLEWWFHGPP  Q++MR+LTG ++ G+ FRF
Sbjct  23   EQRNRATAETLYKSLATGRTHAVAKFLAPDLEWWFHGPPHCQYMMRVLTGDSSHGE-FRF  81

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  + AIG +V V        + WVH WT+ DG+ITQ REYFNT L VT     +    
Sbjct  82   EPRSITAIGDSVVVAEGWEGAQVYWVHVWTLKDGLITQFREYFNTWLVVTDLRQPAWEEI  141

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                      +VW S   +   +S+P +VLA+
Sbjct  142  RHD-----GLTVWRSQPRDLFHRSLPAIVLAL  168



>ref|XP_003623507.1| Wound-induced protein [Medicago truncatula]
 gb|AES79725.1| wound-induced-like protein [Medicago truncatula]
Length=151

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 18/158 (11%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E +NK +V  L +AL  +  +++V KL ASDLE+WFHGPP  Q +M++LTG       F+
Sbjct  6    EMQNKSIVEILYKALLGQGTMEMVAKLLASDLEYWFHGPPKCQHMMKVLTGETNHKKGFK  65

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT-----RFGN  363
            FEP  V +IG  V  EG +      WVH WT+ +G+ITQ REYFNT L V      R+ +
Sbjct  66   FEPRSVTSIGDCVITEGWE--GQAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPLRWED  123

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            H               ++W S   +   +S+PGLVLAI
Sbjct  124  HKQDNM----------TLWRSQPRDLYRRSLPGLVLAI  151



>ref|XP_003623517.1| Wound-induced protein [Medicago truncatula]
 gb|AES79735.1| wound-induced-like protein [Medicago truncatula]
Length=151

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 18/158 (11%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E +NK +V  L +AL  +  +++V KL ASDLE+WFHGPP  Q +M++LTG       F+
Sbjct  6    EMQNKSIVEILYKALLGQGTMEMVAKLLASDLEYWFHGPPECQHMMKVLTGETNHKKGFK  65

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT-----RFGN  363
            FEP  V +IG  V  EG +      WVH WT+ +G+ITQ REYFNT L V      R+ +
Sbjct  66   FEPRSVTSIGDCVITEGWE--GQAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPLRWED  123

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            H               ++W S   +   +S+PGLVLAI
Sbjct  124  HKQDNM----------TLWRSQPRDLYRRSLPGLVLAI  151



>ref|XP_003623505.1| Wound-induced protein [Medicago truncatula]
 gb|AES79723.1| wound-induced-like protein [Medicago truncatula]
Length=151

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 18/158 (11%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E +NK +V  L +AL  +  +++V KL ASDLE+WFHGPP  Q +M++LTG       F+
Sbjct  6    EMQNKSIVEILYKALLGQGTMEMVAKLLASDLEYWFHGPPQCQHMMKVLTGETNHKKGFK  65

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT-----RFGN  363
            FEP  V +IG  V  EG +      WVH WT+ +G+ITQ REYFNT L V      R+ +
Sbjct  66   FEPRSVTSIGDCVITEGWE--GQAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPLRWED  123

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            H               ++W S   +   +S+PGLVLAI
Sbjct  124  HKQDNM----------TLWRSQPRDLYRRSLPGLVLAI  151



>ref|XP_002872998.1| hypothetical protein ARALYDRAFT_486893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49257.1| hypothetical protein ARALYDRAFT_486893 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 88/155 (57%), Gaps = 10/155 (6%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +N+R +  L +AL   D   V K+ ASD+EWWFHGP   Q +MR+LTG   +  SFRF
Sbjct  15   EMKNQRTIELLYKALQQGDTSTVTKVVASDVEWWFHGPHHCQHMMRLLTGERRSQVSFRF  74

Query  524  EPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsa  354
            EP  V  + P    V  EG + S+ + WVH W + DG++T++REYFNT LTVT +   + 
Sbjct  75   EPSSVQVVVPGHDCVIAEGWEGSQ-VYWVHVWKLKDGVVTELREYFNTWLTVTDYSLGAI  133

Query  353  saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   T      VWES   +    S+P L+LAI
Sbjct  134  GWDMGRCT------VWESVPRDLARGSLPSLLLAI  162



>ref|XP_003623511.1| Wound-induced protein [Medicago truncatula]
 gb|AES79729.1| wound-induced-like protein [Medicago truncatula]
 gb|AFK35809.1| unknown [Medicago truncatula]
Length=151

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 18/158 (11%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E +NK +V  L +AL  +  +++V KL ASDLE+WFHGPP  Q +M++LTG       F+
Sbjct  6    EMQNKSIVEILYKALLGQGTMEMVAKLLASDLEYWFHGPPQCQHMMKVLTGETDHKKGFK  65

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT-----RFGN  363
            FEP  V +IG  V  EG +      WVH WT+ +G+ITQ REYFNT L V      R+ +
Sbjct  66   FEPRSVTSIGDCVITEGWE--GQAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPLRWED  123

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            H               ++W S   +   +S+PGLVLAI
Sbjct  124  HKQDNM----------TLWRSQPRDLYRRSLPGLVLAI  151



>ref|XP_006591719.1| PREDICTED: uncharacterized protein LOC102660194, partial [Glycine 
max]
Length=158

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 17/164 (10%)
 Frame = -2

Query  725  NIQETXEE--TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTG  555
            N +E  EE    N RVV  L +AL+S+D + +  + A DLEWWFHGP  H+  L+  LTG
Sbjct  7    NSRECLEEYVEHNTRVVTELYKALTSKDPETLHGIVAQDLEWWFHGPSCHRHHLVPWLTG  66

Query  554  TATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV--TDGIITQVREYFNTSLT  381
            ++ +  +    P  V   GP V  EG D +  + WVHAWT+  +DG+ITQV+EY NTS++
Sbjct  67   SSPSSKALV--PQHVVGFGPLVIAEGFDEAHLVWWVHAWTIRTSDGLITQVKEYVNTSVS  124

Query  380  VTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            VTR      +A+       +C  +W+S L +   +SVPGLVLAI
Sbjct  125  VTRLSQMLPNAS-------NCQCIWQSRLCD---ESVPGLVLAI  158



>ref|XP_002440895.1| hypothetical protein SORBIDRAFT_09g015680 [Sorghum bicolor]
 gb|EES19325.1| hypothetical protein SORBIDRAFT_09g015680 [Sorghum bicolor]
Length=247

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 100/175 (57%), Gaps = 20/175 (11%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ--FLMRILTGTATA  543
            E      +K VV  L  AL   DVD V++L   D++WWFHGP +HQ   LMR+LTG A A
Sbjct  74   EPSPAVSSKAVVEELYRALERGDVDAVRRLLNPDVDWWFHGPRAHQHLVLMRLLTG-AGA  132

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRF-  369
            G    F+   +DA GPTV  EG D++  + WVHAWTV   G +T+VREY NT+L VTR  
Sbjct  133  GAGLPFKIRSLDAFGPTVLAEGTDVTGALYWVHAWTVGPRGRVTEVREYCNTALVVTRLG  192

Query  368  ------------GNHsasaaaaAITPLHCPS--VWESS-LPNRVGKSVPGLVLAI  249
                           +A+A  A  T    PS  VW+S  LP+R  +++PGLVLAI
Sbjct  193  GGGGGGGGGADADAAAAAAEEAKATLSRSPSKQVWQSRLLPDRARRNLPGLVLAI  247



>ref|XP_010937969.1| PREDICTED: wound-induced protein 1-like [Elaeis guineensis]
Length=110

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREY  399
            +MR+LTG A+  +SF+F    ++A G TV VEG D +R++ WVHAWTV+ DGIITQVREY
Sbjct  1    MMRLLTG-ASPEESFQFVLRSIEAFGSTVLVEGTDRTRSLYWVHAWTVSPDGIITQVREY  59

Query  398  FNTSLTVTRFGNHsasaaaaAITP-LHCPSVWESSLPNRVGKSVPGLVLAI  249
            FNTS+TVTR G  +A  ++++  P LHC  VW+S LP++  +S+PGLVLAI
Sbjct  60   FNTSVTVTRVGAAAAGDSSSSNVPKLHCLPVWQSKLPDQARRSLPGLVLAI  110



>ref|XP_010423988.1| PREDICTED: wound-induced protein 1-like [Camelina sativa]
Length=155

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 90/157 (57%), Gaps = 12/157 (8%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E   N+  +  L  AL   D   V K+ ASD+EWWFHGP   Q +MR+LTG   +  SFR
Sbjct  7    ETLTNQGTIELLYRALQQGDASTVAKVVASDVEWWFHGPHHCQHMMRLLTGEPPSQVSFR  66

Query  527  FEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            FEP  V  + P    V  EG + S N+ WVH WT+ DG++T++REYFNT LTVT +   +
Sbjct  67   FEPSSVQVLVPGHDCVIAEGWEGS-NVYWVHVWTLKDGVVTELREYFNTWLTVTDYSLGA  125

Query  356  asaaaaAITPLHCPSVWESSLPNRVGK-SVPGLVLAI  249
                    T      VWE S+P  +G+ S+P L+LAI
Sbjct  126  IGWDMGRCT------VWE-SVPKDLGRGSLPSLLLAI  155



>ref|XP_009125397.1| PREDICTED: wound-induced protein 1 [Brassica rapa]
Length=160

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 88/158 (56%), Gaps = 10/158 (6%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDS  534
            T  E +N+  +  L  AL   D   V KL ASD+EWWFHGP + Q +MR+LTG   +  S
Sbjct  10   TTPEMKNRENIELLYRALQQGDASTVAKLVASDVEWWFHGPHNCQHMMRLLTGEPPSQVS  69

Query  533  FRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN  363
            FRFEP  V  + P    V  EG + S+ + WVH W + DG++T++REYFNT +TVT +  
Sbjct  70   FRFEPSSVQVVVPGHGCVIAEGWEGSQ-VYWVHVWKLKDGVVTELREYFNTWITVTDYSR  128

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             +        T      VWES   +    S+P L+LAI
Sbjct  129  GAIGWDMGGCT------VWESVPRDLPRGSLPSLLLAI  160



>ref|XP_009343484.1| PREDICTED: uncharacterized protein LOC103935438 [Pyrus x bretschneideri]
Length=133

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -2

Query  620  SDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHA  441
            +DLEWWFHGPP+HQFLMR+LTG+     SF+F P  + + G TV VEG D   +I+WVHA
Sbjct  14   TDLEWWFHGPPTHQFLMRLLTGSQN--KSFQFVPESIASFGLTVLVEGCDRDCSISWVHA  71

Query  440  WTVTDGIITQVREYFNTSLTVTRFGN  363
            WTV  G++T VREYFNT+LTV  + N
Sbjct  72   WTVASGVVTGVREYFNTTLTVLTWNN  97



>ref|NP_195794.1| Nuclear transport factor 2 (NTF2) family protein [Arabidopsis 
thaliana]
 emb|CAB82744.1| putative protein [Arabidopsis thaliana]
 gb|AAL91620.1| AT5g01740/T20L15_10 [Arabidopsis thaliana]
 gb|AAT41853.1| At5g01740 [Arabidopsis thaliana]
 gb|AED90385.1| Nuclear transport factor 2 (NTF2) family protein [Arabidopsis 
thaliana]
Length=162

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 86/155 (55%), Gaps = 10/155 (6%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +N+  +  L +AL   D   V K+ ASD+EWWFHGP   Q +MR+LTG      SFRF
Sbjct  15   EMKNQGTIELLYKALQQGDTSTVTKVVASDVEWWFHGPHDCQHMMRLLTGEPPRQVSFRF  74

Query  524  EPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsa  354
            EP  V  + P    V  EG + SR + WVH W + DG++T++REYFNT LTVT +   + 
Sbjct  75   EPSSVQVVVPGHDCVIAEGWEGSR-VYWVHVWKLKDGVVTELREYFNTWLTVTDYSLGAV  133

Query  353  saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   T      VWES   +    S+P L+LAI
Sbjct  134  GWDMGRCT------VWESVPRDLARGSLPSLLLAI  162



>emb|CDY04831.1| BnaAnng00130D [Brassica napus]
Length=160

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 88/158 (56%), Gaps = 10/158 (6%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDS  534
            T  E +N+  +  L  AL   D   V KL ASD+EWWFHGP + Q +MR+LTG   +  S
Sbjct  10   TTPEMKNRGNIELLYRALQQGDASTVAKLVASDVEWWFHGPHNCQHMMRLLTGEPPSQVS  69

Query  533  FRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN  363
            FRFEP  V  + P    V  EG + S+ + WVH W + DG++T++REYFNT +TVT +  
Sbjct  70   FRFEPSTVQVVVPGHGCVIAEGWEGSQ-VYWVHVWKLKDGVVTELREYFNTWITVTDYSR  128

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             +        T      VWES   +    S+P L+LAI
Sbjct  129  GAIGWDMGGCT------VWESVPRDLPRGSLPSLLLAI  160



>ref|XP_003533675.1| PREDICTED: wound-induced protein 1-like [Glycine max]
Length=152

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 85/153 (56%), Gaps = 9/153 (6%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E +NK  V  L +AL  +  +D V KL ASDLEWWFHGPP    +M++LTG       FR
Sbjct  8    EMQNKARVEVLYKALLGQGTMDNVAKLLASDLEWWFHGPPHCHHMMKVLTGETDHTKGFR  67

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            FEP +V A+G     EG +      WVH WT+ +G+ITQ REYFNT L V          
Sbjct  68   FEPRRVTAVGDCTIAEGWE--GKAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPPRWED  125

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +  ++T      +W+S   +   +S+PGLVL I
Sbjct  126  SKDSMT------LWQSQPRDLYHRSLPGLVLTI  152



>ref|XP_002533790.1| Wound-induced protein, putative [Ricinus communis]
 gb|EEF28592.1| Wound-induced protein, putative [Ricinus communis]
Length=154

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 88/158 (56%), Gaps = 13/158 (8%)
 Frame = -2

Query  722  IQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA  543
            + E+  E  NK +V AL +AL    +D V  L A+DLEWWFHGPP  Q +MR+LTG A+ 
Sbjct  10   VPESGNEVENKGIVDALYKALVQGRMDRVANLLATDLEWWFHGPPRCQHMMRVLTGEASH  69

Query  542  GDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN  363
             D        ++ +G  V  EG + ++   WVH WT+ DG+ITQ REYFNT LTV     
Sbjct  70   ID--------IEVVGDCVIAEGWEGAQAY-WVHVWTLKDGLITQFREYFNTWLTVKDMSP  120

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     I      ++W+S   +   +S+PGL+LAI
Sbjct  121  Q----QRWEIGRESSHTLWQSQPRDLFNRSLPGLLLAI  154



>ref|XP_006398586.1| hypothetical protein EUTSA_v10014882mg [Eutrema salsugineum]
 gb|ESQ40039.1| hypothetical protein EUTSA_v10014882mg [Eutrema salsugineum]
Length=162

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 85/155 (55%), Gaps = 10/155 (6%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +N+  +  L  AL   D   V KL ASD+EWWFHGP   Q +MR+LTG   +  SFRF
Sbjct  15   EMKNRGAIELLYRALQQGDTSTVAKLVASDVEWWFHGPHHCQHMMRLLTGEQPSQVSFRF  74

Query  524  EPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsa  354
            EP  V  + P    V  EG + S ++ WVH W + DG++T++REYFNT LTVT     + 
Sbjct  75   EPSNVQVVVPGHGCVIAEGWEGS-HVYWVHVWKLKDGVVTELREYFNTWLTVTDCSLGAI  133

Query  353  saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   T      VWES   +    S+P L+LAI
Sbjct  134  GWDMGRCT------VWESVPRDLARGSLPSLLLAI  162



>gb|EPS73020.1| hypothetical protein M569_01735, partial [Genlisea aurea]
Length=148

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 89/151 (59%), Gaps = 4/151 (3%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTG-TATAGDSFRFE  522
            +N  VV +L +A+S+ D   +  +   DL+WWFHGP +  F+M  LTG ++T    F+FE
Sbjct  1    KNIAVVRSLYDAVSNSDDVRISAIVVDDLDWWFHGPQNCHFMMNALTGKSSTTAPRFKFE  60

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            P  +DAIG  V VEG + ++ + WVH WT+  G I Q REYFNT +TV  F   +     
Sbjct  61   PKSIDAIGNRVIVEGWEGAK-VYWVHVWTLRGGKIGQFREYFNTWVTVRDFRRRNFDHCR  119

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             + T  H  ++W+S   +   +S PGL+LAI
Sbjct  120  ESSTDSH--TLWQSHPRDLAKRSFPGLMLAI  148



>ref|XP_011095092.1| PREDICTED: wound-induced protein 1 [Sesamum indicum]
Length=149

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 94/155 (61%), Gaps = 19/155 (12%)
 Frame = -2

Query  701  TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFE  522
            + N   V  L +AL+S + + +  L A+DLEWWFHGP + Q +M++LTG ++  D F+F+
Sbjct  10   SSNATTVRTLYQALASGNTN-ISGLIATDLEWWFHGPHNCQHMMKMLTGQSSPSD-FKFQ  67

Query  521  PLKVDAIG-PTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            P  +DAI    V VEG D ++ + WVH WT+ DG+ITQ REYFNT LTV           
Sbjct  68   PRSMDAIDHDCVIVEGWDGAQ-VYWVHVWTLKDGVITQFREYFNTWLTV-----------  115

Query  344  aaAITPLHC---PSVWESSLPNRVGKSVPGLVLAI  249
               + PL+C    ++W+S   +   +S+P L+LAI
Sbjct  116  -RDLRPLNCLTSTTLWQSHPQDLAQRSLPELMLAI  149



>gb|KHN29546.1| Wound-induced protein 1 [Glycine soja]
Length=144

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 84/151 (56%), Gaps = 9/151 (6%)
 Frame = -2

Query  698  RNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFE  522
            +NK  V  L +AL  +  +D V KL ASDLEWWFHGPP    +M++LTG       FRFE
Sbjct  2    QNKARVEVLYKALLGQGTMDNVAKLLASDLEWWFHGPPHCHHMMKVLTGETDHTKGFRFE  61

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            P +V A+G     EG +      WVH WT+ +G+ITQ REYFNT L V          + 
Sbjct  62   PRRVTAVGDCTIAEGWE--GKAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPPRWEDSK  119

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             ++T      +W+S   +   +S+PGLVL I
Sbjct  120  DSMT------LWQSQPRDLYHRSLPGLVLTI  144



>ref|XP_003623509.1| Wound-induced protein [Medicago truncatula]
 gb|AES79727.1| wound-induced-like protein [Medicago truncatula]
Length=149

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 86/157 (55%), Gaps = 18/157 (11%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +NK +V  L +AL  +   +V KL ASDLE+WFHGPP  Q +M++LTG       F+F
Sbjct  6    EKQNKSIVEILYKALLGQGT-MVAKLLASDLEYWFHGPPKCQHMMKVLTGETNHKKGFKF  64

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVT-----RFGNH  360
            EP  V +IG  V  EG +      WVH WT+ +G+ITQ REYFNT L V      ++ +H
Sbjct  65   EPRSVTSIGDCVITEGWE--GQAYWVHVWTLKNGLITQFREYFNTWLVVRDLRPLKWEDH  122

Query  359  sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                           ++W S   +   +S+PGLVL I
Sbjct  123  KQDNM----------TLWRSQPRDLYRRSLPGLVLPI  149



>gb|EAY97598.1| hypothetical protein OsI_19523 [Oryza sativa Indica Group]
 gb|EEE63315.1| hypothetical protein OsJ_18126 [Oryza sativa Japonica Group]
Length=252

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 83/148 (56%), Gaps = 6/148 (4%)
 Frame = -2

Query  674  LXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ--FLMRILTGTATAGDSFRFEPLKVDAI  501
            L  AL   D D V++L   D++WWFHGP +HQ   LMR+LTG         F+   VDA 
Sbjct  105  LYRALERGDGDAVRRLLNPDVDWWFHGPRAHQHLVLMRLLTGGGGGAAGLPFKVRGVDAF  164

Query  500  GPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHsasaaaaAITPL  324
            G TV  EG D +  + WVHAWTV   G +T VREY NT+L VTR G       A A  P 
Sbjct  165  GETVLAEGTDATGKLYWVHAWTVGPGGRVTGVREYCNTALVVTRLGGGGGGKGAEAAAPC  224

Query  323  ---HCPSVWESSLPNRVGKSVPGLVLAI  249
                   +W+S LP+R  K++P LVLAI
Sbjct  225  SRSQSEQLWQSRLPDRARKNLPALVLAI  252



>ref|XP_011466429.1| PREDICTED: wound-induced protein 1 [Fragaria vesca subsp. vesca]
Length=144

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 88/155 (57%), Gaps = 20/155 (13%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
            NK +V AL +AL+    + V K+ A+DLEWWFHGPP  Q +M++LTG  +    F+FEP 
Sbjct  4    NKAIVEALYKALAQGQTETVAKVLATDLEWWFHGPPKCQHMMKVLTGD-SGHVGFKFEPR  62

Query  515  KVDAIGP-TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaa  339
             V  IG   V  EG + ++   WVH WT+ DG+ITQ REYFNT LTV             
Sbjct  63   SVTEIGDYCVIAEGWEGAQAY-WVHVWTIKDGLITQFREYFNTWLTV------------R  109

Query  338  AITPLHCP-----SVWESSLPNRVGKSVPGLVLAI  249
             + PL        +VW+S   +   +S+P L+LAI
Sbjct  110  DLKPLGWKESKSFTVWQSMPRDLFHRSLPSLLLAI  144



>ref|XP_009630043.1| PREDICTED: wound-induced protein 1 [Nicotiana tomentosiformis]
Length=169

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 91/165 (55%), Gaps = 26/165 (16%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDL--------VQKLXASDLEWWFHGPPSHQFLMRILTGTA  549
            E +NK +V  L +AL+    D         +    A DLEWWFHGP +  ++M++LTG  
Sbjct  18   ENKNKAIVKTLYKALACTCGDSPKNVLGPNICSYIADDLEWWFHGPQNCHYMMKMLTGEL  77

Query  548  TAGDSFRFEPLKVDAIGPT-VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTR  372
            +  + F+FEP  VDAI    V VEG + ++   WVH WT+ DG+ITQ REYFNT LTVT 
Sbjct  78   SNQNCFKFEPRSVDAIDDDRVIVEGWEGAK-AYWVHVWTLKDGVITQFREYFNTWLTVTE  136

Query  371  FGNHsasaaaaAITPL----HCPSVWESSLPNRVGKSVPGLVLAI  249
                        + P+       ++W+S   +   +S+PGL+LAI
Sbjct  137  ------------LRPMGWVRSSTTLWQSHPRDLAKRSLPGLMLAI  169



>ref|XP_009766409.1| PREDICTED: wound-induced protein 1 [Nicotiana sylvestris]
Length=168

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 90/160 (56%), Gaps = 17/160 (11%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKL-------XASDLEWWFHGPPSHQFLMRILTGTAT  546
            E +NK +V  L +AL+    D    L        A DLEWWFHGP +  ++M++LTG  +
Sbjct  18   ENKNKVIVKTLYKALACTCGDSKNVLGSNICSSIADDLEWWFHGPQNCHYMMKMLTGELS  77

Query  545  AGDSFRFEPLKVDAIGPT-VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF  369
              + F+FEP  VDAI    V VEG + ++   WVH WT+ DG+ITQ REYFNT LTVT  
Sbjct  78   NQNCFKFEPRSVDAIDDDRVIVEGWEGAKTY-WVHVWTLKDGVITQFREYFNTWLTVTEL  136

Query  368  GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   ++         ++W+S   +   +S+PGL+LAI
Sbjct  137  RPTEWVRSST--------TLWQSHPRDLAKRSLPGLMLAI  168



>emb|CDP06415.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 83/153 (54%), Gaps = 8/153 (5%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            +   N+  V AL +AL+S ++  V    ASDLEWWFHGP     +M++LTG ++   +F 
Sbjct  13   QNNGNEATVKALYKALASGEIGKVAGFVASDLEWWFHGPQGCHHMMKMLTGKSSH-KAFS  71

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F P  +DAI   V VEG +      WVH WT+ DG+ITQ REYFNT LTV          
Sbjct  72   FNPRSMDAIDDYVIVEGWE-GVQAYWVHVWTLKDGLITQFREYFNTWLTVADL------R  124

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              A          W+S   +   +S+PGL+LAI
Sbjct  125  PVAVAGGCSSSKFWQSHPRDLAKRSLPGLMLAI  157



>gb|EYU41980.1| hypothetical protein MIMGU_mgv1a015491mg [Erythranthe guttata]
Length=156

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 87/149 (58%), Gaps = 18/149 (12%)
 Frame = -2

Query  683  VLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVDA  504
            V +L  AL S     +  L ASDLEWWFHGP +   +M++LTG ++  D F+FEP  +DA
Sbjct  22   VRSLYTALGSGGSRQISGLIASDLEWWFHGPQNCHHMMKMLTGKSSPAD-FKFEPRSIDA  80

Query  503  I--GPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHsasaaaaAI  333
            +  G  V VEG +    + WVH WT+  DG+ITQ REYFNT LTV              +
Sbjct  81   VDDGECVIVEGWE-GAQVYWVHVWTLNEDGVITQFREYFNTWLTV------------WDL  127

Query  332  TPLHCP-SVWESSLPNRVGKSVPGLVLAI  249
             PL C  ++W+S   +   +S+PGL+LAI
Sbjct  128  RPLSCTGTLWQSHPQDLAKRSLPGLMLAI  156



>gb|KFK24638.1| hypothetical protein AALP_AA8G005600 [Arabis alpina]
Length=162

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 10/155 (6%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E +N+  +  L  AL   D   V KL ASD+EWWFHGP   Q +MR+LTG   +  SF+F
Sbjct  15   EMKNRGTIELLYRALLQGDTSTVAKLVASDVEWWFHGPHHCQHMMRLLTGEPPSQISFKF  74

Query  524  EPLKVDAIGPT---VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsa  354
            EP  V  +  +   V  EG + S ++ WVH W + DG++T++REYFNT LTVT +     
Sbjct  75   EPSSVQVLPSSHGCVIAEGWEGS-HVYWVHVWKLKDGVVTELREYFNTWLTVTDYSLGPI  133

Query  353  saaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   T      VWES   +    S+P L+LAI
Sbjct  134  GWDMGRCT------VWESVPRDLARGSLPSLLLAI  162



>ref|XP_006429518.1| hypothetical protein CICLE_v10012959mg [Citrus clementina]
 ref|XP_006481136.1| PREDICTED: wound-induced protein 1-like [Citrus sinensis]
 gb|ESR42758.1| hypothetical protein CICLE_v10012959mg [Citrus clementina]
Length=163

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = -2

Query  725  NIQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTAT  546
            N++ +  E   + +V AL +AL++ +++ V K  ASDLE+WFHGPP+ Q ++R+LTG ++
Sbjct  9    NVETSMAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESS  68

Query  545  AGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT--DGIITQVREYFNTSLTV  378
               +F+FEP  V+ +G  V  EG +      WVH WTV   DG+ITQ REYFNT LTV
Sbjct  69   KA-TFKFEPRSVEVVGDCVIAEGWE-GAPAYWVHVWTVNVKDGLITQFREYFNTWLTV  124



>ref|XP_007146843.1| hypothetical protein PHAVU_006G074700g [Phaseolus vulgaris]
 gb|ESW18837.1| hypothetical protein PHAVU_006G074700g [Phaseolus vulgaris]
Length=171

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            +E   E RN+  V  + +A      + + KL  ++LEWW+HGP   +++MR+LTG +TA 
Sbjct  24   REAEHEKRNRETVKMVYKAQCDGHTEKLVKLVRTELEWWYHGPHHCEYMMRLLTGESTA-  82

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTV  378
              FRF P ++ A+G  V VEG +      WVH WT++ GII Q+REYFNT +TV
Sbjct  83   KGFRFRPRRIRAVGDRVMVEGWEGKGEEYWVHVWTLSHGIIAQLREYFNTFITV  136



>gb|KDO63300.1| hypothetical protein CISIN_1g031351mg [Citrus sinensis]
Length=161

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = -2

Query  725  NIQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTAT  546
            N++ +  E   + +V AL +AL++ +++ V K  ASDLE+WFHGPP+ Q ++R+LTG ++
Sbjct  7    NVETSMAEQNQEAIVKALYKALANDEMENVAKYLASDLEYWFHGPPTCQHMVRLLTGESS  66

Query  545  AGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT--DGIITQVREYFNTSLTV  378
               +F+FEP  V+ +G  V  EG +      WVH WTV   DG+ITQ REYFNT LTV
Sbjct  67   KA-TFKFEPRSVEVVGDCVIAEGWE-GAPAYWVHVWTVNVKDGLITQFREYFNTWLTV  122



>ref|XP_010102619.1| hypothetical protein L484_001345 [Morus notabilis]
 gb|EXC46005.1| hypothetical protein L484_001345 [Morus notabilis]
Length=176

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 91/160 (57%), Gaps = 19/160 (12%)
 Frame = -2

Query  701  TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTG-TATAGDSFRF  525
            ++N+  +  L +ALS  + + V KL ASDLE+WFHGPP    +MR+LTG + +   +F F
Sbjct  27   SQNEATIKKLYKALSQGETEAVSKLIASDLEYWFHGPPRCHHMMRVLTGESPSHAAAFCF  86

Query  524  EPLKVDAI-GPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF-------  369
            +P  V A+ G  V  EG + ++   WV  WTV DG++TQ REYFNT LTV          
Sbjct  87   DPRSVTAVSGACVIAEGWEGAKAY-WVQVWTVKDGVVTQFREYFNTWLTVRDLRPPPQAV  145

Query  368  GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            G+H           L   ++W+S   +   +S+PGL+LAI
Sbjct  146  GHHQR---------LSTSTLWQSMPRDLFRRSLPGLLLAI  176



>ref|XP_008236386.1| PREDICTED: wound-induced protein 1-like [Prunus mume]
Length=165

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 86/151 (57%), Gaps = 11/151 (7%)
 Frame = -2

Query  701  TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFE  522
            +++++VV AL +AL+ +D     +L A DLEWWFHGP   Q +MR LTG +   + F+F 
Sbjct  26   SQHRKVVKALYKALARKDTSTTSELVAPDLEWWFHGPRHCQHMMRTLTGESRHVE-FKFR  84

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaa  342
            P  +  +G  V  EG + S+   W H W+V +G+ITQ+REYFNT +TV   GN       
Sbjct  85   PRSITPVGDRVVAEGWEGSKAY-WAHVWSVKEGMITQLREYFNTWVTVI-VGNSEVEDEM  142

Query  341  aAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +        W+S    R  +S+P +VLAI
Sbjct  143  MKL--------WQSDPRERSQRSLPDIVLAI  165



>ref|XP_010039423.1| PREDICTED: wound-induced protein 1-like [Eucalyptus grandis]
 gb|KCW88251.1| hypothetical protein EUGRSUZ_A00638 [Eucalyptus grandis]
Length=157

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 9/154 (6%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E  +NK  + AL  AL+  + + V +L ASDLEWWFHGPP  Q +MR LTG +    +F 
Sbjct  12   ESDKNKATIKALYAALALGESNKVAELLASDLEWWFHGPPGCQHMMRTLTGKSDY-SAFP  70

Query  527  FEPLKVDAIG-PTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsas  351
            F P  + AIG   V  EG + ++   WVH WT+ +G+I Q REYFNT L V    +    
Sbjct  71   FHPRSITAIGTDYVIAEGWEGAQAY-WVHVWTLKNGLIAQFREYFNTWLIVRDVSSPRRE  129

Query  350  aaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            AA A+ T      +W+S   +   +S+PGL+LAI
Sbjct  130  AARASYT------LWQSQPRDHFEQSLPGLLLAI  157



>ref|XP_004296041.1| PREDICTED: wound-induced protein 1-like [Fragaria vesca subsp. 
vesca]
Length=169

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 12/152 (8%)
 Frame = -2

Query  701  TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFE  522
            + ++++V  L +AL+ RD     KL A DLEWWFHGPP  Q +MR+LTG +     F+F 
Sbjct  29   SHHRKIVKTLYKALAHRDTRTTAKLVAPDLEWWFHGPPQCQHMMRMLTGESRQL-KFKFR  87

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHsasaa  345
            P  + A+G  V  EG +  +   WV  WTV  DG++TQ+REYFNT +TV    + +    
Sbjct  88   PRSLKAVGDRVVAEGWE-GKKEYWVQVWTVNKDGMVTQLREYFNTLVTVMVRVSEADDEM  146

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                       +W+S    R  +S+P +VLAI
Sbjct  147  V---------KLWQSDSKERFRRSLPDIVLAI  169



>ref|XP_010683577.1| PREDICTED: wound-induced protein 1 [Beta vulgaris subsp. vulgaris]
Length=162

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 91/164 (55%), Gaps = 10/164 (6%)
 Frame = -2

Query  725  NIQETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTAT  546
            NIQ+      NK +V     ALS  D + V K  ASDLEWWFHGPP  Q + R+LTG  +
Sbjct  4    NIQDENNNHNNKAIVQDFYYALSKGDGENVSKHLASDLEWWFHGPPQCQHMRRVLTGE-S  62

Query  545  AGDSFRFEPLKVDAIGPT-VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF  369
            A   FRF+P  +  I    V VEG +   +  WVH WT+  G++TQ REYFNT+LTV   
Sbjct  63   AYPEFRFKPRSITIIDEDRVIVEGWE-GAHAYWVHVWTLKGGLMTQFREYFNTALTVRDL  121

Query  368  GNHsasaaaaAITPLHCP-SVWESSL---PNRVGKSVPGLVLAI  249
              H    +   I P++   ++W+S +         S+PGLVLAI
Sbjct  122  RPH---NSGWEIGPINEKGTLWQSHISGSGLSGTGSMPGLVLAI  162



>ref|XP_006288836.1| hypothetical protein CARUB_v10002178mg [Capsella rubella]
 gb|EOA21734.1| hypothetical protein CARUB_v10002178mg [Capsella rubella]
Length=155

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 88/157 (56%), Gaps = 12/157 (8%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E   NK  V  L  AL   +   V K+ ASD+EWWFHGP   Q +MR+LTG   +   FR
Sbjct  7    ETLTNKGTVELLYRALQQGEASKVAKVVASDVEWWFHGPHHCQHMMRLLTGEPPSQVPFR  66

Query  527  FEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHs  357
            F+P  V  + P    V  EG + S ++ WVH W + DG++T++REYFNT LTVT +   +
Sbjct  67   FKPSSVQVVVPGHDCVIAEGWEGS-HVYWVHVWKLKDGVVTELREYFNTWLTVTDYSLGA  125

Query  356  asaaaaAITPLHCPSVWESSLPNRVGK-SVPGLVLAI  249
                    T      VWE S+P  +G+ S+P L+LAI
Sbjct  126  IGWDMGRCT------VWE-SVPKDLGRGSLPNLLLAI  155



>ref|XP_007206573.1| hypothetical protein PRUPE_ppa020160mg, partial [Prunus persica]
 gb|EMJ07772.1| hypothetical protein PRUPE_ppa020160mg, partial [Prunus persica]
Length=136

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 82/147 (56%), Gaps = 11/147 (7%)
 Frame = -2

Query  689  RVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKV  510
            +VV AL +AL+ +D     KL A DLEWWFHGP   Q +MR LTG +   + F+F P  +
Sbjct  1    KVVKALYKALALKDTSTTSKLVAPDLEWWFHGPRHCQHMMRTLTGESRHVE-FKFRPRSI  59

Query  509  DAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaAIT  330
              +G  V  EG + S+   W H W+V +G+ITQ+REYFNT +TV   GN         + 
Sbjct  60   TPVGDRVVAEGWEGSKAY-WAHVWSVKEGMITQLREYFNTWVTVI-VGNSEVEDEMMKL-  116

Query  329  PLHCPSVWESSLPNRVGKSVPGLVLAI  249
                   W+S    R  +S+P +VLAI
Sbjct  117  -------WQSDPRERSQRSLPDIVLAI  136



>gb|EMS56136.1| hypothetical protein TRIUR3_05350 [Triticum urartu]
Length=189

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 80/158 (51%), Gaps = 37/158 (23%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            EE RNK +VL L EAL+ RD   V  L A DLE                        SFR
Sbjct  64   EEQRNKFLVLRLYEALNGRDHAAVHSLLAPDLE---------------------CSSSFR  102

Query  527  FEPLKVDAIGPTVFVEG----QDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGN  363
            F+P  VDA G TV  EG     + ++   WVHAWTV +DG+ITQ+REYFNT LTVTR   
Sbjct  103  FQPRSVDAFGSTVIAEGVSAAGEDTKAAYWVHAWTVGSDGVITQLREYFNTDLTVTRLA-  161

Query  362  HsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                             VW+S  P+R   S+PGLVLA+
Sbjct  162  ----------AAAASKCVWQSRRPDRARNSLPGLVLAL  189



>ref|XP_004246826.1| PREDICTED: wound-induced protein 1 [Solanum lycopersicum]
Length=164

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 88/153 (58%), Gaps = 15/153 (10%)
 Frame = -2

Query  692  KRVVLALXEALSSR--DVDLVQKLXASDLEWWFHGPPSHQFLMRILTG--TATAGDSFRF  525
            K +V  L +ALS    D   V  +   DLEWWFHGP +  ++M++LTG  +    +SF+F
Sbjct  22   KSIVKTLYKALSCTCGDTKKVTGIIVDDLEWWFHGPQNCHYMMKLLTGEVSNNNNNSFKF  81

Query  524  EPLKVDAIGP-TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            EP  VDAI    V VEG + ++   WVH WT  DG+ITQ REYFNT LTVT         
Sbjct  82   EPRSVDAIDDHRVIVEGWEGAKAY-WVHVWTFKDGVITQFREYFNTWLTVTEL-------  133

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                +  +H  ++W+S   +   +S+PGL+LAI
Sbjct  134  --RPMGWVHSTTLWQSHPRDLAKRSLPGLMLAI  164



>ref|XP_009404669.1| PREDICTED: wound-induced protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 11/120 (9%)
 Frame = -2

Query  575  LMRILTGT----ATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQ  411
            +MR+LTG      TA  +F+F+P +V A G TV  EG     +  WVHAWT+  DGIITQ
Sbjct  1    MMRMLTGADYEETTAAAAFQFKPERVAAFGSTVVAEGSGPDADTAWVHAWTIAPDGIITQ  60

Query  410  VREYFNTSLTVTRF------GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            VREYFNTSLT+TR        + ++ +++++    H   VWESS P R GKS PGLVLAI
Sbjct  61   VREYFNTSLTITRVAADSASKSAASCSSSSSSGSAHGTPVWESSRPERAGKSFPGLVLAI  120



>ref|XP_010490513.1| PREDICTED: wound-induced protein 1-like [Camelina sativa]
Length=158

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 89/160 (56%), Gaps = 15/160 (9%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVD---LVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGD  537
            E   N+  +  L  AL   D      V K+ ASD+EWWFHGP   Q +MR+LTG   +  
Sbjct  7    ETLTNQGTIELLYRALQQGDASRPSTVAKVVASDVEWWFHGPHHCQHMMRLLTGEPPSQV  66

Query  536  SFRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFG  366
            SFRFEP  V  + P    V  EG + S ++ WVH W + DG++T++REYFNT LTVT + 
Sbjct  67   SFRFEPSSVQVLVPGHDCVIAEGWEGS-HVYWVHVWKLKDGVVTELREYFNTWLTVTDYS  125

Query  365  NHsasaaaaAITPLHCPSVWESSLPNRVGK-SVPGLVLAI  249
              +        T      VWE S+P  +G+ S+P L+LAI
Sbjct  126  LGAIGWDMGRCT------VWE-SVPKDLGRGSLPSLLLAI  158



>ref|XP_003537326.1| PREDICTED: wound-induced protein 1-like [Glycine max]
Length=163

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 84/153 (55%), Gaps = 12/153 (8%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA-GDSFR  528
            E RN+  V  + +AL   D + + K+   +LEWW+HGPP  Q + ++LTG +TA   +F+
Sbjct  22   ENRNRETVKMVYKALRDGDTEKLAKVVRVELEWWYHGPPHCQHMKKVLTGESTATQKAFK  81

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F P ++ A+G  V VEG + +    WVH W +  GII Q+REYFNT +TV          
Sbjct  82   FRPRRIRAVGDRVMVEGWEGAGEY-WVHVWRLKHGIIAQLREYFNTLITVV---------  131

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                +       +W S+   RV  S+P +VL+I
Sbjct  132  -LRVLEDGDEARLWRSTDRVRVQGSLPDIVLSI  163



>gb|KHN33242.1| Wound-induced protein 1 [Glycine soja]
Length=140

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 82/152 (54%), Gaps = 17/152 (11%)
 Frame = -2

Query  695  NKRVVLALXEALSSR-DVDLVQ-KLXASDLEWWFHGPPSHQFLMRILTGTATA-GDSFRF  525
            NK  V AL +AL  +  +D V   + ASDLEWWFHGPP  Q +MR+LTG  T   + FRF
Sbjct  3    NKATVEALYKALLGQGQMDTVATNMLASDLEWWFHGPPQCQHMMRVLTGETTLDNNGFRF  62

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP         V  EG +      WVH WTV +G+ITQ REYFNT L V    +      
Sbjct  63   EP------SDCVIAEGWE--GKAYWVHVWTVRNGLITQFREYFNTWLVVRDLRSQRWENK  114

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
               +T      +W+S   +   +S+PGLVLAI
Sbjct  115  LDNMT------LWQSQPRDLYRRSLPGLVLAI  140



>ref|XP_011077499.1| PREDICTED: wound-induced protein 1-like [Sesamum indicum]
Length=146

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 83/153 (54%), Gaps = 16/153 (10%)
 Frame = -2

Query  707  EETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFR  528
            E + N   V  L + +S+  V  +  L A DLEWWFHGP +   +M++LT   +    F+
Sbjct  10   ENSDNITTVRRLYQVIST-GVGEISGLIAEDLEWWFHGPQNCHHMMKMLTAGNSPTSDFK  68

Query  527  FEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasa  348
            F+P  +D I   + VEG +    + WVH WT+ DG+ITQ REYFNT LTV          
Sbjct  69   FKPRSMDTIDDRIIVEGWE-GAEVYWVHVWTLKDGVITQFREYFNTWLTV----------  117

Query  347  aaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                + PL   ++W+S   +   +S PGL+LAI
Sbjct  118  --RDLRPL--TTLWQSHPRDLAKRSFPGLMLAI  146



>ref|XP_003599291.1| Wound-induced protein [Medicago truncatula]
 gb|AES69542.1| wound-induced-like protein [Medicago truncatula]
Length=162

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 92/160 (58%), Gaps = 21/160 (13%)
 Frame = -2

Query  716  ETXEETRNKRVVLALXEAL-SSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            E+  E RN+RVV  + +AL    + + + K+   +LEW +HGPP  Q +M++LTG +T  
Sbjct  20   ESELENRNRRVVKMVYKALLRGGETEKIAKVVGKELEWRYHGPPHCQHMMKMLTGESTQ-  78

Query  539  DSFRFEPLKVDAI-GPTVFVEG-QDLSRNITWVHAWTVTDGIITQVREYFNTSLT-VTRF  369
             SF+F P ++ ++ G  + VEG +D+     WVH W V DGIITQ+REYFNT LT V+  
Sbjct  79   KSFKFRPRRMRSVMGDRLIVEGWEDVGE--YWVHVWRVKDGIITQLREYFNTLLTVVSED  136

Query  368  GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            GN                 +W S+   RV  S+P LVL+I
Sbjct  137  GNEG--------------RLWRSTPWARVQGSLPDLVLSI  162



>gb|KHN22779.1| Wound-induced protein 1, partial [Glycine soja]
Length=161

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 77/124 (62%), Gaps = 7/124 (6%)
 Frame = -2

Query  725  NIQETXEE--TRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQ-FLMRILTG  555
            N +E  EE    N RVV  L +AL+S+D + +  + A DLEWWFHGP  H+  L+  LTG
Sbjct  3    NSRECLEEYVEHNTRVVTELYKALTSKDPETLHGIVAQDLEWWFHGPSCHRHHLVPWLTG  62

Query  554  TATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV--TDGIITQVREYFNTSLT  381
            ++ +  +    P  V   GP V  EG D +  + WVHAWT+  +DG+ITQV+EY NTS++
Sbjct  63   SSPSSKALV--PQHVVGFGPLVIAEGFDEAHLVWWVHAWTIRTSDGLITQVKEYVNTSVS  120

Query  380  VTRF  369
            VTR 
Sbjct  121  VTRL  124



>ref|XP_003552928.1| PREDICTED: wound-induced protein 1-like [Glycine max]
Length=174

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEAL-SSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTG-TATAG  540
            T  E RN+  V  + +AL    D + + K+  ++LEWW+HGPP  Q +M++LTG + TA 
Sbjct  27   TEHENRNRETVKLVYKALLRDADTEKLAKVVRAELEWWYHGPPHCQHMMKVLTGESTTAQ  86

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTV  378
             +F+F P ++ A+G  V VEG + +    WVH W    GIITQ+REYFNT +TV
Sbjct  87   KAFKFRPRRIRAVGDRVVVEGWEGAGEY-WVHVWRFKHGIITQLREYFNTLITV  139



>gb|KCW88253.1| hypothetical protein EUGRSUZ_A00640, partial [Eucalyptus grandis]
Length=133

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = -2

Query  665  ALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVDAIGPTVF  486
            AL+  D  +V KL ASDLEWWFHGPP  Q +MR+LTG +   + F F P    A+G    
Sbjct  2    ALALGDSAMVAKLLASDLEWWFHGPPHCQHMMRVLTGQSDYSE-FTFHPRSTTAMGDDCV  60

Query  485  VEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVW  306
            +          WVH WT+ +G++ Q REYFNT LTV         AA A+ T      +W
Sbjct  61   IAEAWEGAQAYWVHVWTLKNGLVAQFREYFNTWLTVREVSLPRRKAARASHT------LW  114

Query  305  ESSLPNRVGKSVPGLVLAI  249
            +S   +   +S+PGL+LAI
Sbjct  115  QSQPRDCFDRSLPGLLLAI  133



>gb|KHN22780.1| Wound-induced protein 1 [Glycine soja]
Length=164

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 85/157 (54%), Gaps = 13/157 (8%)
 Frame = -2

Query  713  TXEETRNKRVVLALXEAL-SSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA-G  540
            T  E RN+  V  + +AL    D + + K+  ++LEWW+HGPP  Q + ++LTG +TA  
Sbjct  19   TEHENRNRETVKLVYKALLRDGDTEKLAKVVRAELEWWYHGPPHCQHMKKVLTGESTATQ  78

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNH  360
             +F+F P ++ A+G  V VEG + +    WVH W +  GII Q+REYFNT +TV      
Sbjct  79   KAFKFRPRRIRAVGDRVMVEGWEGAGEY-WVHVWRLKHGIIAQLREYFNTLITVV-----  132

Query  359  sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                    +        W S+   RV  S+P +VL+I
Sbjct  133  -----LRVLEDGDEARCWRSTDRVRVQGSLPDIVLSI  164



>ref|XP_002960457.1| hypothetical protein SELMODRAFT_73443 [Selaginella moellendorffii]
 ref|XP_002967263.1| hypothetical protein SELMODRAFT_87660 [Selaginella moellendorffii]
 gb|EFJ31862.1| hypothetical protein SELMODRAFT_87660 [Selaginella moellendorffii]
 gb|EFJ37996.1| hypothetical protein SELMODRAFT_73443 [Selaginella moellendorffii]
Length=156

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 84/157 (54%), Gaps = 15/157 (10%)
 Frame = -2

Query  719  QETXEETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAG  540
            ++   E     V+  L  A+S  DV++V+ L A+D+EWWFHGP + Q LMR+LTG    G
Sbjct  15   KDLASEQEGYAVLRNLYRAVSQGDVEIVKALVAADIEWWFHGPRAEQHLMRMLTGADRLG  74

Query  539  DSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNH  360
             S  F P +V  +      EG   +    WVH +T+  G + ++REYFNTS+TVT  G  
Sbjct  75   -SIAFSPSRVCLVQDKFLAEGFLDASKSCWVHVFTIKSGKVVELREYFNTSVTVTGAGFF  133

Query  359  sasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +         PL     WES L      S+PGL++A+
Sbjct  134  TRD------DPL-----WESELTL---TSMPGLIVAV  156



>ref|XP_011021438.1| PREDICTED: wound-induced protein 1-like [Populus euphratica]
Length=117

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -2

Query  536  SFRFEPL-KVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNH  360
            SF F PL  V + G  V VEG +   N++WVHAWTVT+GIITQVREYFNTS+TVTRFG+ 
Sbjct  21   SFVFHPLSNVVSFGSMVLVEGFNKDWNVSWVHAWTVTNGIITQVREYFNTSVTVTRFGDG  80

Query  359  sasaaaaAITPLH--CPSVWESSLPNRVGKSVPGLVLAI  249
             +S+ A + +     C SVW+S + +   KSVPGLVLA+
Sbjct  81   GSSSPAISTSQFRASCQSVWQSKVSDN--KSVPGLVLAL  117



>ref|XP_004958783.1| PREDICTED: wound-induced protein 1-like [Setaria italica]
Length=98

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 66/111 (59%), Gaps = 15/111 (14%)
 Frame = -2

Query  575  LMRILTGTATAGDS-FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTV-TDGIITQVRE  402
            +MR+LTG  +   S FRF P  VDA G TV  EG D  R + WVHAWTV  DG+ITQ+RE
Sbjct  1    MMRVLTGGGSNSSSSFRFAPRSVDAFGSTVIAEGGDQERGVYWVHAWTVGADGVITQLRE  60

Query  401  YFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            YFNT LTVTR                 C  +W+S  P+R   S+PGLVLA+
Sbjct  61   YFNTDLTVTRLA-----------AATKC--IWQSRRPDRATNSLPGLVLAL  98



>gb|EMT30757.1| hypothetical protein F775_02215 [Aegilops tauschii]
Length=158

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 81/159 (51%), Gaps = 20/159 (13%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
            N+ VV +L  +L+  D   V  L A+DL+WWFH P   Q +  +LTG A     FRF P 
Sbjct  10   NREVVESLYTSLARGDAAAVTVLLAADLDWWFHRPRRCQHMRSMLTGEAVGDMVFRFAPT  69

Query  515  KVDAIGPTVFVEGQD----------LSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFG  366
             V  +G T   EG+D          +     WVHAW +  G+IT  REYFNTS+TV   G
Sbjct  70   WVVEVGCT--TEGEDGWVVAEGWAGVGERDYWVHAWCLHAGVITSFREYFNTSVTVRELG  127

Query  365  NHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              +              +VWES  P   G+S+PGLVLAI
Sbjct  128  RPAKEDVVW--------AVWESQSPKPKGRSMPGLVLAI  158



>ref|XP_008649565.1| PREDICTED: wound-induced protein 1-like [Zea mays]
Length=112

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 69/113 (61%), Gaps = 6/113 (5%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYF  396
            MR+LTGT  AG    F+   +DA GPTV  EG D +  + WVHAWTV   G +T VREY 
Sbjct  1    MRLLTGTG-AGAGLPFKIRSLDAFGPTVLAEGADATGALYWVHAWTVGPGGRVTGVREYC  59

Query  395  NTSLTVTRFGNHsasaaaaAITPLHCPS----VWESSLPNRVGKSVPGLVLAI  249
            NT+L VTR G   A+   A  T    PS    VW+S LP+R  +++PGLVLAI
Sbjct  60   NTALVVTRLGGGGAAVERAKATCSLSPSPSKQVWQSRLPDRARRNLPGLVLAI  112



>ref|XP_004500329.1| PREDICTED: wound-induced protein 1-like [Cicer arietinum]
Length=159

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 93/165 (56%), Gaps = 23/165 (14%)
 Frame = -2

Query  725  NIQET--XEETRNKRVVLALXEALSSRD-VDLVQKLXASDLEWWFHGPPSHQFLMRILTG  555
            NI E+    E  N++VV  + +AL   D  + + K+   +LEW +HGPP  Q +M+ LTG
Sbjct  12   NISESIPQHENHNRKVVKMVYKALLHGDETEKLGKVVGKELEWRYHGPPHCQHMMKKLTG  71

Query  554  TATAGDSFRFEPLKVDAI-GPTVFVEG-QDLSRNITWVHAWTVTDGIITQVREYFNTSLT  381
             +T  +SF+F P ++ ++ G    VEG +D+     WVH W+V DGIITQ+REYFNT LT
Sbjct  72   ESTQ-NSFKFRPRRMRSVMGDRWIVEGWEDVGE--YWVHVWSVKDGIITQLREYFNTLLT  128

Query  380  -VTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
             V+  GN                 +W S+   RV  S+P LVL+I
Sbjct  129  VVSEDGNEV--------------RLWRSTPWARVQGSLPDLVLSI  159



>gb|ABF95470.1| Wound-induced protein 1, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89649.1| hypothetical protein OsI_11180 [Oryza sativa Indica Group]
 gb|EAZ26611.1| hypothetical protein OsJ_10513 [Oryza sativa Japonica Group]
 dbj|BAG90781.1| unnamed protein product [Oryza sativa Japonica Group]
Length=124

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 71/124 (57%), Gaps = 15/124 (12%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREY  399
            +MR+LTG       F F P  VDA G TV  EG D +R + WVHAWTV  DG+ITQ+REY
Sbjct  1    MMRLLTGADHGESRFLFSPRSVDAFGSTVIAEGTDDTRQLYWVHAWTVGPDGVITQLREY  60

Query  398  FNTSLTVTRF--------------GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGL  261
            FNT LTVTR                ++ AS++A    P     +W+S   +R  KS+PGL
Sbjct  61   FNTDLTVTRLSASAAKTTAAISSSNSNHASSSAPPPPPSKPKCLWQSRRADRAHKSLPGL  120

Query  260  VLAI  249
            VLAI
Sbjct  121  VLAI  124



>gb|AFM95222.1| senescence-associated protein 20, partial [Cynara cardunculus 
var. scolymus]
Length=117

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = -2

Query  614  LEWWFHGPPSHQF-LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNIT--WVH  444
            ++WWFHGPP+H+F LM++L+G     D+  F PL + AIG  V  EG  + ++    WVH
Sbjct  1    IDWWFHGPPAHKFNLMQLLSGGCACNDTNSFNPLSIVAIGSLVGAEGYHIHKSGKNHWVH  60

Query  443  AWTVTDG-IITQVREYFNTSLTVTR  372
            AWTV +G IIT+V+EY NTS+TV R
Sbjct  61   AWTVENGKIITEVKEYLNTSVTVAR  85



>gb|EMT05243.1| hypothetical protein F775_04576 [Aegilops tauschii]
Length=153

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 82/154 (53%), Gaps = 15/154 (10%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
            N+ VV +L  +L+  D   V  L A+DL+WWFHGP   Q + R+LTG A    +FRF P 
Sbjct  10   NREVVESLYASLARGDAAAVTALLATDLDWWFHGPRRCQHMRRMLTGEAAGAAAFRFAPT  69

Query  515  KVDAIGPT-----VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsas  351
            +V  +G T     V  EG     +  WVH W +  G+IT  REYFNTS+TV   G  +  
Sbjct  70   RVSEVGGTMDGRWVVAEGWTGEHDY-WVHVWCLRGGVITSFREYFNTSVTVRNLGQTAED  128

Query  350  aaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                        ++WES  P    +S+PGLVLAI
Sbjct  129  VVW---------AIWESQSPRPKSRSMPGLVLAI  153



>ref|XP_010032950.1| PREDICTED: uncharacterized protein LOC104422343 [Eucalyptus grandis]
 gb|KCW52456.1| hypothetical protein EUGRSUZ_J01851 [Eucalyptus grandis]
Length=161

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 84/161 (52%), Gaps = 27/161 (17%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXAS--DLEWWFHGPPSHQFLMRILTGTATAGD----S  534
            NK+VV  L +AL++ D + V KL  S  DLEW +HGPP  Q++MR LTG     +     
Sbjct  16   NKKVVAMLYKALAAGDGEGVSKLVTSNDDLEWRYHGPPQCQYMMRALTGHHRRHEPEDRK  75

Query  533  FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DG---IITQVREYFNTSLT--VTR  372
            FRF+P ++ A    V VEG D   +  WVH WT+  DG   +I + REYF T LT  V  
Sbjct  76   FRFKPRRITAFRDRVIVEGWD-GLDAYWVHVWTLKMDGSRPVIAEFREYFKTWLTVIVRS  134

Query  371  FGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +G                 SVW+S       +S+P ++LAI
Sbjct  135  YGKEV--------------SVWQSEPRLHRNRSLPDIILAI  161



>emb|CDP04078.1| unnamed protein product [Coffea canephora]
Length=115

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 17/120 (14%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDL-SRNITWVHAWTVTDG-IITQVREY  399
            M +LTG  +   SF F+PL ++A G  V VEG D  + +++WVHAWTV+ G +ITQVREY
Sbjct  1    MGLLTGKDS---SFVFKPLSIEAFGSLVLVEGFDQKNSSVSWVHAWTVSQGRMITQVREY  57

Query  398  FNTSLTVTRFGNHsasaaaaAITPL----------HCPSVWESSLPNRVGKSVPGLVLAI  249
            FNT +TVT  G+ +  ++  +  P           +C S+W+S L +     VPGLVLA+
Sbjct  58   FNTHVTVTLLGSCTTKSSNESEQPQGASSQANPLKYCQSIWQSKLVDN--SVVPGLVLAL  115



>ref|XP_002465402.1| hypothetical protein SORBIDRAFT_01g038030 [Sorghum bicolor]
 gb|EER92400.1| hypothetical protein SORBIDRAFT_01g038030 [Sorghum bicolor]
Length=139

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 69/139 (50%), Gaps = 30/139 (22%)
 Frame = -2

Query  575  LMRILTGT-------ATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DGI  420
            +MR+LTG           G  F F P  VDA G TV  EG D +R + WVHAWTV  DG+
Sbjct  1    MMRLLTGADQRDKQNRGGGGGFVFSPRSVDAFGSTVIAEGADDARQLYWVHAWTVGPDGV  60

Query  419  ITQVREYFNTSLTVTRF-GNHsasaaaaAITPLHCPS---------------------VW  306
            ITQ+REYFNT LTVT   G+ + S+   A      P                      +W
Sbjct  61   ITQLREYFNTDLTVTLLSGSGAVSSTKKADIAGALPKLQDAASSSSSSSPSAAAGPKCLW  120

Query  305  ESSLPNRVGKSVPGLVLAI  249
            +S   +   KS+PGLVLAI
Sbjct  121  QSRRADSAHKSLPGLVLAI  139



>gb|ACU16338.1| unknown [Glycine max]
Length=144

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 82/147 (56%), Gaps = 8/147 (5%)
 Frame = +3

Query  150  PRRRKIRRCPFSPYEIKTRAF--YFLFMGMDRVGLDCEDETRDRFPNPIGEAALPDRRav  323
            P  R +    F+ Y   T  F  Y L      + L C+++T   FP+P G+AA PD    
Sbjct  4    PSHRHVHNSLFNYYSHVTAFFPNYLLI-----IILYCKNQTGYGFPDPTGDAAFPDT-GQ  57

Query  324  egsdsgggggggmvaeasdgEGGVEVLADLGDYPIRDGPGVDPGDVARQVLALDEHGGAN  503
                         + +A DGEGGVEVL+DL +YPIRDG GVDPG+VA  V ALD+ GGA 
Sbjct  58   TAGAGASRNNLAGIVDAGDGEGGVEVLSDLSNYPIRDGAGVDPGNVAGGVAALDDDGGAE  117

Query  504  GVDFEGLKSEGIAGGCSAGEDAHQKLV  584
            G D    ++EG+ G   AGE AHQKLV
Sbjct  118  GGDGLRKEAEGVVGSGVAGEHAHQKLV  144



>gb|EEE63316.1| hypothetical protein OsJ_18127 [Oryza sativa Japonica Group]
Length=175

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 82/161 (51%), Gaps = 13/161 (8%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA--GDSFRFE  522
            N+R+V +L  A+++ D      + A D++WWFHGP   + + R LTG A A    SF F 
Sbjct  16   NERLVESLYAAVAAGDGAAASAVLAGDVDWWFHGPRRCEHMRRRLTGEAEAASASSFVFV  75

Query  521  PLKVDAIGPT---VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF--GNHs  357
            P +V A+G     V  EG +  R   WVHAW V  G IT++REYFNTS+TV     G H 
Sbjct  76   PRQVAAVGRGGGWVVAEGWEGPRAY-WVHAWAVEGGRITRLREYFNTSVTVRDVGGGGHC  134

Query  356  asaaaaAITPLHCPSVWESS-----LPNRVGKSVPGLVLAI  249
                            W+S        +   +S+PGLVLAI
Sbjct  135  RPQLDGGGVRRRAAVCWQSQRGRGGGDDDDDRSLPGLVLAI  175



>ref|NP_001174370.1| Os05g0342100 [Oryza sativa Japonica Group]
 gb|AAV43863.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV44155.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG99159.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93098.1| Os05g0342100 [Oryza sativa Japonica Group]
Length=177

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 82/161 (51%), Gaps = 13/161 (8%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATA--GDSFRFE  522
            N+R+V +L  A+++ D      + A D++WWFHGP   + + R LTG A A    SF F 
Sbjct  18   NERLVESLYAAVAAGDGAAASAVLAGDVDWWFHGPRRCEHMRRRLTGEAEAASASSFVFV  77

Query  521  PLKVDAIGPT---VFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRF--GNHs  357
            P +V A+G     V  EG +  R   WVHAW V  G IT++REYFNTS+TV     G H 
Sbjct  78   PRQVAAVGRGGGWVVAEGWEGPRAY-WVHAWAVEGGRITRLREYFNTSVTVRDVGGGGHC  136

Query  356  asaaaaAITPLHCPSVWESS-----LPNRVGKSVPGLVLAI  249
                            W+S        +   +S+PGLVLAI
Sbjct  137  RPQLDGGGVRRRAAVCWQSQRGRGGGDDDDDRSLPGLVLAI  177



>gb|ACG48358.1| wound-induced protein WI12 containing protein [Zea mays]
Length=101

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 64/114 (56%), Gaps = 18/114 (16%)
 Frame = -2

Query  575  LMRILTGTATAG-DSFRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVT-DGIITQ  411
            +MR+LT T T    SFRF P  VDA+     TV  EG +  R   WVHAWTV  DG+ITQ
Sbjct  1    MMRLLTTTTTTTTGSFRFVPRSVDALAASSGTVIAEGHE--RGCYWVHAWTVGPDGVITQ  58

Query  410  VREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +REYFNT LTVTR               +    VW+S  P+    S+PGL+LA+
Sbjct  59   LREYFNTDLTVTRLA-----------AAVAAKCVWQSRRPDSATNSLPGLLLAL  101



>ref|NP_001130795.1| uncharacterized protein LOC100191899 [Zea mays]
 gb|ACF79150.1| unknown [Zea mays]
 tpg|DAA64234.1| TPA: wound-induced protein WI12 containing protein [Zea mays]
Length=102

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 56/100 (56%), Gaps = 17/100 (17%)
 Frame = -2

Query  536  SFRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRF  369
            SFRF P  VDA+     TV  EG +  R   WVHAWTV  DG+ITQ+REYFNT LTVTR 
Sbjct  16   SFRFVPRSVDALAASSGTVIAEGHE--RGCYWVHAWTVGPDGVITQLREYFNTDLTVTRL  73

Query  368  GNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                          +    VW+S  P+    S+PGL+LA+
Sbjct  74   A-----------AAVAAKCVWQSRRPDSATNSLPGLLLAL  102



>emb|CBI18080.3| unnamed protein product [Vitis vinifera]
Length=124

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 73/152 (48%), Gaps = 43/152 (28%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRF  525
            E+++K  V+ L  AL++ D  +V  L ASDLEWWFHGPP  Q +MR+LTG +   + F+F
Sbjct  16   ESQDKANVIELYNALANGDTQIVAGLLASDLEWWFHGPPLCQHMMRVLTGESVHTE-FKF  74

Query  524  EPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaa  345
            EP  + AI   V  EG + ++   WVH+                                
Sbjct  75   EPRSITAIDGCVIAEGWEGAQAY-WVHS--------------------------------  101

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                     P++W+S   +   +S+PGL+LAI
Sbjct  102  ---------PTLWQSQPRDLAKRSLPGLLLAI  124



>ref|XP_001783793.1| predicted protein [Physcomitrella patens]
 gb|EDQ51385.1| predicted protein [Physcomitrella patens]
Length=115

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 68/118 (58%), Gaps = 13/118 (11%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQ---------DLSRNITWVHAWTVTDGI  420
            MR+LTG  T+ D+F F+   +  IG  VFVEG+          L + + WVH WT+ DG 
Sbjct  1    MRLLTG-VTSCDTFTFKLTGIRGIGNRVFVEGEAPSARGSISGLKKPVYWVHIWTLKDGK  59

Query  419  ITQVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSL-PNRVGKSVPGLVLAI  249
            ITQ+REYFNT++ VT     + +       P  C S+W + L  ++ G+ +PGL+LAI
Sbjct  60   ITQLREYFNTAILVTDLKPTAPTPHEIQHHP--CASLWHNRLWKSKEGRELPGLILAI  115



>gb|KCW52457.1| hypothetical protein EUGRSUZ_J01852, partial [Eucalyptus grandis]
Length=148

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 82/161 (51%), Gaps = 27/161 (17%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASD--LEWWFHGPPSHQFLMRILTGTATAGD----S  534
            NK+VV  L +AL++ D + V KL  S+  LEW ++GPP  Q++MR LTG     +     
Sbjct  3    NKKVVAMLYKALAAGDGEAVSKLVTSNNNLEWRYNGPPQCQYMMRALTGHHQQREPEDRK  62

Query  533  FRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVT-DG---IITQVREYFNT--SLTVTR  372
            FRF+  ++ A    V VEG D   +   VH WT+  DG   +I + REYFNT  ++ V  
Sbjct  63   FRFKTSRITAFRDRVIVEGWD-GLDAYCVHVWTLKMDGSHPVIAEFREYFNTWLAVIVRS  121

Query  371  FGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            +G                  VW+S       +S+P +VLAI
Sbjct  122  YGKEV--------------RVWQSEPRLHRNRSLPDIVLAI  148



>ref|XP_002461263.1| hypothetical protein SORBIDRAFT_02g043820 [Sorghum bicolor]
 gb|EER97784.1| hypothetical protein SORBIDRAFT_02g043820 [Sorghum bicolor]
Length=107

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 66/117 (56%), Gaps = 18/117 (15%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAI-------GPTVFVEGQDLSRNITWVHAWTV-TDGI  420
            +MR+LTG   +   FRF P  VDA+         TV  EG +      WVHAWTV  DG+
Sbjct  1    MMRLLTGGGGSSGGFRFVPRSVDALVAPTPTTSTTVIAEGHE--GRCYWVHAWTVGADGV  58

Query  419  ITQVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
            ITQ+REYFNT LTVTR    + +A+A          VW+S  P+    S+PGL+LA+
Sbjct  59   ITQLREYFNTDLTVTRLAAVAVAASAK--------CVWQSRRPDSATNSLPGLLLAL  107



>gb|KHN19132.1| Wound-induced protein 1, partial [Glycine soja]
Length=93

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -2

Query  521  PLKVDAIGPTVFVEGQDLSRNITWVHAWTVTD-GIITQVREYFNTSLTVTRFGNHsasaa  345
            P  V   G     EG D S  + WVHAWT TD GIIT+VREY NTS+TVT+ G H  +  
Sbjct  8    PDLVVGFGSVTIAEGFDESNLVWWVHAWTTTDEGIITEVREYVNTSVTVTKLGLHVNNDD  67

Query  344  aaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
              + T   C SVW+S L +   +SVPGL+LAI
Sbjct  68   VVSAT---CQSVWQSKLCD---ESVPGLILAI  93



>gb|ACN85337.1| unknown [Oryza granulata]
Length=310

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 74/162 (46%), Gaps = 40/162 (25%)
 Frame = -2

Query  686  VVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVD  507
             VL L EA++SRD      L A D             +M +LTG A A  SFRF PL VD
Sbjct  102  AVLRLYEAINSRDHATAHALLAPD-----------HHMMHLLTGGA-APSSFRFRPLSVD  149

Query  506  AIGPT--------VFVEGQDLSRNITWVHAWTV-TDGIITQVREYFNTSLTVTRFGNHsa  354
            A+  +                +    WVHAWTV   G+IT + EYFNT LTVTR      
Sbjct  150  ALRASDVVVVEGVTTTSASAAAGYCYWVHAWTVGPHGVITHLPEYFNTDLTVTRL-----  204

Query  353  saaaaAITPLHCPS-----VWESSLPNRVGKSVPGLVLAI*P  243
                     L  P+     +W+S  P+R   ++PGLVLA  P
Sbjct  205  ---------LAAPTAATRYLWQSRRPDRATNALPGLVLAPVP  237



>ref|XP_010094676.1| hypothetical protein L484_003305 [Morus notabilis]
 gb|EXB56618.1| hypothetical protein L484_003305 [Morus notabilis]
Length=101

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPL  516
            N++ V    +A +S D + + ++ ASDLEWWFHGPP+ Q +MR LTG +   + F+F+P 
Sbjct  23   NRKTVKGFYKAFASNDTETISRVVASDLEWWFHGPPNCQHMMRTLTGKSNPSE-FKFKPR  81

Query  515  KVDAIGPTVFVEG  477
             + A    V VEG
Sbjct  82   NITAFADRVIVEG  94



>ref|XP_006658169.1| PREDICTED: wound-induced protein 1-like [Oryza brachyantha]
Length=104

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 54/102 (53%), Gaps = 17/102 (17%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPT--VFVEG---QDLSRNITWVHAWTV-TDGIIT  414
            +MR+LTG +    SFRF PL VDA+  +  V  EG      S    WVHAWTV  DG+IT
Sbjct  1    MMRLLTGASAPSSSFRFRPLSVDALPASDVVIAEGIIAGAASGYCYWVHAWTVGPDGVIT  60

Query  413  QVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPN  288
             +REY NT LTVTR              P  C  +W+S  P+
Sbjct  61   HLREYLNTDLTVTRL---------LLAAPARC--LWQSRRPD  91



>ref|XP_006378646.1| hypothetical protein POPTR_0010s18940g [Populus trichocarpa]
 gb|ERP56443.1| hypothetical protein POPTR_0010s18940g [Populus trichocarpa]
Length=101

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  361  WLPKRVTVREVLKYSRTWVIIPSVTVQAWTQVMLRDRSWPSTNTVGPMASTLRGSN-RKE  537
            W P+RVTVREVLKYS TWVIIPSVTVQA TQ M R    PST T  P      G      
Sbjct  27   WFPRRVTVREVLKYSLTWVIIPSVTVQACTQEMERLVLHPSTTTRFPKEVMEIGEKPNGT  86

Query  538  SPAVAVPVRMRIKNW  582
            S +   PVR RI NW
Sbjct  87   SLSFCSPVRRRIINW  101



>ref|XP_003570951.1| PREDICTED: wound-induced protein 1-like [Brachypodium distachyon]
Length=178

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 81/159 (51%), Gaps = 14/159 (9%)
 Frame = -2

Query  692  KRVVLALXEALSSRDVDLVQKLXASDLEWWFHGPP-SHQFLMRILTG---TATAGDSFRF  525
            + VV +L  +L+  D      L A+D++WWFHGP    Q + R+LTG   +ATA  +FRF
Sbjct  23   RAVVESLYASLARGDAAAATALLAADVDWWFHGPRRCQQHMRRLLTGELSSATATAAFRF  82

Query  524  EPLKVDAIGPT-VFVEG-----QDLSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFGN  363
             P +V  +G   V  EG      +      WVHAW V  G+I+  REYFNT +TV   G 
Sbjct  83   APARVADVGEGWVLAEGWAAGAGEEGEKDYWVHAWRVRGGVISGFREYFNTCVTVRELGR  142

Query  362  HsasaaaaAITPLHCPSVWESSLP-NRVGKSVPGLVLAI  249
                            +VWES  P  +  + +PGLVLAI
Sbjct  143  RPGPVKEEGDVLW---AVWESQNPWPKAQRCMPGLVLAI  178



>ref|XP_010032951.1| PREDICTED: uncharacterized protein LOC104422344 [Eucalyptus grandis]
Length=140

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 77/154 (50%), Gaps = 27/154 (18%)
 Frame = -2

Query  674  LXEALSSRDVDLVQKLXASD--LEWWFHGPPSHQFLMRILTGTATAGD----SFRFEPLK  513
            L +AL++ D + V KL  S+  LEW ++GPP  Q++MR LTG     +     FRF+  +
Sbjct  2    LYKALAAGDGEAVSKLVTSNNNLEWRYNGPPQCQYMMRALTGHHQQREPEDRKFRFKTSR  61

Query  512  VDAIGPTVFVEGQDLSRNITWVHAWTVT-DG---IITQVREYFNT--SLTVTRFGNHsas  351
            + A    V VEG D   +   VH WT+  DG   +I + REYFNT  ++ V  +G     
Sbjct  62   ITAFRDRVIVEGWD-GLDAYCVHVWTLKMDGSHPVIAEFREYFNTWLAVIVRSYGKEV--  118

Query  350  aaaaAITPLHCPSVWESSLPNRVGKSVPGLVLAI  249
                         VW+S       +S+P +VLAI
Sbjct  119  ------------RVWQSEPRLHRNRSLPDIVLAI  140



>gb|ACN31379.1| unknown [Zea mays]
Length=140

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 58/127 (46%), Gaps = 33/127 (26%)
 Frame = -2

Query  536  SFRFEPLKVDAIGP---TVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRF  369
            SFRF P  VDA+     TV  EG +  R   WVHAWTV  DG+ITQ+REYFNT LTVTR 
Sbjct  16   SFRFVPRSVDALAASSGTVIAEGHE--RGCYWVHAWTVGPDGVITQLREYFNTDLTVTRL  73

Query  368  GN---------------------------HsasaaaaAITPLHCPSVWESSLPNRVGKSV  270
                                         ++          +    VW+S  P+    S+
Sbjct  74   AEGHERGCYWVHAWTVGPDGVITQLREYFNTDLTVTRLAAAVAAKCVWQSRRPDSATNSL  133

Query  269  PGLVLAI  249
            PGL+LA+
Sbjct  134  PGLLLAL  140



>emb|CDY36286.1| BnaA01g31320D [Brassica napus]
Length=124

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 66/112 (59%), Gaps = 13/112 (12%)
 Frame = +3

Query  384  EGGVEVLADLGDYPIRDGPGVDPGDVARQVLALDEHGGANGV-----DFEGLKSEGIAGG  548
            E  V VL  L DYP+R GPGVDPGD A  V AL + GG+ G      +FEG +       
Sbjct  21   ERSVRVLPHLSDYPMRHGPGVDPGDGASGVAALGDDGGSEGDDGERHEFEGRR-------  73

Query  549  CSAGEDAHQKLVGRRTMEPPL*VRGXKFLDQIHVAGAQGFXQGEHHPLVSGL  704
              AGE AHQKLV RR +EP + +RG   ++++ V+ +QG  Q ++H  V GL
Sbjct  74   -DAGERAHQKLVRRRAVEPVVEIRGEDPVNRLGVSRSQGVIQFQNHGSVLGL  124



>gb|KHN02123.1| Wound-induced protein 1 [Glycine soja]
Length=80

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  506  AIGPTVFVEGQDLSRNITWVHAWTVT-DGIITQVREYFNTSLTVTRFGNHsasaaaaAIT  330
              GP V  EG D    + WVHAWTVT DG+ITQV+EY NTS+TVT         A+    
Sbjct  3    GFGPVVIAEGFDDDHLVWWVHAWTVTADGLITQVKEYVNTSVTVTLLSQQVLPNAS----  58

Query  329  PLHCPSVWESSLPNRVGKSVPGLVLAI  249
               C  +W+S L +   +SVPGL+L I
Sbjct  59   --KCQCIWQSRLCD---ESVPGLILPI  80



>gb|AFG55123.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55124.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55127.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55128.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55129.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55130.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55131.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55132.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55133.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55134.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55135.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55136.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55137.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
 gb|AFG55138.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
Length=67

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 6/68 (9%)
 Frame = -2

Query  452  WVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKS  273
            WVH WTV +GIIT+VREYFNT++TVT F                C  +WESS      KS
Sbjct  6    WVHVWTVENGIITEVREYFNTTITVTDFNPSLLREKQL------CSPMWESSAVKSKEKS  59

Query  272  VPGLVLAI  249
            +PGLV AI
Sbjct  60   MPGLVFAI  67



>gb|AFG55125.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
Length=67

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 6/68 (9%)
 Frame = -2

Query  452  WVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKS  273
            WVH WTV +GIIT+VREYFNT++TVT F                C  +WESS      KS
Sbjct  6    WVHVWTVENGIITEVREYFNTTITVTDFNPSLLREKQL------CSPMWESSTVKSKEKS  59

Query  272  VPGLVLAI  249
            +PGLV AI
Sbjct  60   MPGLVFAI  67



>ref|XP_007026530.1| Uncharacterized protein TCM_021566 [Theobroma cacao]
 gb|EOY07032.1| Uncharacterized protein TCM_021566 [Theobroma cacao]
Length=132

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 45/87 (52%), Gaps = 2/87 (2%)
 Frame = +1

Query  379  TVREVLKYSRTWVIIPSVTVQAWTQVMLRDRSWPSTNTVGPMASTLRGSNRKESPAVAVP  558
            TV  VLKYS   VI PS  V  WTQ      S PS  T  P  S L GSN   S  +  P
Sbjct  38   TVSHVLKYSLNCVIRPSFKVHTWTQYTCAP-SQPSAITQSPTTSMLLGSNL-NSVWLDSP  95

Query  559  VRMRIKNWWDGGPWNHHSRSEAXSFWT  639
            V  RI  W  GGPWNHHSRS A S  T
Sbjct  96   VSTRIICWHRGGPWNHHSRSLASSLTT  122



>gb|AFG55126.1| hypothetical protein 0_16615_01, partial [Pinus taeda]
Length=67

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 39/68 (57%), Gaps = 6/68 (9%)
 Frame = -2

Query  452  WVHAWTVTDGIITQVREYFNTSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKS  273
            WVH WTV +GIIT+VREYFNT++TVT F                C  +WESS      K 
Sbjct  6    WVHVWTVENGIITEVREYFNTTITVTDFNPSLLREKQL------CSPMWESSAVKSKEKC  59

Query  272  VPGLVLAI  249
            +PGLV AI
Sbjct  60   MPGLVFAI  67



>ref|XP_001778855.1| predicted protein [Physcomitrella patens]
 gb|EDQ56305.1| predicted protein [Physcomitrella patens]
Length=105

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 8/107 (7%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYFN  393
            M++L    T   +F F P +V   G  VFVEG   + N +WVH WT+   +   +REYFN
Sbjct  1    MKLLLTGITTCKTFHFTPNEVFLFGNRVFVEGFGRTINTSWVHIWTIHQNLCVMLREYFN  60

Query  392  TSLTVTRFGNHsasaaaaAITPLHCPSVWESSLPNRVGKSVPGLVLA  252
            T++ VT   +       + I        W+S L      ++PG+VLA
Sbjct  61   TAIMVTNVTSSQKEHDVSYI--------WQSHLARIRDINIPGVVLA  99



>ref|XP_010264764.1| PREDICTED: uncharacterized protein LOC104602681 [Nelumbo nucifera]
Length=236

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  656  SRDVDLVQKLXASDLEWWFHGPPSHQFLMRILTGTATAGDSFRFEPLKVDAI  501
            S D++ V +L A+DLEWWFHGPP  Q +MR+LTG ++  + F+FEP  + AI
Sbjct  8    SGDIETVARLLAADLEWWFHGPPRCQHMMRLLTGQSSHAE-FKFEPQSITAI  58



>gb|AFG49700.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
Length=84

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDG--IITQVREY  399
            MRILTG   +  SF F P  + A+G  + V       ++ WVH WT+ +    ITQ+REY
Sbjct  1    MRILTGHHES--SFTFVPHSITALGHNLVVAEGREDESVYWVHVWTLDNAGCTITQLREY  58

Query  398  FNTSLTVTRF  369
            FNTSL VT F
Sbjct  59   FNTSLVVTEF  68



>gb|AFG49693.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49697.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49705.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
Length=84

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDG--IITQVREY  399
            MRILTG   +  SF F P  + A+G  + V       ++ WVH WT+ +    ITQ+REY
Sbjct  1    MRILTGHHES--SFTFVPHSITALGYNMVVAEGREDESVYWVHVWTLDNAGCTITQLREY  58

Query  398  FNTSLTVTRF  369
            FNTSL VT F
Sbjct  59   FNTSLVVTEF  68



>gb|AFG49703.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
Length=84

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDG--IITQVREY  399
            MRILTG   +  SF F P  + A+G  + V       ++ WVH WT+ +    ITQ+REY
Sbjct  1    MRILTGHHES--SFTFVPHSITALGHNLVVAEGREDESMYWVHVWTLDNAGCTITQLREY  58

Query  398  FNTSLTVTRF  369
            FNTSL VT F
Sbjct  59   FNTSLVVTEF  68



>ref|NP_001169134.1| uncharacterized protein LOC100382979 [Zea mays]
 gb|ACN31740.1| unknown [Zea mays]
Length=137

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = +3

Query  435  GPGVDPGDVARQVLALDEHGGANGVDFEGLKSEGIAGGC-SAGEDAHQKLVGRRTMEPPL  611
            GPGV P ++AR V AL + GGA GVD  G + E  A    SAGE AH  L   R MEPPL
Sbjct  5    GPGVHPVELARVVGALGDDGGAEGVD--GARGEDEAAVVQSAGEQAHHVLARGRAMEPPL  62

Query  612  *VRGXKFLDQIHVAGAQGFXQGEHHPLVSGL  704
             VR  + L    VAG +   Q +H   V+ L
Sbjct  63   EVRRQQLLRPARVAGVERLVQPQHQEAVALL  93



>ref|XP_001759839.1| predicted protein [Physcomitrella patens]
 gb|EDQ75343.1| predicted protein [Physcomitrella patens]
Length=111

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (54%), Gaps = 4/112 (4%)
 Frame = -2

Query  575  LMRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDGIITQVREYF  396
            + ++LTG   +  S    P  + A    V VEG+   + + WVH WTV +G + Q++EY+
Sbjct  1    MSKLLTGI-ISFRSVTLIPSSILATHNIVIVEGESFCQEVAWVHIWTVKEGKLVQLQEYW  59

Query  395  NTSLTVTRFGNHsa-saaaaAITPLH--CPSVWESSLPNRVGKSVPGLVLAI  249
            NT++++      ++ S  +    PL    P +W+S L + V  + PGL+L I
Sbjct  60   NTAVSINSSACLTSDSCCSKRQLPLQSTSPIIWQSKLWHDVNNTKPGLILTI  111



>gb|AFG49692.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49694.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49695.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49696.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49698.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49699.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49701.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49702.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
 gb|AFG49704.1| hypothetical protein 0_9318_01, partial [Pinus taeda]
Length=84

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -2

Query  572  MRILTGTATAGDSFRFEPLKVDAIGPTVFVEGQDLSRNITWVHAWTVTDG--IITQVREY  399
            MRILTG   +  SF F P  + A+G  + V       ++ WVH WT+ +    ITQ+REY
Sbjct  1    MRILTGHHES--SFTFVPHSITALGHNLVVAEGREDESVYWVHVWTLDNAGCTITQLREY  58

Query  398  FNTSLTVTRF  369
             NTSL VT F
Sbjct  59   CNTSLVVTEF  68



>ref|XP_002984259.1| hypothetical protein SELMODRAFT_423366 [Selaginella moellendorffii]
 gb|EFJ14769.1| hypothetical protein SELMODRAFT_423366 [Selaginella moellendorffii]
Length=209

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 15/121 (12%)
 Frame = -2

Query  713  TXEETRNK-RVVLALXEALSSRDVDLVQKLXASDLEWWFHGPP-SHQFLMRILTGTATAG  540
            T E TR    +V+   + L + D   ++ L + ++EW FHGP  S++++M++LTG    G
Sbjct  51   TVESTRQLVDLVVQFYDRLLAADAITLKSLVSDEIEWRFHGPRLSNKYMMKLLTGEKRIG  110

Query  539  DSFRFEPLKVDAIGPT-VFVEGQDLSRNITWVHAWTVT--DGIITQVREYFNTSLTVTRF  369
             S  F P  +  I  T    +GQ       W+H WTV    G +T + EY N   T+  F
Sbjct  111  -SVSFVPDHIHRIDSTRAAAQGQG------WLHVWTVNIDTGKLTNLSEYCN---TIIEF  160

Query  368  G  366
            G
Sbjct  161  G  161



>ref|WP_043458230.1| hypothetical protein [Azohydromonas australica]
Length=134

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 52/119 (44%), Gaps = 10/119 (8%)
 Frame = -2

Query  695  NKRVVLALXEALSSRDVDLVQKLXASDLEWWFHG--PPSHQFLMRILTGTATAGDSFRFE  522
            NKRV  A   A+   D   +Q L A    WW  G    S +  +  ++ T  A D  R  
Sbjct  9    NKRVAAAFLHAIERGDAPGLQALLAPGFSWWVAGWGERSRKAFLDAVSRTMRAFDERRVT  68

Query  521  PLKVDAIGPTVFVEGQD-------LSRNITWVHAWTVTDGIITQVREYFNTSLTVTRFG  366
            P  V A    V VE Q        + RN T+ + + V DG+I   REYF+T+     FG
Sbjct  69   PTGVTAEADRVAVEAQGHFERPGLVYRN-TYHYLFIVRDGLIASGREYFDTAAAAAAFG  126



>dbj|BAF95861.1| hypothetical protein [Vitis hybrid cultivar]
Length=56

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -2

Query  599  HGPPSHQFLMRILTGTATAGDSFRFEPLKVDAIGPT  492
            HGPPSHQF+MR+LTG  ++ +SF FEPL   ++G T
Sbjct  1    HGPPSHQFMMRLLTGV-SSDESFVFEPLAYASLGST  35



>ref|XP_002972428.1| hypothetical protein SELMODRAFT_412807 [Selaginella moellendorffii]
 gb|EFJ26514.1| hypothetical protein SELMODRAFT_412807 [Selaginella moellendorffii]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 11/109 (10%)
 Frame = -2

Query  686  VVLALXEALSSRDVDLVQKLXASDLEWWFHGPP-SHQFLMRILTGTATAGDSFRFEPLKV  510
            +V+   + L + D   ++ L + ++EW FHGP  S++++M++LTG    G S  F P  +
Sbjct  61   LVVQFYDRLLAADAITLKSLVSDEIEWRFHGPRLSNKYMMKLLTGEKRIG-SVSFVPDHI  119

Query  509  DAIGPT-VFVEGQDLSRNITWVHAWTVT--DGIITQVREYFNTSLTVTR  372
              I  T    +GQ       W+H WTV    G +T + EY NT +   R
Sbjct  120  HRIDSTRAAAQGQG------WLHVWTVNIDTGKLTHLSEYCNTIIEFGR  162



>emb|CDY72676.1| BnaAnng42010D [Brassica napus]
Length=101

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 53/107 (50%), Gaps = 26/107 (24%)
 Frame = +3

Query  384  EGGVEVLADLGDYPIRDGPGVDPGDVARQVLALDEHGGANGVDFEGLKSEGIAGGCSAGE  563
            E  V VL  L DYP+R G   D G+                 +FEG +         AGE
Sbjct  21   ERSVRVLPHLSDYPMRHG---DDGERR---------------EFEGRR--------DAGE  54

Query  564  DAHQKLVGRRTMEPPL*VRGXKFLDQIHVAGAQGFXQGEHHPLVSGL  704
             AHQKLV RR +EP + +RG   ++++ VA +QG  Q ++H  V GL
Sbjct  55   RAHQKLVRRRAVEPVVEIRGEDPVNRLGVARSQGVIQFQNHGSVLGL  101



>ref|WP_028930094.1| hypothetical protein [Pseudonocardia asaccharolytica]
Length=135

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 50/121 (41%), Gaps = 16/121 (13%)
 Frame = -2

Query  704  ETRNKRVVLALXEALSSRDVDLVQKLXASDLEWW-------FHGPPSHQFLMRILTGTA-  549
            E RNK++V    E  SS DVD +    A D +WW         G         +++G A 
Sbjct  5    EERNKQIVAEFMEVFSSGDVDGILSCLADDAKWWVAGSIPGISGTKDKAGFKEMVSGIAE  64

Query  548  -TAGDSFRFEPLKVDAIGPTVFVEGQDLSR-------NITWVHAWTVTDGIITQVREYFN  393
             T   + R  PL   A G  V VE +  +        N  +   + V DG I  V+EY +
Sbjct  65   STTTGAIRLTPLGFTAEGDRVAVETESYTELKNGRVYNNLYHFLFEVRDGKIAAVKEYLD  124

Query  392  T  390
            T
Sbjct  125  T  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470