BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035F10

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    263   3e-82   Nicotiana sylvestris
ref|XP_009599751.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    262   3e-82   Nicotiana tomentosiformis
gb|ADG41743.1|  putative progesterone 5 beta-reductase                  262   5e-82   Nicotiana tabacum [American tobacco]
dbj|BAH47641.1|  progesterone 5beta reductase-B                         261   1e-81   Nicotiana tabacum [American tobacco]
gb|AEX31544.1|  putative steroid 5beta-reductase                        258   9e-81   Solanum tuberosum [potatoes]
ref|XP_006353962.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    258   1e-80   
gb|AFZ41795.1|  putative progesterone 5-beta-reductase                  256   1e-79   Duboisia hopwoodii
ref|NP_001266103.1|  putative steroid 5beta-reductase                   254   5e-79   
gb|ADG46023.1|  progesterone 5-beta-reductase                           253   1e-78   Atropa belladonna [deadly nightshade]
gb|ADK13080.1|  putative progesterone 5-beta-reductase                  253   1e-78   Nierembergia aristata
gb|AIW09143.1|  progesterone 5-beta-reductase 1                         251   6e-78   Catharanthus roseus [chatas]
gb|AIW09144.1|  progesterone 5-beta-reductase 2                         251   1e-77   Catharanthus roseus [chatas]
gb|EPS65468.1|  progesterone 5-beta-reductase                           251   1e-77   Genlisea aurea
gb|ADG46022.1|  progesterone 5-beta-reductase                           250   2e-77   Mentha x piperita
gb|AFW97632.1|  putative progesterone 5-beta-reductase                  248   8e-77   Salvia rosmarinus
ref|XP_011088171.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    246   8e-76   Sesamum indicum [beniseed]
gb|AEY82379.1|  putative progesterone 5-beta-reductase                  246   9e-76   Withania somnifera [ashwagandha]
gb|AGT29344.1|  putative progesterone 5-beta reductase 1_2              246   9e-76   Thymus serpyllum [creeping thyme]
gb|AFZ42257.2|  putative progesterone 5-beta-reductase                  246   9e-76   Thymus serpyllum [creeping thyme]
sp|Q6PQJ9.1|5BPOR_DIGLA  RecName: Full=3-oxo-Delta(4,5)-steroid 5...    244   4e-75   Digitalis lanata [Grecian foxglove]
gb|ADG46027.1|  putative progesterone 5-beta-reductase                  244   5e-75   Coffea arabica [arabica coffee]
gb|KHN45161.1|  Hypothetical protein glysoja_031389                     238   9e-75   Glycine soja [wild soybean]
emb|CDO97253.1|  unnamed protein product                                243   1e-74   Coffea canephora [robusta coffee]
gb|ABA77560.1|  progesterone 5-beta-reductase                           242   2e-74   Digitalis sibirica
gb|ADG46029.1|  putative progesterone 5-beta-reductase                  242   2e-74   Corchorus capsularis [jute]
ref|XP_006367946.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    242   3e-74   Solanum tuberosum [potatoes]
pdb|2V6F|A  Chain A, Structure Of Progesterone 5beta-Reductase Fr...    241   3e-74   Digitalis lanata [Grecian foxglove]
gb|AHC23071.1|  putative progesterone 5beta-reductase                   241   3e-74   Thymus x citriodorus
ref|XP_004248770.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    241   3e-74   Solanum lycopersicum
ref|XP_011092523.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    241   4e-74   Sesamum indicum [beniseed]
gb|ABB36654.1|  progesterone 5beta-reductase                            241   4e-74   Isoplexis sceptrum
gb|AHC23070.1|  putative progesterone 5beta-reductase                   240   5e-74   Thymus x citriodorus
gb|AAS93803.1|  progesterone 5-beta-reductase                           241   7e-74   Digitalis parviflora
gb|AHC23069.1|  putative progesterone 5beta-reductase                   240   7e-74   Thymus x citriodorus
gb|ABA77559.1|  progesterone 5-beta-reductase                           241   7e-74   Digitalis lutea [straw foxglove]
gb|ABB36652.1|  progesterone 5beta-reductase                            241   7e-74   Isoplexis chalcantha
gb|AIF73578.1|  progesterone 5-beta-reductase                           241   8e-74   Digitalis lanata [Grecian foxglove]
gb|AFZ41791.1|  putative progesterone 5-beta-reductase                  241   8e-74   Thymus vulgaris [garden thyme]
gb|AEW67079.1|  putative progesterone 5-beta-reductase                  241   9e-74   Digitalis trojana
gb|ABA77557.1|  progesterone 5-beta-reductase                           241   9e-74   Digitalis ciliata
gb|AEW67076.1|  putative progesterone 5-beta-reductase                  241   9e-74   Digitalis cariensis
gb|ADG56540.1|  progesterone 5-beta-reductase                           240   1e-73   Nerium oleander [rose-bay]
gb|AEW67077.1|  putative progesterone 5-beta-reductase                  240   1e-73   Digitalis lamarckii
gb|ABA77558.1|  progesterone 5-beta-reductase                           240   1e-73   Digitalis davisiana
gb|AAU95076.1|  progesterone 5 beta reductase                           240   1e-73   Digitalis subalpina
gb|ABB72433.1|  progesterone 5-beta-reductase                           240   1e-73   Digitalis nervosa
emb|CAD87012.1|  putative progesterone 5-beta-reductase                 240   1e-73   Digitalis obscura [willow-leaf foxglove]
gb|ABA77555.1|  progesterone 5-beta-reductase                           240   1e-73   Digitalis laevigata
gb|AAU88204.1|  progesterone 5-beta-reductase                           240   1e-73   Digitalis ferruginea [rusty foxglove]
gb|AAS93802.1|  progesterone 5-beta-reductase                           240   1e-73   Digitalis grandiflora
gb|ADG56546.1|  progesterone 5-beta-reductase                           240   1e-73   Gomphocarpus fruticosus
gb|ADG46028.1|  putative progesterone 5-beta-reductase                  239   4e-73   Calotropis procera
gb|ABD33275.2|  progesterone 5-beta-reductase, putative                 238   5e-73   Medicago truncatula
ref|XP_007136737.1|  hypothetical protein PHAVU_009G070100g             238   6e-73   Phaseolus vulgaris [French bean]
gb|AEW67078.1|  putative progesterone 5-beta-reductase                  238   6e-73   Digitalis ferruginea subsp. schischkinii
ref|XP_008356369.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    238   6e-73   
ref|XP_003525919.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    238   8e-73   Glycine max [soybeans]
gb|ABA77556.1|  progesterone 5-beta-reductase                           238   1e-72   Digitalis viridiflora
ref|XP_003589112.1|  hypothetical protein MTR_1g018610                  239   1e-72   
gb|ABA77554.1|  progesterone 5-beta-reductase                           237   2e-72   Digitalis cariensis
gb|ABB36651.1|  progesterone 5beta-reductase                            237   2e-72   Isoplexis canariensis
gb|EYU37596.1|  hypothetical protein MIMGU_mgv1a007982mg                237   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_003589109.1|  hypothetical protein MTR_1g018580                  236   3e-72   
gb|ABF51668.1|  progesterone 5-beta-reductase                           237   3e-72   Digitalis minor var. minor
gb|ABD33272.2|  hypothetical protein MtrDRAFT_AC158501g31v2             236   3e-72   Medicago truncatula
ref|XP_002272271.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    237   3e-72   Vitis vinifera
ref|XP_004499012.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    236   4e-72   Cicer arietinum [garbanzo]
gb|ADG56538.1|  progesterone 5-beta-reductase                           236   5e-72   Asclepias curassavica
gb|AAU88203.1|  progesterone 5-beta-reductase                           236   6e-72   Digitalis purpurea subsp. heywoodii
gb|ABB36653.1|  progesterone 5beta-reductase                            235   1e-71   Isoplexis isabelliana
gb|AIW09145.1|  progesterone 5-beta-reductase 3                         235   1e-71   Catharanthus roseus [chatas]
ref|XP_009593701.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    235   2e-71   Nicotiana tomentosiformis
ref|XP_011088173.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    234   2e-71   
ref|XP_011088183.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    234   3e-71   
ref|XP_011088182.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    234   3e-71   Sesamum indicum [beniseed]
gb|AAU88205.1|  progesterone 5-beta-reductase                           234   4e-71   Digitalis thapsi
emb|CAC80137.1|  progesterone 5-beta-reductase                          233   6e-71   Digitalis purpurea
ref|XP_010271744.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    233   1e-70   Nelumbo nucifera [Indian lotus]
gb|ABD33273.2|  VEP1 , putative                                         233   1e-70   Medicago truncatula
ref|XP_010111562.1|  hypothetical protein L484_011348                   232   1e-70   Morus notabilis
ref|XP_003589110.1|  hypothetical protein MTR_1g018590                  233   2e-70   
gb|AES59361.2|  3-oxo-delta(4,5)-steroid 5-beta-reductase-like pr...    232   2e-70   Medicago truncatula
ref|XP_009771310.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    232   2e-70   Nicotiana sylvestris
gb|AAS93805.1|  putative progesterone 5-beta-reductase                  231   3e-70   Digitalis purpurea
gb|AFW16645.1|  putative progesterone 5beta-reductase                   231   4e-70   Bupleurum falcatum
gb|AFZ41790.1|  putative progesterone 5-beta-reductase                  231   5e-70   Spinacia oleracea
ref|XP_003638459.1|  Progesterone 5-beta-reductase                      230   1e-69   
gb|ADG56539.1|  progesterone 5-beta-reductase                           230   1e-69   Hoya carnosa [honeyplant]
ref|XP_010277137.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    229   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006387422.1|  hypothetical protein POPTR_1058s00200g             229   3e-69   
gb|EYU37597.1|  hypothetical protein MIMGU_mgv11b006498mg               228   6e-69   Erythranthe guttata [common monkey flower]
ref|XP_002285152.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    228   7e-69   Vitis vinifera
ref|XP_006386483.1|  hypothetical protein POPTR_0002s12150g             228   9e-69   
ref|XP_006374842.1|  hypothetical protein POPTR_0014s01950g             228   9e-69   
gb|KDP44462.1|  hypothetical protein JCGZ_16295                         223   1e-68   Jatropha curcas
ref|XP_011069776.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   2e-68   Sesamum indicum [beniseed]
ref|XP_011016706.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    227   2e-68   Populus euphratica
ref|XP_006366601.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    226   2e-68   Solanum tuberosum [potatoes]
ref|XP_007018551.1|  NAD(P)-binding Rossmann-fold superfamily pro...    226   3e-68   
ref|XP_004152001.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    226   3e-68   Cucumis sativus [cucumbers]
gb|AIW09146.1|  progesterone 5-beta-reductase 4                         226   3e-68   Catharanthus roseus [chatas]
ref|XP_008236416.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(...    226   3e-68   
ref|XP_011017140.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    226   4e-68   Populus euphratica
ref|XP_010059860.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    226   4e-68   Eucalyptus grandis [rose gum]
ref|XP_008447374.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    224   2e-67   Cucumis melo [Oriental melon]
gb|KJB83174.1|  hypothetical protein B456_013G233500                    221   2e-67   Gossypium raimondii
ref|XP_004289734.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    224   2e-67   Fragaria vesca subsp. vesca
ref|XP_010673631.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    224   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007201077.1|  hypothetical protein PRUPE_ppa006872mg             223   5e-67   Prunus persica
ref|XP_002518657.1|  conserved hypothetical protein                     223   6e-67   Ricinus communis
gb|AJE29749.1|  putative progesterone 5-beta-reductase                  223   8e-67   Cucurbita pepo
ref|XP_003636813.1|  Progesterone 5-beta-reductase                      222   1e-66   
ref|XP_003598452.1|  Progesterone 5-beta-reductase                      222   1e-66   Medicago truncatula
ref|XP_004300685.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    222   1e-66   Fragaria vesca subsp. vesca
ref|XP_010099074.1|  hypothetical protein L484_011508                   222   1e-66   
gb|ABK95160.1|  unknown                                                 218   2e-66   Populus trichocarpa [western balsam poplar]
emb|CAN63254.1|  hypothetical protein VITISV_028488                     231   2e-66   Vitis vinifera
gb|KJB83175.1|  hypothetical protein B456_013G233500                    221   3e-66   Gossypium raimondii
ref|XP_007226426.1|  hypothetical protein PRUPE_ppa023813mg             221   3e-66   
gb|AFK42748.1|  unknown                                                 221   3e-66   Medicago truncatula
gb|AFK45113.1|  unknown                                                 221   3e-66   Medicago truncatula
ref|XP_009360316.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    221   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_009360311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    221   4e-66   Pyrus x bretschneideri [bai li]
gb|KJB58603.1|  hypothetical protein B456_009G217500                    221   4e-66   Gossypium raimondii
ref|XP_007223008.1|  hypothetical protein PRUPE_ppa006816mg             221   4e-66   
ref|XP_006420622.1|  hypothetical protein CICLE_v10006945mg             219   1e-65   
gb|KDP41649.1|  hypothetical protein JCGZ_16056                         219   1e-65   Jatropha curcas
ref|XP_002302422.2|  hypothetical protein POPTR_0002s12170g             219   2e-65   
ref|XP_007042587.1|  Progesterone 5-beta-reductase, putative isof...    219   2e-65   
gb|AHI88616.2|  progesterone 5-beta-reductase                           219   2e-65   Capsella bursa-pastoris
ref|XP_009360365.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    219   2e-65   Pyrus x bretschneideri [bai li]
gb|AAO63776.1|  unknown                                                 219   3e-65   Populus tremuloides
ref|XP_007042586.1|  Progesterone 5-beta-reductase, putative isof...    219   3e-65   
ref|XP_006374844.1|  hypothetical protein POPTR_0014s01970g             218   4e-65   
ref|XP_002510123.1|  conserved hypothetical protein                     218   5e-65   
gb|ABK95134.1|  unknown                                                 218   5e-65   Populus trichocarpa [western balsam poplar]
ref|XP_009137807.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    218   7e-65   Brassica rapa
gb|AFW16644.1|  putative progesterone 5beta-reductase                   218   7e-65   Passiflora incarnata
gb|AGN74846.1|  putative enone 5-beta-reductase                         218   8e-65   Brassica juncea var. juncea
ref|XP_008351978.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   9e-65   Malus domestica [apple tree]
ref|XP_011028990.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   9e-65   Populus euphratica
ref|XP_010521424.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   1e-64   
ref|XP_009360382.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_011017142.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   1e-64   Populus euphratica
ref|XP_011017141.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   1e-64   Populus euphratica
ref|XP_003636810.1|  Progesterone 5-beta-reductase                      226   1e-64   
ref|XP_011022580.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   1e-64   Populus euphratica
ref|XP_008393755.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   2e-64   
ref|XP_009137433.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   2e-64   Brassica rapa
emb|CDY10994.1|  BnaA03g46530D                                          216   2e-64   Brassica napus [oilseed rape]
ref|XP_008220361.1|  PREDICTED: uncharacterized protein LOC103320460    224   3e-64   Prunus mume [ume]
ref|XP_008393756.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   3e-64   
gb|KJB58604.1|  hypothetical protein B456_009G217600                    216   3e-64   Gossypium raimondii
ref|XP_011029002.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    216   3e-64   Populus euphratica
ref|XP_002304533.1|  hypothetical protein POPTR_0003s13440g             216   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_008337044.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    209   5e-64   
ref|XP_006847874.1|  hypothetical protein AMTR_s00029p00093020          215   5e-64   Amborella trichopoda
gb|ABK96780.1|  unknown                                                 215   5e-64   Populus trichocarpa x Populus deltoides
gb|AHZ44508.1|  putative progesterone 5 beta-reductase                  215   6e-64   Stellaria media
emb|CDX92623.1|  BnaC07g38810D                                          215   7e-64   
ref|XP_006489807.1|  PREDICTED: uncharacterized protein LOC102610524    223   7e-64   
gb|AFD96485.1|  putative enone 5-beta-reductase                         214   1e-63   Brassica oleracea var. gemmifera
ref|XP_008377976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    214   1e-63   
ref|XP_006387765.1|  hypothetical protein POPTR_0602s00210g             214   2e-63   
ref|XP_008360976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    214   2e-63   
gb|AEX31542.1|  putative steroid 5beta-reductase                        214   2e-63   Vitis vinifera
gb|ADG56544.1|  progesterone 5-beta-reductase                           213   3e-63   Erysimum crepidifolium
gb|ADG56542.1|  progesterone 5-beta-reductase                           213   3e-63   Erysimum capitatum var. purshii
ref|XP_009354120.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   3e-63   
ref|XP_006471792.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   3e-63   Citrus sinensis [apfelsine]
ref|XP_006471790.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   4e-63   Citrus sinensis [apfelsine]
ref|XP_006433107.1|  hypothetical protein CICLE_v10001388mg             213   4e-63   Citrus clementina [clementine]
ref|XP_006283899.1|  hypothetical protein CARUB_v10005016mg             213   5e-63   Capsella rubella
gb|AEZ01593.1|  progesterone 5-beta-reductase                           213   5e-63   Erysimum odoratum
ref|XP_009406008.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    213   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADG56545.1|  progesterone 5-beta-reductase                           213   6e-63   Erysimum rhaeticum
dbj|BAH57049.1|  AT4G24220                                              211   6e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AIA58905.1|  putative progesterone 5-beta-reductase                  212   8e-63   Malcolmia maritima
ref|XP_006374843.1|  hypothetical protein POPTR_0014s01960g             212   9e-63   
gb|ADG56543.1|  progesterone 5-beta-reductase                           212   9e-63   Erysimum x marshallii
ref|XP_002869731.1|  hypothetical protein ARALYDRAFT_914168             212   1e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_008372977.1|  PREDICTED: uncharacterized protein LOC103436331    217   1e-62   
gb|AGT29342.1|  putative progesterone 5-beta reductase                  211   2e-62   Barbarea vulgaris [upland cress]
gb|KJB29426.1|  hypothetical protein B456_005G100200                    211   2e-62   Gossypium raimondii
ref|XP_006387764.1|  hypothetical protein POPTR_0602s00200g             213   2e-62   
gb|AHI88614.1|  putative progesterone 5-beta-reductase                  211   2e-62   Hesperis matronalis
gb|KJB32255.1|  hypothetical protein B456_005G233200                    211   2e-62   Gossypium raimondii
gb|KDO53351.1|  hypothetical protein CISIN_1g045430mg                   209   2e-62   Citrus sinensis [apfelsine]
ref|XP_008220298.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    211   3e-62   Prunus mume [ume]
ref|NP_001078438.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase          211   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194153.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase             211   3e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ01594.1|  progesterone 5-beta-reductase                           211   3e-62   Erysimum cheiri [wallflower]
gb|KDO81569.1|  hypothetical protein CISIN_1g0159921mg                  210   3e-62   Citrus sinensis [apfelsine]
emb|CDY03474.1|  BnaC01g16080D                                          211   4e-62   
gb|AEX31541.1|  putative steroid 5beta-reductase                        210   5e-62   Armoracia rusticana [horseradish]
gb|AGM16376.1|  putative progesterone 5-beta-reductase                  210   5e-62   Cakile maritima [European sea-rocket]
ref|XP_007223026.1|  hypothetical protein PRUPE_ppa006894mg             210   5e-62   
ref|XP_010448593.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    210   6e-62   
gb|AFZ41789.1|  putative progesterone 5-beta-reductase                  210   6e-62   Raphanus sativus
gb|KDO81567.1|  hypothetical protein CISIN_1g0159921mg                  210   7e-62   Citrus sinensis [apfelsine]
ref|XP_003638458.1|  Progesterone 5-beta-reductase                      210   7e-62   
gb|AEO36948.1|  progesterone 5beta-reductase                            210   7e-62   Erysimum capitatum var. purshii
gb|KDO81568.1|  hypothetical protein CISIN_1g0159921mg                  210   7e-62   Citrus sinensis [apfelsine]
ref|XP_006433602.1|  hypothetical protein CICLE_v10001370mg             210   7e-62   Citrus clementina [clementine]
ref|XP_010530504.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    209   8e-62   Tarenaya hassleriana [spider flower]
ref|XP_006471787.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    210   8e-62   Citrus sinensis [apfelsine]
gb|KHG08322.1|  Uncharacterized protein F383_14595                      210   8e-62   Gossypium arboreum [tree cotton]
ref|XP_006433101.1|  hypothetical protein CICLE_v10001374mg             210   8e-62   Citrus clementina [clementine]
gb|AFN22088.1|  putative progesterone 5-beta-reductase                  209   1e-61   Draba aizoides
gb|ABK96579.1|  unknown                                                 209   1e-61   Populus trichocarpa x Populus deltoides
gb|AEO36945.1|  progesterone 5beta-reductase                            209   2e-61   Erysimum albescens
gb|AEO36946.1|  progesterone 5beta-reductase                            209   2e-61   Erysimum scoparium
ref|XP_006472269.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    209   2e-61   Citrus sinensis [apfelsine]
gb|AEO36947.1|  progesterone 5beta-reductase                            209   2e-61   Erysimum caboverdeanum
gb|AGT29341.1|  putative progesterone 5-beta reductase                  208   3e-61   Cardamine pratensis [cuckoo flower]
gb|AHZ44507.1|  putative progesterone 5 beta-reductase                  208   3e-61   Isatis tinctoria [woad]
ref|XP_004299763.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    208   3e-61   Fragaria vesca subsp. vesca
gb|AHZ44505.1|  putative progesterone 5 beta-reductase                  208   4e-61   Draba verna
ref|XP_006433601.1|  hypothetical protein CICLE_v10001445mg             208   4e-61   Citrus clementina [clementine]
gb|KDO53786.1|  hypothetical protein CISIN_1g030297mg                   201   5e-61   Citrus sinensis [apfelsine]
gb|AFZ42258.1|  putative progesterone 5-beta-reductase                  207   8e-61   Nasturtium officinale [watercress]
ref|XP_006413460.1|  hypothetical protein EUTSA_v10025425mg             207   9e-61   Eutrema salsugineum [saltwater cress]
ref|XP_006284965.1|  hypothetical protein CARUB_v10006268mg             207   1e-60   Capsella rubella
ref|XP_004501803.1|  PREDICTED: uncharacterized protein LOC101510608    214   2e-60   
ref|XP_006472267.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    206   2e-60   Citrus sinensis [apfelsine]
ref|XP_010099073.1|  hypothetical protein L484_011507                   204   2e-60   
ref|XP_009109253.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    206   2e-60   Brassica rapa
ref|XP_006472268.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    206   2e-60   Citrus sinensis [apfelsine]
ref|XP_007223050.1|  hypothetical protein PRUPE_ppa006944mg             206   2e-60   
ref|XP_007222999.1|  hypothetical protein PRUPE_ppa006780mg             206   2e-60   
gb|AEY82380.1|  putative progesterone 5-beta-reductase                  206   3e-60   Lunaria annua [honesty]
emb|CDY08911.1|  BnaC08g11410D                                          206   3e-60   Brassica napus [oilseed rape]
ref|XP_009394340.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    206   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHZ44509.1|  putative progesterone 5 beta-reductase                  205   4e-60   Thlaspi arvense
gb|AHI88613.1|  putative steroid 5-beta-reductase                       205   4e-60   Sinapis arvensis [charlock mustard]
gb|AGN74845.1|  putative enone 5-beta-reductase                         205   5e-60   Lepidium sativum
ref|XP_011042197.1|  PREDICTED: uncharacterized protein LOC105137942    212   5e-60   Populus euphratica
gb|AFZ42259.1|  putative progesterone 5-beta-reductase                  205   6e-60   Aethionema grandiflorum
ref|XP_006433105.1|  hypothetical protein CICLE_v10001393mg             204   9e-60   Citrus clementina [clementine]
gb|AGL96526.1|  putative progesterone 5-beta-reductase                  204   2e-59   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010905261.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    202   5e-59   Elaeis guineensis
ref|XP_009396895.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    202   7e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790634.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    202   8e-59   Phoenix dactylifera
ref|XP_008790041.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    202   1e-58   Phoenix dactylifera
ref|XP_006471285.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    201   1e-58   Citrus sinensis [apfelsine]
ref|XP_006432523.1|  hypothetical protein CICLE_v10001412mg             201   2e-58   Citrus clementina [clementine]
gb|EMS53363.1|  hypothetical protein TRIUR3_02025                       196   2e-58   Triticum urartu
gb|AHZ44506.1|  putative progesterone 5 beta-reductase                  201   3e-58   Iberis amara [bitter candytuft]
ref|XP_009394339.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    200   6e-58   
ref|XP_002465092.1|  hypothetical protein SORBIDRAFT_01g031950          199   9e-58   Sorghum bicolor [broomcorn]
ref|NP_001140307.1|  uncharacterized protein LOC100272352               195   1e-57   
ref|XP_010939097.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    199   3e-57   
emb|CDM86919.1|  unnamed protein product                                197   4e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010556421.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    197   7e-57   Tarenaya hassleriana [spider flower]
tpg|DAA45880.1|  TPA: hypothetical protein ZEAMMB73_620077              197   7e-57   
ref|XP_010556422.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    196   8e-57   Tarenaya hassleriana [spider flower]
gb|KDO53787.1|  hypothetical protein CISIN_1g024207mg                   193   9e-57   Citrus sinensis [apfelsine]
ref|XP_003562377.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    196   1e-56   Brachypodium distachyon [annual false brome]
ref|XP_006450012.1|  hypothetical protein CICLE_v10013989mg             196   2e-56   Citrus clementina [clementine]
emb|CBI22490.3|  unnamed protein product                                194   2e-56   Vitis vinifera
ref|XP_006432519.1|  hypothetical protein CICLE_v10001420mg             195   3e-56   Citrus clementina [clementine]
ref|XP_006471279.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    195   3e-56   Citrus sinensis [apfelsine]
gb|AFZ41796.1|  putative progesterone 5-beta-reductase                  195   3e-56   Sisymbrium officinale
emb|CDM86889.1|  unnamed protein product                                195   4e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009762620.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    195   4e-56   Nicotiana sylvestris
ref|XP_006665039.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    194   5e-56   
dbj|BAK04809.1|  predicted protein                                      194   7e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006432505.1|  hypothetical protein CICLE_v10001414mg             194   7e-56   Citrus clementina [clementine]
ref|XP_006471280.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    194   7e-56   Citrus sinensis [apfelsine]
ref|XP_004983958.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    193   2e-55   Setaria italica
dbj|BAJ93442.1|  predicted protein                                      193   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006432526.1|  hypothetical protein CICLE_v10001422mg             193   2e-55   
gb|EMT09140.1|  hypothetical protein F775_25898                         191   3e-55   
ref|XP_006495229.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    193   3e-55   Citrus sinensis [apfelsine]
gb|EMS51064.1|  hypothetical protein TRIUR3_03279                       191   3e-55   Triticum urartu
ref|XP_006432524.1|  hypothetical protein CICLE_v10001422mg             192   3e-55   Citrus clementina [clementine]
gb|AHZ44504.1|  putative progesterone 5 beta-reductase                  192   4e-55   Cochlearia officinalis [scurvy-grass]
gb|EMT17902.1|  hypothetical protein F775_30194                         191   5e-55   
gb|EAY90583.1|  hypothetical protein OsI_12184                          191   9e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001050440.1|  Os03g0436400                                       191   9e-55   
gb|ABR16709.1|  unknown                                                 191   1e-54   
ref|XP_010687527.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    188   1e-53   
gb|ABK24243.1|  unknown                                                 188   2e-53   
gb|AIW09147.1|  progesterone 5-beta-reductase 5                         187   4e-53   
sp|K7WDL7.1|IRIS_CATRO  RecName: Full=Iridoid synthase                  187   4e-53   
gb|AHA82033.1|  iridoid synthase                                        187   4e-53   
ref|XP_002991994.1|  hypothetical protein SELMODRAFT_186462             186   6e-53   
ref|XP_002989828.1|  hypothetical protein SELMODRAFT_160458             186   7e-53   
ref|XP_002991995.1|  hypothetical protein SELMODRAFT_448625             185   1e-52   
ref|XP_006339461.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    186   1e-52   
ref|XP_002989827.1|  hypothetical protein SELMODRAFT_235888             184   2e-52   
gb|ABR16676.1|  unknown                                                 185   2e-52   
ref|NP_001167740.1|  hypothetical protein                               184   4e-52   
gb|ABK24388.1|  unknown                                                 184   6e-52   
ref|XP_004229838.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    183   1e-51   
gb|ACZ66261.1|  progesterone 5beta-reductase 2                          182   2e-51   
ref|XP_002449263.1|  hypothetical protein SORBIDRAFT_05g006930          182   3e-51   
emb|CDP01226.1|  unnamed protein product                                181   7e-51   
ref|XP_008657260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    180   2e-50   
emb|CDP01225.1|  unnamed protein product                                179   3e-50   
ref|XP_002991996.1|  hypothetical protein SELMODRAFT_448626             179   3e-50   
gb|EMT05549.1|  hypothetical protein F775_09108                         172   1e-49   
gb|ACJ85489.1|  unknown                                                 172   3e-49   
ref|XP_007201878.1|  hypothetical protein PRUPE_ppa009693mg             173   7e-49   
gb|AGO01041.1|  putative progesterone 5-beta-reductase                  175   1e-48   
gb|ADL28122.1|  putative progesterone 5-beta-reductase 2                174   5e-48   
ref|XP_010905260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    173   8e-48   
ref|XP_010905259.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    173   1e-47   
ref|XP_011069777.1|  PREDICTED: iridoid synthase-like                   171   2e-47   
ref|XP_010520747.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    171   5e-47   
gb|EEC82398.1|  hypothetical protein OsI_26764                          168   6e-47   
gb|EEE67538.1|  hypothetical protein OsJ_25016                          167   6e-46   
ref|NP_001060201.2|  Os07g0601600                                       167   1e-45   
gb|ACE96889.1|  putative protein                                        164   2e-45   
gb|ACE96904.1|  putative protein                                        164   2e-45   
gb|EMS53364.1|  hypothetical protein TRIUR3_02028                       164   3e-45   
gb|ACE96903.1|  putative protein                                        162   6e-45   
gb|ACE96881.1|  putative protein                                        162   9e-45   
ref|XP_004983960.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    163   3e-44   
ref|XP_004983959.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    163   5e-44   
ref|XP_001754205.1|  predicted protein                                  161   2e-43   
ref|XP_002981288.1|  hypothetical protein SELMODRAFT_444825             159   2e-42   
ref|XP_002969677.1|  hypothetical protein SELMODRAFT_92604              158   3e-42   
ref|XP_006651421.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    157   3e-42   
emb|CAA68126.1|  unnamed protein product                                157   7e-42   
ref|XP_008367783.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    157   8e-42   
gb|KDO36187.1|  hypothetical protein CISIN_1g037566mg                   156   1e-41   
ref|XP_006443047.1|  hypothetical protein CICLE_v10023804mg             156   2e-41   
ref|XP_006478688.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    155   3e-41   
ref|XP_002960184.1|  hypothetical protein SELMODRAFT_74145              155   4e-41   
ref|XP_002967521.1|  hypothetical protein SELMODRAFT_86439              155   5e-41   
gb|AHI88615.1|  putative progesterone 5-beta-reductase                  155   7e-41   
ref|XP_002960183.1|  hypothetical protein SELMODRAFT_402259             154   8e-41   
ref|XP_011037089.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    153   2e-40   
ref|XP_006443046.1|  hypothetical protein CICLE_v10020613mg             153   2e-40   
ref|XP_006443045.1|  hypothetical protein CICLE_v10020568mg             153   3e-40   
gb|AGI15851.1|  collinsiaXVII-like protein                              149   3e-40   
gb|AGI15854.1|  collinsiaXVII-like protein                              149   4e-40   
gb|AGI15847.1|  collinsiaXVII-like protein                              149   4e-40   
gb|AGI15837.1|  collinsiaXVII-like protein                              149   4e-40   
gb|AGI15840.1|  collinsiaXVII-like protein                              148   4e-40   
gb|KDO47323.1|  hypothetical protein CISIN_1g0426562mg                  149   4e-40   
gb|AGI15841.1|  collinsiaXVII-like protein                              148   5e-40   
gb|AGI15852.1|  collinsiaXVII-like protein                              147   9e-40   
gb|AGI15842.1|  collinsiaXVII-like protein                              147   1e-39   
gb|AGI15855.1|  collinsiaXVII-like protein                              147   1e-39   
ref|XP_011037153.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    151   1e-39   
gb|AGI15835.1|  collinsiaXVII-like protein                              147   1e-39   
ref|XP_006478687.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    150   2e-39   
ref|XP_004508264.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    150   4e-39   
gb|AGI15844.1|  collinsiaXVII-like protein                              145   4e-39   
gb|ABK96577.1|  unknown                                                 149   6e-39   
ref|XP_006372880.1|  hypothetical protein POPTR_0017s05930g             149   9e-39   
ref|XP_006372881.1|  hypothetical protein POPTR_0017s05940g             149   1e-38   
ref|XP_006432520.1|  hypothetical protein CICLE_v10003925mg             147   8e-38   
gb|AGI15834.1|  collinsiaXVII-like protein                              142   1e-37   
ref|XP_002518654.1|  hypothetical protein RCOM_0810740                  139   2e-37   
gb|AGI15853.1|  collinsiaXVII-like protein                              140   5e-37   
ref|XP_002467669.1|  hypothetical protein SORBIDRAFT_01g031940          142   3e-36   
ref|XP_003529541.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    141   4e-36   
gb|KHN02917.1|  Hypothetical protein glysoja_009783                     141   6e-36   
ref|XP_006432518.1|  hypothetical protein CICLE_v10003867mg             140   7e-36   
ref|XP_007154349.1|  hypothetical protein PHAVU_003G111300g             140   1e-35   
ref|XP_007154348.1|  hypothetical protein PHAVU_003G111200g             139   3e-35   
ref|XP_007154725.1|  hypothetical protein PHAVU_003G142200g             138   8e-35   
ref|XP_007022522.1|  NAD(P)-binding Rossmann-fold superfamily pro...    138   1e-34   
ref|XP_010098784.1|  hypothetical protein L484_000585                   138   1e-34   
gb|AHA84141.1|  3-oxo-delta(4,5)-steroid 5-beta-reductase               137   1e-34   
gb|ABF96680.1|  progesterone 5-beta-reductase, putative                 136   1e-34   
ref|XP_006374846.1|  hypothetical protein POPTR_0014s01980g             136   3e-34   
ref|XP_006374845.1|  hypothetical protein POPTR_0014s01980g             136   3e-34   
gb|AIW09148.1|  progesterone 5-beta-reductase 6                         136   5e-34   
ref|XP_010259353.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    136   5e-34   
ref|XP_003607179.1|  hypothetical protein MTR_4g073090                  136   6e-34   
ref|XP_010649532.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    135   1e-33   
ref|XP_003609735.1|  hypothetical protein MTR_4g121570                  134   2e-33   
gb|EEC75505.1|  hypothetical protein OsI_12105                          132   2e-33   
ref|XP_003609737.1|  hypothetical protein MTR_4g121590                  131   3e-32   
ref|XP_010671660.1|  PREDICTED: iridoid synthase-like                   131   3e-32   
ref|WP_010795227.1|  hypothetical protein                               130   3e-32   
ref|XP_006432521.1|  hypothetical protein CICLE_v100016292mg            124   9e-32   
ref|WP_019366346.1|  NAD dependent epimerase/dehydratase                128   3e-31   
ref|WP_034798529.1|  NAD-dependent dehydratase                          128   3e-31   
ref|XP_002967522.1|  hypothetical protein SELMODRAFT_86462              128   3e-31   
ref|WP_023904087.1|  hypothetical protein                               128   3e-31   
ref|WP_018325470.1|  hypothetical protein                               128   4e-31   
ref|XP_006386996.1|  hypothetical protein POPTR_2318s00200g             121   1e-30   
ref|WP_025431188.1|  NAD-dependent dehydratase                          126   1e-30   
ref|WP_006449597.1|  NAD dependent epimerase/dehydratase                125   2e-30   
gb|KHN21407.1|  Hypothetical protein glysoja_042470                     124   3e-30   
ref|XP_002276159.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    125   6e-30   
ref|WP_025661354.1|  NAD-dependent dehydratase                          124   7e-30   
ref|XP_011037154.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    119   1e-29   
ref|WP_037204462.1|  NAD-dependent dehydratase                          124   1e-29   
ref|XP_010671934.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    124   1e-29   
ref|XP_002960090.1|  hypothetical protein SELMODRAFT_74346              124   1e-29   
ref|WP_035225966.1|  NAD-dependent dehydratase                          123   2e-29   
ref|WP_015875516.1|  NAD dependent epimerase/dehydratase                123   2e-29   
ref|WP_032885923.1|  NAD-dependent dehydratase                          123   2e-29   
ref|WP_042625158.1|  NAD-dependent dehydratase                          123   2e-29   
ref|WP_006239142.1|  NAD-dependent dehydratase                          122   3e-29   
ref|WP_039514425.1|  NAD-dependent dehydratase                          122   3e-29   
ref|WP_037496607.1|  NAD-dependent dehydratase                          122   3e-29   
ref|WP_032406024.1|  NAD-dependent dehydratase                          122   3e-29   
ref|WP_027495300.1|  NAD-dependent dehydratase                          122   3e-29   
ref|WP_039815830.1|  NAD-dependent dehydratase                          122   4e-29   
ref|XP_006855298.1|  hypothetical protein AMTR_s00057p00055480          119   4e-29   
ref|WP_032387564.1|  NAD-dependent dehydratase                          122   4e-29   
ref|WP_017277479.1|  hypothetical protein                               122   4e-29   
ref|WP_032374766.1|  NAD-dependent dehydratase                          122   6e-29   
ref|WP_032392463.1|  NAD-dependent dehydratase                          122   7e-29   
ref|WP_032367139.1|  NAD-dependent dehydratase                          122   7e-29   
ref|XP_002984047.1|  hypothetical protein SELMODRAFT_234421             122   7e-29   
ref|WP_032369532.1|  NAD-dependent dehydratase                          121   7e-29   
ref|WP_032400492.1|  NAD-dependent dehydratase                          121   8e-29   
ref|WP_012279416.1|  epimerase                                          121   8e-29   
ref|WP_016902584.1|  NAD dependent epimerase/dehydratase                121   8e-29   
ref|WP_017638618.1|  NAD dependent epimerase/dehydratase                121   8e-29   
ref|WP_037157291.1|  NAD-dependent dehydratase                          121   1e-28   
ref|WP_024933973.1|  epimerase                                          121   1e-28   
ref|WP_039521715.1|  NAD-dependent dehydratase                          121   1e-28   
ref|WP_039527127.1|  NAD-dependent dehydratase                          121   1e-28   
ref|WP_032383332.1|  NAD-dependent dehydratase                          120   1e-28   
ref|WP_032390275.1|  NAD-dependent dehydratase                          120   2e-28   
ref|WP_028623205.1|  NAD-dependent dehydratase                          120   2e-28   
ref|WP_008348061.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    120   2e-28   
ref|WP_029625448.1|  epimerase                                          120   2e-28   
ref|WP_032377495.1|  NAD-dependent dehydratase                          120   2e-28   
ref|WP_042573032.1|  NAD-dependent dehydratase                          120   2e-28   
ref|WP_008710903.1|  hypothetical protein                               120   2e-28   
ref|WP_031425945.1|  NAD-dependent dehydratase                          120   2e-28   
ref|WP_024938681.1|  NAD-dependent dehydratase                          120   2e-28   
ref|WP_017909301.1|  NAD dependent epimerase/dehydratase                120   2e-28   
ref|WP_017914865.1|  NAD dependent epimerase/dehydratase                120   2e-28   
ref|WP_010342645.1|  NAD dependent epimerase/dehydratase                120   3e-28   
gb|EWC62342.1|  Nucleoside-diphosphate-sugar epimerase                  120   3e-28   
ref|WP_035281545.1|  NAD-dependent dehydratase                          120   3e-28   
ref|WP_037011105.1|  NAD-dependent dehydratase                          119   4e-28   
ref|WP_017912517.1|  NAD dependent epimerase/dehydratase                119   4e-28   
ref|WP_035962590.1|  NAD-dependent dehydratase                          119   4e-28   
ref|WP_035687562.1|  NAD-dependent dehydratase                          119   4e-28   
ref|WP_007160663.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    119   4e-28   
ref|WP_032405204.1|  NAD-dependent dehydratase                          119   5e-28   
ref|WP_042137883.1|  NAD-dependent dehydratase                          119   5e-28   
ref|WP_037196072.1|  NAD-dependent dehydratase                          119   6e-28   
ref|WP_019484159.1|  MULTISPECIES: hypothetical protein                 119   6e-28   
ref|WP_037171041.1|  NAD-dependent dehydratase                          119   6e-28   
ref|WP_033780187.1|  NAD-dependent dehydratase                          119   7e-28   
ref|WP_015885059.1|  NAD dependent epimerase/dehydratase                119   7e-28   
ref|WP_033768488.1|  NAD-dependent dehydratase                          119   7e-28   
ref|WP_032384829.1|  NAD-dependent dehydratase                          119   7e-28   
ref|WP_031374413.1|  NAD-dependent dehydratase                          119   8e-28   
ref|WP_027133570.1|  NAD-dependent dehydratase                          119   8e-28   
ref|WP_032396718.1|  NAD-dependent dehydratase                          118   9e-28   
ref|WP_043095840.1|  NAD-dependent dehydratase                          118   1e-27   
gb|AAW75557.1|  Nucleoside-diphosphate-sugar epimerases                 117   1e-27   
ref|WP_024745109.1|  NAD-dependent dehydratase                          118   1e-27   
ref|WP_027601512.1|  MULTISPECIES: NAD-dependent dehydratase            118   1e-27   
ref|WP_032383748.1|  NAD-dependent dehydratase                          118   1e-27   
dbj|BAE68935.1|  conserved hypothetical protein                         117   2e-27   
ref|WP_039762885.1|  NAD-dependent dehydratase                          117   2e-27   
emb|CAQ43088.1|  hypothetical protein                                   117   2e-27   
ref|WP_026843956.1|  NAD-dependent dehydratase                          117   2e-27   
ref|WP_013511465.1|  NAD dependent epimerase/dehydratase                117   3e-27   
dbj|BAP45173.1|  aldo-keto reductase family protein                     117   3e-27   
ref|WP_022624759.1|  NAD dependent epimerase/dehydratase                117   3e-27   
ref|WP_034911597.1|  NAD-dependent dehydratase                          117   3e-27   
ref|WP_019300231.1|  NAD dependent epimerase/dehydratase                117   3e-27   
ref|WP_033773890.1|  NAD-dependent dehydratase                          117   3e-27   
ref|WP_042599156.1|  NAD-dependent dehydratase                          117   3e-27   
ref|WP_041616676.1|  NAD-dependent dehydratase                          117   3e-27   
ref|XP_006848213.1|  hypothetical protein AMTR_s00029p00242940          117   4e-27   
ref|WP_027801748.1|  NAD-dependent dehydratase                          117   4e-27   
ref|WP_043347926.1|  NAD-dependent dehydratase                          115   4e-27   
ref|WP_019303656.1|  NAD dependent epimerase/dehydratase                117   4e-27   
gb|ADB36423.1|  NAD-dependent epimerase/dehydratase                     117   4e-27   
ref|WP_017919948.1|  NAD dependent epimerase/dehydratase                117   4e-27   
ref|WP_036055780.1|  MULTISPECIES: NAD-dependent dehydratase            117   4e-27   
ref|WP_006368581.1|  NAD-dependent dehydratase                          117   4e-27   
ref|WP_010253428.1|  NAD dependent epimerase/dehydratase                117   4e-27   
ref|WP_012438234.1|  NAD dependent epimerase/dehydratase                117   4e-27   
ref|WP_037190969.1|  NAD-dependent dehydratase                          116   4e-27   
ref|WP_004160360.1|  NAD dependent epimerase/dehydratase                116   5e-27   
ref|WP_035930836.1|  NAD-dependent dehydratase                          116   5e-27   
ref|WP_039661398.1|  NAD-dependent dehydratase                          116   5e-27   
ref|WP_016774737.1|  NAD dependent epimerase/dehydratase                116   6e-27   
ref|WP_010670307.1|  NAD dependent epimerase/dehydratase                116   6e-27   
ref|WP_027504021.1|  NAD-dependent dehydratase                          116   6e-27   
ref|WP_042559116.1|  NAD-dependent dehydratase                          116   6e-27   
ref|WP_039434936.1|  NAD-dependent dehydratase                          116   7e-27   
ref|WP_008714610.1|  putative NDP-sugar phosphate epimerase             116   7e-27   
ref|WP_041480359.1|  NAD-dependent dehydratase                          116   7e-27   
ref|WP_007111782.1|  NAD dependent epimerase/dehydratase                116   7e-27   
ref|WP_024691865.1|  NAD-dependent dehydratase                          116   7e-27   
ref|WP_024550907.1|  MULTISPECIES: NAD-dependent dehydratase            116   7e-27   
ref|WP_016568052.1|  Progesterone 5-beta-reductase-like protein         116   8e-27   
ref|WP_003851482.1|  Nucleoside-diphosphate-sugar epimerase             116   8e-27   
ref|WP_008924711.1|  NAD dependent epimerase/dehydratase                116   8e-27   
ref|WP_004417900.1|  Progesterone 5-beta-reductase-like protein (...    116   8e-27   
ref|WP_042326343.1|  NAD-dependent dehydratase                          116   8e-27   



>ref|XP_009771311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=388

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+KAAWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E +    L  MMK+KGPVWDEIV+ENGL   KLEDVG WW
Sbjct  283  WKHFWKVLAEQFGVEAAEFDEVNRC-TLAEMMKDKGPVWDEIVKENGLTPAKLEDVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + + PLD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  342  FVDLILAGDCPLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  388



>ref|XP_009599751.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
 dbj|BAH47640.1| progesterone 5beta reductase-A [Nicotiana tabacum]
Length=389

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+KAAWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E +    +E MMK+KGPVWDEIV+ENGL  TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGVEAAEFDEENRCTLVE-MMKDKGPVWDEIVKENGLTPTKLEDVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + +  LD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  343  FVDLMLAGDCRLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  389



>gb|ADG41743.1| putative progesterone 5 beta-reductase [Nicotiana tabacum]
Length=388

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+KAAWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E +    L  MMK+KGPVWDEIV+ENGL   KLEDVG WW
Sbjct  283  WKHFWKVLAEQFGVEAAEFDEVNRC-TLAEMMKDKGPVWDEIVKENGLTLAKLEDVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + + PLD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  342  FVDLILAGDCPLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  388



>dbj|BAH47641.1| progesterone 5beta reductase-B [Nicotiana tabacum]
Length=388

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+KAAWDGY++CSDADLIAE +IWAAVDP AKNEAFNV NGDVFK
Sbjct  223  YAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVRNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E +    L  MMK+KGPVWDEIV+ENGL   KLEDVG WW
Sbjct  283  WKHFWKVLAEQFGVEAAEFDEVNRC-TLAEMMKDKGPVWDEIVKENGLTPAKLEDVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + + PLD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  342  FVDLILAGDCPLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  388



>gb|AEX31544.1| putative steroid 5beta-reductase [Solanum tuberosum]
Length=387

 Score =   258 bits (660),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  222  YAAICKHEGLPLKFPGVKGAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E      +E MMK+KG VWDEIV+ENGL+ TKLE+VG WW
Sbjct  282  WKHFWKVLAEQFGVEAAEFDEGKRCTLVE-MMKDKGAVWDEIVKENGLVPTKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+ S + PLD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  341  FADLMLSGDCPLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  387



>ref|XP_006353962.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGLPLKFPGVKGAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E      +E MMK+KG VWDEIV+ENGL+ TKLE+VG WW
Sbjct  283  WKHFWKVLAEQFGVEAAEFDEGKRCTLVE-MMKDKGAVWDEIVKENGLVPTKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+ S + PLD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  342  FADLMLSGDCPLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  388



>gb|AFZ41795.1| putative progesterone 5-beta-reductase [Duboisia hopwoodii]
Length=388

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+KAAWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGLPLKFPGVKAAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F   V EF+E      L  MMK+KG VWDEIV+ENGL  TKLEDVG WW
Sbjct  283  WKHFWKVLAEQFGREVAEFDEEKRC-TLAEMMKDKGSVWDEIVKENGLTPTKLEDVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + + PLD MNKSKEHGFLGFRNS KAFISWIDK+KA K+VP
Sbjct  342  FVDLILAGDCPLDTMNKSKEHGFLGFRNSPKAFISWIDKVKACKVVP  388



>ref|NP_001266103.1| putative steroid 5beta-reductase [Solanum lycopersicum]
 gb|AEX31545.1| putative steroid 5beta-reductase [Solanum lycopersicum]
Length=387

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G+K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  222  YAAICKHEGLPLKFPGVKGAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVL ++F +   EF+E      +E MMK+KG VWDEIV+ENGL+ TKLE+VG WW
Sbjct  282  WKHFWKVLGEQFGLEAAEFDEGKRCTLVE-MMKDKGAVWDEIVKENGLVPTKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ S +  LD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  341  FVDLILSGDCALDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  387



>gb|ADG46023.1| progesterone 5-beta-reductase [Atropa belladonna]
Length=387

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G+KAAW+GY++ SDADLIAE +IWAAVDP AKNE FNVSNGDVFK
Sbjct  222  YAAICKHEGLPLRFPGVKAAWNGYSDSSDADLIAEHQIWAAVDPYAKNEEFNVSNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   EF+E  +   L  MMK+KG VWDEIV+ENGL STKLE+VG WW
Sbjct  282  WKHFWKVLAEQFGVEATEFDE-GKRCTLGEMMKDKGAVWDEIVKENGLESTKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+   + PLD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  341  FVDLILGGDCPLDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  387



>gb|ADK13080.1| putative progesterone 5-beta-reductase [Nierembergia aristata]
Length=387

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  222  YAAICKHEGLPLRFPGAKGAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +   EF+E      L  MMK+KGP+WDEIV+E+GL++TKLE+VG WW
Sbjct  282  WKHFWKVLAEQFGMEAAEFDEEKRW-TLAEMMKDKGPIWDEIVKESGLVATKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ S + PLD MNKSKEHGFLGFRNS+KAF SWIDK+KA K+VP
Sbjct  341  FVDLILSGDCPLDTMNKSKEHGFLGFRNSQKAFASWIDKVKACKVVP  387



>gb|AIW09143.1| progesterone 5-beta-reductase 1 [Catharanthus roseus]
Length=387

 Score =   251 bits (641),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G K AW+GY+ CSDADLIAEQ+IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGLPLKFPGCKEAWEGYSMCSDADLIAEQQIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +   E+E   +  +LE MMK+K  VW+EIVRENGLL TKLE+VG +W
Sbjct  283  WKHFWKVLAEQFGLECAEYE--GDKVSLEEMMKDKEAVWEEIVRENGLLPTKLEEVGGFW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +F VE PLD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  341  FVDFIFGVEYPLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  387



>gb|AIW09144.1| progesterone 5-beta-reductase 2 [Catharanthus roseus]
Length=389

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW GY+ CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  225  YAAICKHEGVPLRFPGCKEAWQGYSMCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F     E++   E  +L+ +MK+KGPVW+ IVRENGL+ +KLE+VG WW
Sbjct  285  WKHFWKVLAEQFGAEYAEYQ--GERLSLQELMKDKGPVWENIVRENGLVPSKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+ SVE PLD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKI P
Sbjct  343  FADLVLSVECPLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIFP  389



>gb|EPS65468.1| progesterone 5-beta-reductase [Genlisea aurea]
Length=390

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            Y AICKHEG+PLRF G+KAAW+GY++CSD+DLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YTAICKHEGVPLRFPGVKAAWEGYSDCSDSDLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLAD+F V    F E  E   L  +MK+KGPVWDEIVRENGLL  +L+DVG WW
Sbjct  284  WKHLWKVLADQFGVENGGFVEEGERATLADLMKDKGPVWDEIVRENGLLPCELKDVGLWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+   E+ LD+MNKSKEHGFLGFRNS+ +F SWIDK++AYKIVP
Sbjct  344  FVDLMLGGEALLDSMNKSKEHGFLGFRNSKNSFASWIDKVRAYKIVP  390



>gb|ADG46022.1| progesterone 5-beta-reductase [Mentha x piperita]
Length=389

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEA NVSNGDVFK
Sbjct  224  YAAICKHEGAVLRFPGCKGAWDGYYDCSDADLIAEHQIWAAVDPYAKNEALNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE +E   L+ +MK+KGPVWDEIVRENGL  TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGNEVK-LQDLMKDKGPVWDEIVRENGLSPTKLEDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D     E PLD MNKSKEHGFLGFRNS+ +FISWIDK+KAYKIVP
Sbjct  343  FADFSLGYECPLDTMNKSKEHGFLGFRNSKNSFISWIDKVKAYKIVP  389



>gb|AFW97632.1| putative progesterone 5-beta-reductase [Rosmarinus officinalis]
Length=389

 Score =   248 bits (634),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGAVLRFPGCKDAWDGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +   E+EE  E   L+ +MKEKGPVWDEIVRENGL  TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGLECGEYEEGKEV-KLQELMKEKGPVWDEIVRENGLSCTKLEDVGKWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+      LD MNKSKEHGFLGFRNS+ +FISWIDK+KAYKIVP
Sbjct  343  FSDLILEHAGMLDTMNKSKEHGFLGFRNSKNSFISWIDKLKAYKIVP  389



>ref|XP_011088171.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Sesamum 
indicum]
Length=389

 Score =   246 bits (628),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G KAAWDGY++CSDADL AE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGEVLRFPGCKAAWDGYSDCSDADLTAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK+F KVLA++F V    +EE  ++  LE +MK+KG VWDEIVRENGL  TKLEDVG WW
Sbjct  284  WKNFWKVLAEQFGVECGGYEE-GQTLTLEELMKDKGAVWDEIVRENGLTPTKLEDVGLWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E PLD MNKSKEHGFLGFRNS+ +FISWIDK+KAYKIVP
Sbjct  343  FGDIILGNECPLDTMNKSKEHGFLGFRNSKNSFISWIDKVKAYKIVP  389



>gb|AEY82379.1| putative progesterone 5-beta-reductase [Withania somnifera]
Length=388

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG+PL+F G+K AWDGY++ SDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  222  YAAICKQEGLPLKFPGVKGAWDGYSDGSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F V   EF+E      L  MMK+K  VW+EIV+ENGL+ TKLE+VG WW
Sbjct  282  WKHLWKVLAEQFGVEAAEFDEGERRCTLAEMMKDKDAVWEEIVKENGLIPTKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + +  LD MNKSKEHGFLGFRNS+KAFISWIDK+KAYK+VP
Sbjct  342  FVDLVLAGDCALDTMNKSKEHGFLGFRNSQKAFISWIDKVKAYKVVP  388



>gb|AGT29344.1| putative progesterone 5-beta reductase 1_2 [Thymus serpyllum]
Length=389

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGSVLRFPGCKVAWDGYYDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +   E+EE +E   L+ +MK+KGPVWDEIVRENGLL TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGMECGEYEEGNEV-KLQDLMKDKGPVWDEIVRENGLLPTKLEDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D      S LD MNKSKEHGFLGFRNS+ +FISWID++KA+KIVP
Sbjct  343  FSDFCLEYGSVLDTMNKSKEHGFLGFRNSKNSFISWIDRVKAFKIVP  389



>gb|AFZ42257.2| putative progesterone 5-beta-reductase [Thymus serpyllum]
Length=389

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGSVLRFPGCKVAWDGYYDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE +E   L+ +MK+KGPVWDEIVRENGL  TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGNEV-KLQDLMKDKGPVWDEIVRENGLSPTKLEDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL     S LD MNKSKEHGFLGFRNS+ +FISWID++KA+KIVP
Sbjct  343  FSDLCLGNGSALDTMNKSKEHGFLGFRNSKNSFISWIDRVKAFKIVP  389



>sp|Q6PQJ9.1|5BPOR_DIGLA RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR 
[Digitalis lanata]
 gb|AAS76634.1| progesterone 5-beta-reductase [Digitalis lanata]
 gb|AAS93804.1| progesterone 5-beta-reductase [Digitalis lanata]
Length=389

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F VG  E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVGCGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ADG46027.1| putative progesterone 5-beta-reductase [Coffea arabica]
 gb|ADG56541.1| progesterone 5-beta-reductase [Plantago major]
Length=389

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFPGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  E+  L+ +MK K PVW+EIVRENGL ST LEDV  WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEE-GENLKLQDLMKGKEPVWEEIVRENGLASTNLEDVAVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  +  PLD+MNKSKEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  343  FSDAVLDIPCPLDSMNKSKEHGFLGFRNSKNSFISWIDKAKAYKIVP  389



>gb|KHN45161.1| Hypothetical protein glysoja_031389 [Glycine soja]
Length=219

 Score =   238 bits (606),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G + AW+ Y+  SDADLIAEQ IWAAVDP A+NEAFN SNGDVF+
Sbjct  55   YAAICKHEGVPLRFPGTRGAWESYSCASDADLIAEQHIWAAVDPYARNEAFNCSNGDVFR  114

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E  +L  +MK+KGPVWDEIV EN LL TKL++V  WW
Sbjct  115  WKHLWKVLAEQFGIEEYGFEE--EGLSLSELMKDKGPVWDEIVSENQLLPTKLDEVADWW  172

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+FS E  LD+MNK+KEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  173  FVDLIFSGEGMLDSMNKAKEHGFLGFRNSKNSFISWIDKTKAYKIVP  219



>emb|CDO97253.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G + AWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGAPLKFPGCREAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F     E+E    S  L+ MMK+KGPVWDEIVRE GL+ TKLE+VG WW
Sbjct  283  WKHFWKVLAEQFGAECGEYEGGPLS--LKEMMKDKGPVWDEIVREKGLVPTKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++      LD MNKSKEHGFLGFRNS+ AFISWIDK+KAYKIVP
Sbjct  341  FADVVLQYPCLLDTMNKSKEHGFLGFRNSKNAFISWIDKVKAYKIVP  387



>gb|ABA77560.1| progesterone 5-beta-reductase [Digitalis sibirica]
Length=389

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LDNMNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDNMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ADG46029.1| putative progesterone 5-beta-reductase [Corchorus capsularis]
 gb|ADK11283.1| putative progesterone 5-beta-reductase [Corchorus olitorius]
Length=387

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G + AWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGAPLKFPGCREAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F     E+E    S  L+ MMK+KGPVWDEIVRE GL+ TKLE+VG WW
Sbjct  283  WKHFWKVLAEQFGAECGEYEGGPLS--LKEMMKDKGPVWDEIVREKGLVPTKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++      LD MNKSKEHGFLGFRNS+ AFISWIDK+KAYKIVP
Sbjct  341  FADVVLQYPCLLDAMNKSKEHGFLGFRNSKNAFISWIDKVKAYKIVP  387



>ref|XP_006367946.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKHEG+PLRF G K+AWDGY+ CSDADLIAE +IWA++DP+AKNEAFN+SNGDVFK
Sbjct  223  YATICKHEGLPLRFPGSKSAWDGYSYCSDADLIAEHQIWASMDPNAKNEAFNISNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F+V   EF+E S+   L  MMK+KG +WDEIV+ENGL+ +KLE++G WW
Sbjct  283  WKHLWKVLAEEFQVEAEEFDE-SKRWTLVEMMKDKGQIWDEIVKENGLVESKLEEIGRWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+   E PLD MNKSKEHGFLGFRNS+ AFISWI K+KA K VP
Sbjct  342  FVDLVLKKECPLDTMNKSKEHGFLGFRNSKNAFISWIYKIKACKFVP  388



>pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis 
Lanata
 pdb|2V6G|A Chain A, Structure Of Progesterone 5beta-reductase From Digitalis 
Lanata In Complex With Nadp
Length=364

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  199  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  258

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  259  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  317

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  318  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  364



>gb|AHC23071.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  189  YAAICKHEGSVLRFPGSKVAWDGYYDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  248

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE +E   L+ +MK+KG +WDEIVRENGL  TKLEDVG WW
Sbjct  249  WKHFWKVLAEQFGVECGEYEEGNEV-KLQDLMKDKGTIWDEIVRENGLPPTKLEDVGIWW  307

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D      S LD MNKSKEHGFLGFRNS+ +FISWID++KA+KIVP
Sbjct  308  FSDFCLGYGSALDTMNKSKEHGFLGFRNSKNSFISWIDRVKAFKIVP  354



>ref|XP_004248770.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
lycopersicum]
Length=385

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K  WDGY+ CSDADLIAEQ IWA+VDP+AKNEAFN+SNGDVF 
Sbjct  220  YAAICKHEGLPLRFPGSKCGWDGYSICSDADLIAEQHIWASVDPNAKNEAFNISNGDVFH  279

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVL  +FEV + EF+E ++   LE MMK+KG +WDEIV ENGL+ +KLE++G WW
Sbjct  280  WKHLWKVLGKEFEVEIEEFDE-NKRWRLEEMMKDKGKIWDEIVEENGLVESKLEEIGGWW  338

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + E PLD MNKSKEHGFLGFRNS+ AFISWI K+KA KIVP
Sbjct  339  FVDLVLNEECPLDTMNKSKEHGFLGFRNSKNAFISWIYKIKASKIVP  385



>ref|XP_011092523.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=389

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G KAAWDGY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFPGCKAAWDGYSDCSDADLIAEHQIWAAVDPFAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +   ++EE  ++  L+ +MK+KGPVWDEIV+E  L+ TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGLECGKYEE-GQTLTLQELMKDKGPVWDEIVKEKELMQTKLEDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD MNKSKEHGFLGFRNS+ +F+SWIDK+KAYKIVP
Sbjct  343  FGDVILGNECFLDTMNKSKEHGFLGFRNSKNSFVSWIDKVKAYKIVP  389



>gb|ABB36654.1| progesterone 5beta-reductase [Isoplexis sceptrum]
Length=389

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL+ TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVEYGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLIPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AHC23070.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  189  YAAICKHEGSVLRFPGSKLAWDGYYDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  248

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE +E   L+ +MK+KG +WDEIVRENGL  TKLEDVG WW
Sbjct  249  WKHFWKVLAEQFGVECGEYEEGNEV-KLQDLMKDKGTIWDEIVRENGLPPTKLEDVGIWW  307

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D      S LD MNKSKEHGFLGFRNS+ +FISWID++KA+KIVP
Sbjct  308  FSDFCLGYGSALDTMNKSKEHGFLGFRNSKNSFISWIDRVKAFKIVP  354



>gb|AAS93803.1| progesterone 5-beta-reductase [Digitalis parviflora]
Length=389

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AHC23069.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  189  YAAICKHEGSVLRFPGSKLAWDGYYDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  248

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE +E   L+ +MK+KG +WDEIVRENGL  TKLEDVG WW
Sbjct  249  WKHFWKVLAEQFGVECGEYEEGNEV-KLQDLMKDKGTIWDEIVRENGLPPTKLEDVGIWW  307

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D      S LD MNKSKEHGFLGFRNS+ +FISWID++KA+KIVP
Sbjct  308  FSDFCLGYGSVLDTMNKSKEHGFLGFRNSKNSFISWIDRVKAFKIVP  354



>gb|ABA77559.1| progesterone 5-beta-reductase [Digitalis lutea]
Length=389

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABB36652.1| progesterone 5beta-reductase [Isoplexis chalcantha]
Length=389

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AIF73578.1| progesterone 5-beta-reductase [Digitalis lanata]
Length=389

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AFZ41791.1| putative progesterone 5-beta-reductase [Thymus vulgaris]
Length=389

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY +CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGSVLRFPGSKVAWDGYYDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE +E   L+ +MK+KG +WDEIVRENGL  TKLEDVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGNEV-KLQDLMKDKGTIWDEIVRENGLPPTKLEDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D      S LD MNKSKEHGFLGFRNS+ +FISWID++KA+KIVP
Sbjct  343  FSDFCLGYGSALDTMNKSKEHGFLGFRNSKNSFISWIDRVKAFKIVP  389



>gb|AEW67079.1| putative progesterone 5-beta-reductase [Digitalis trojana]
Length=389

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABA77557.1| progesterone 5-beta-reductase [Digitalis ciliata]
Length=389

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AEW67076.1| putative progesterone 5-beta-reductase [Digitalis cariensis]
Length=389

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ADG56540.1| progesterone 5-beta-reductase [Nerium oleander]
Length=387

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW GY+ CSDADLIAE  IWAAVD  AKNEAFNVSNGDVF+
Sbjct  223  YAAICKHEGVPLRFPGCKEAWQGYSMCSDADLIAEHHIWAAVDSYAKNEAFNVSNGDVFR  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F     E+E   E  +L+ MMK+KG VW++IVRENGL+ TKLE+VG WW
Sbjct  283  WKHFWKVLAEQFGAEYAEYE--GEKLSLQEMMKDKGSVWEDIVRENGLVPTKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  341  FADIVLGFECQLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  387



>gb|AEW67077.1| putative progesterone 5-beta-reductase [Digitalis lamarckii]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABA77558.1| progesterone 5-beta-reductase [Digitalis davisiana]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AAU95076.1| progesterone 5 beta reductase [Digitalis subalpina]
 gb|ABF48559.1| putative progesterone 5 beta reductase [Digitalis minor]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABB72433.1| progesterone 5-beta-reductase [Digitalis nervosa]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>emb|CAD87012.1| putative progesterone 5-beta-reductase [Digitalis obscura]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  E   L+ +MK K PVW+EIVR NGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEE-GEDLKLQDLMKGKEPVWEEIVRGNGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABA77555.1| progesterone 5-beta-reductase [Digitalis laevigata]
 gb|AIF73579.1| progesterone 5-beta-reductase [Digitalis ferruginea subsp. ferruginea]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AAU88204.1| progesterone 5-beta-reductase [Digitalis ferruginea]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AAS93802.1| progesterone 5-beta-reductase [Digitalis grandiflora]
Length=389

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ADG56546.1| progesterone 5-beta-reductase [Gomphocarpus fruticosus]
Length=388

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKH+G+PL+F G K AW+GY+ CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHDGVPLKFPGCKEAWEGYSVCSDADLIAEHQIWAAVDPFAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F+V   E+E   E  +LE MMK+KG VWDEIV ENGL  TKLE+VG WW
Sbjct  284  WKHFWKVLAEQFDVECGEYE--GEKLSLEDMMKDKGGVWDEIVAENGLAPTKLEEVGLWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D+    E  L +MNKSKEHGFLGFRNS+ AFISWI+KMKAYKIVP
Sbjct  342  FGDICLGYECALMSMNKSKEHGFLGFRNSKNAFISWIEKMKAYKIVP  388



>gb|ADG46028.1| putative progesterone 5-beta-reductase [Calotropis procera]
Length=387

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G K AW+GY+ CSDADL+AE +IWAAVDP AKNEAFN+SNGDVFK
Sbjct  223  YAAICKHEGVPLKFPGCKEAWEGYSVCSDADLMAEHQIWAAVDPFAKNEAFNLSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F+V   E+E   E  +LE MMK+KG VW+EIV ENGL  TKLE+VG WW
Sbjct  283  WKHFWKVLAEQFDVECAEYE--GEKLSLEEMMKDKGGVWEEIVAENGLAPTKLEEVGLWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D+    E  L +MNKSKEHGF GFRNS+ AFISWIDKMKAYKIVP
Sbjct  341  FGDICLGYECALMSMNKSKEHGFFGFRNSKNAFISWIDKMKAYKIVP  387



>gb|ABD33275.2| progesterone 5-beta-reductase, putative [Medicago truncatula]
Length=387

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LI+EQ IW AVDP+AKNEAFN SNGDVF+
Sbjct  222  YAAICKHEGLPLRFPGSKGAWECYSTASDANLISEQHIWGAVDPNAKNEAFNCSNGDVFR  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  282  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +F VE  LD+MNKSKEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  341  FADFMFRVEGVLDSMNKSKEHGFLGFRNSKNSFISWIDKTKAYKIVP  387



>ref|XP_007136737.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
 gb|ESW08731.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
Length=389

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+GY+  SDADLIAEQ IWAAVDP+A+NEAFN SNGDVFK
Sbjct  224  YAAICKHEGVPLRFPGTKGAWEGYSFSSDADLIAEQHIWAAVDPNARNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE S     EV MK+KGPVWDEIV  N LL TKLE+VG WW
Sbjct  284  WKHLWKVLAEQFGIEEYGFEEGSHLKLSEV-MKDKGPVWDEIVSANQLLPTKLEEVGDWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++FS E  LD+MNK+KEHGFLGFRNS+ + ISWIDK K YKIVP
Sbjct  343  FVDIIFSAEGVLDSMNKAKEHGFLGFRNSKNSLISWIDKCKGYKIVP  389



>gb|AEW67078.1| putative progesterone 5-beta-reductase [Digitalis ferruginea 
subsp. schischkinii]
Length=389

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+M+KSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMDKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>ref|XP_008356369.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=391

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G + AW+GY + SDADLIAE +IWAAVDP AKNEAFN SNGDV K
Sbjct  224  YAAICKHEGKKLRFTGSRGAWNGYWDVSDADLIAEHQIWAAVDPYAKNEAFNCSNGDVVK  283

Query  519  WKHFCKVLADKFEVGVVEF-EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHW  343
            WKH  +VLA++FE+ + +  EE     +LE MMK+KGPVWDEIV+E GL+ TKLE+VG+W
Sbjct  284  WKHLFRVLAEQFELDIEDVGEEGGSEASLEEMMKDKGPVWDEIVKEKGLVPTKLEEVGNW  343

Query  342  WFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            WFVDL+F VE+ LD+MNKSKEHGF+GFRNS+ +F++WID+MK+Y++VP
Sbjct  344  WFVDLMFGVETSLDSMNKSKEHGFVGFRNSKTSFLTWIDRMKSYRLVP  391



>ref|XP_003525919.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Glycine 
max]
Length=388

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G + AW+ Y+  SDADLIAEQ IWAAVDP A+NEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLRFPGTRGAWESYSCASDADLIAEQHIWAAVDPYARNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E  +L  +MK+KGPVWDEIV EN LL TKL++V  WW
Sbjct  284  WKHLWKVLAEQFGIEEYGFEE--EGLSLSELMKDKGPVWDEIVSENQLLPTKLDEVADWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+FS E  LD+MNK+KEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  342  FVDLIFSGEGMLDSMNKAKEHGFLGFRNSKNSFISWIDKTKAYKIVP  388



>gb|ABA77556.1| progesterone 5-beta-reductase [Digitalis viridiflora]
Length=389

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDV K
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVLK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW++IVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEQIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>ref|XP_003589112.1| hypothetical protein MTR_1g018610 [Medicago truncatula]
 gb|AES59363.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=423

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LI+EQ IW AVDP+AKNEAFN SNGDVF+
Sbjct  258  YAAICKHEGLPLRFPGSKGAWECYSTASDANLISEQHIWGAVDPNAKNEAFNCSNGDVFR  317

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  318  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  376

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +F VE  LD+MNKSKEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  377  FADFMFRVEGVLDSMNKSKEHGFLGFRNSKNSFISWIDKTKAYKIVP  423



>gb|ABA77554.1| progesterone 5-beta-reductase [Digitalis cariensis]
Length=389

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVREN L  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENELTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABB36651.1| progesterone 5beta-reductase [Isoplexis canariensis]
Length=389

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            W+HF KVLA++F V   E+EE  +   L+ +MK K PVW+EIVRENGL  TKL+DVG WW
Sbjct  284  WEHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHG LGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGILGFRNSKNAFISWIDKAKAYKIVP  389



>gb|EYU37596.1| hypothetical protein MIMGU_mgv1a007982mg [Erythranthe guttata]
Length=389

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L+F G K AW+GY++CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGSVLKFPGSKIAWEGYSDCSDADLIAEHQIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V    +EE  +   +E MMK+KGPVWDEIV+ENGL  TKL DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGGYEEGQKLTLVE-MMKDKGPVWDEIVKENGLTETKLGDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD MNKSKEHGFLGFRNS+ + ISWIDK+KAYKIVP
Sbjct  343  FGDVILGSECYLDTMNKSKEHGFLGFRNSKNSLISWIDKVKAYKIVP  389



>ref|XP_003589109.1| hypothetical protein MTR_1g018580 [Medicago truncatula]
 gb|AES59360.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=364

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LI+EQ IW AVDP+AKNEAFN SNGDVF+
Sbjct  199  YAAICKHEGLPLRFPGSKGAWECYSTASDANLISEQHIWGAVDPNAKNEAFNCSNGDVFR  258

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  259  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  317

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +F VE  LD+MNKSKEHGFLGFRNS+  FISWIDK K YKIVP
Sbjct  318  FADFMFRVEGVLDSMNKSKEHGFLGFRNSKNVFISWIDKTKVYKIVP  364



>gb|ABF51668.1| progesterone 5-beta-reductase [Digitalis minor var. minor]
Length=389

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKALRFPGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K  VW+EIVRENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKETVWEEIVRENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABD33272.2| hypothetical protein MtrDRAFT_AC158501g31v2 [Medicago truncatula]
Length=366

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LI+EQ IW AVDP+AKNEAFN SNGDVF+
Sbjct  201  YAAICKHEGLPLRFPGSKGAWECYSTASDANLISEQHIWGAVDPNAKNEAFNCSNGDVFR  260

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  261  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  319

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +F VE  LD+MNKSKEHGFLGFRNS+  FISWIDK K YKIVP
Sbjct  320  FADFMFRVEGVLDSMNKSKEHGFLGFRNSKNVFISWIDKTKVYKIVP  366



>ref|XP_002272271.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=389

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKHEG+PLRF G +  W+GY + SDADLIAE  IWAAVDP AKNEAFN SNGDVFK
Sbjct  225  YATICKHEGLPLRFPGTQDTWNGYWDVSDADLIAEHHIWAAVDPFAKNEAFNCSNGDVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F  G+   E   +  +LE MMK+KGPVWDEIVRE GL+ TKLE+VG WW
Sbjct  285  WKHLWKVLAEQF--GLEFHEPEGQGLSLEKMMKDKGPVWDEIVREKGLVPTKLEEVGQWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++ S  S LD+MNKSKEHGFLGFRNS+ +F+SWIDKMKAYK VP
Sbjct  343  FADVVLSAGSSLDSMNKSKEHGFLGFRNSKSSFLSWIDKMKAYKFVP  389



>ref|XP_004499012.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cicer 
arietinum]
Length=389

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL+F G KAAW+GY+  SDA+LIAEQ IW AVDP AKN+AFN SNGDVFK
Sbjct  224  YAAICKHECVPLKFPGSKAAWEGYSTASDANLIAEQHIWGAVDPKAKNQAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLADKF +    FE+ S+   L  MMK+KG VW++IVR+NGLL  KLE+VG WW
Sbjct  284  WKHFWKVLADKFGIENYGFEDGSDF-KLSDMMKDKGGVWEDIVRDNGLLPNKLEEVGDWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +  VE  LD MNK+K+HGFLGFRNS+++FISWIDK KAYKIVP
Sbjct  343  FVDFMLRVEGVLDTMNKAKQHGFLGFRNSKESFISWIDKTKAYKIVP  389



>gb|ADG56538.1| progesterone 5-beta-reductase [Asclepias curassavica]
Length=387

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+ L+F G K AW+GY+ CSDADLIAE +IWAAVDP AKNEAFNVSNGDVFK
Sbjct  223  YAAICKHEGVSLKFPGCKEAWEGYSVCSDADLIAEHQIWAAVDPFAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F+V   E+E   E  +LE MMK+KG VWDEIV ENGL  TKLE+VG WW
Sbjct  283  WKHFWKVLAEQFDVECGEYE--GEKLSLEEMMKDKGGVWDEIVAENGLAPTKLEEVGLWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D+    E  L +MNKSKEHGF GFRNS+ AFISWI+KMKAYKIVP
Sbjct  341  FGDICLGYECALMSMNKSKEHGFFGFRNSKNAFISWIEKMKAYKIVP  387



>gb|AAU88203.1| progesterone 5-beta-reductase [Digitalis purpurea subsp. heywoodii]
Length=389

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFPGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K  VW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEAVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|ABB36653.1| progesterone 5beta-reductase [Isoplexis isabelliana]
Length=389

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF+G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE      L+ +MK K PVW+EIV ENGL  TKL+DVG WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEE-GVGLKLQDLMKGKEPVWEEIVGENGLTPTKLKDVGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHG LGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGLLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AIW09145.1| progesterone 5-beta-reductase 3 [Catharanthus roseus]
Length=394

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVD--PSAKNEAFNVSNGDV  526
            YAAICK +G+PL+F G K  W+GY+ CSDADL+AEQ+IWAA+D  P+AKNEAFNVSNGDV
Sbjct  228  YAAICKQQGLPLKFPGSKNVWEGYSMCSDADLVAEQQIWAAIDHLPNAKNEAFNVSNGDV  287

Query  525  FKWKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGH  346
            FKWK+  KVLA++F +  VEF+   E  +L+ MM +KGP+W+EIVRENGLL TKLE VG 
Sbjct  288  FKWKYIWKVLAEQFGLEFVEFD--GEKLSLQEMMIDKGPIWEEIVRENGLLGTKLEQVGV  345

Query  345  WWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            WWF D+L   E PLD+MNKSKEHGFLGFRNS+ +F+SWI+K KAYKIVP
Sbjct  346  WWFADVLLGFEFPLDSMNKSKEHGFLGFRNSKNSFLSWIEKTKAYKIVP  394



>ref|XP_009593701.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
Length=390

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+ L+F G+K+AWDGY++CSDADLIAE +IWA+VDP+AKNEAF+VSNGDVFK
Sbjct  224  YAAICKHEGLKLKFPGVKSAWDGYSDCSDADLIAEHQIWASVDPNAKNEAFDVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LA++FEV   EF+E+S+   LE MMK+KG +WDEIV+ENGL+  KLE VG WW
Sbjct  284  WKHLWGILAEEFEVEAEEFDEKSKRWTLEEMMKDKGEIWDEIVKENGLVPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++ S E PLD MNKSKEHGFLGFRNS+ +F+SWIDK+KAYKIVP
Sbjct  344  FVDIVLSGECPLDAMNKSKEHGFLGFRNSKNSFVSWIDKVKAYKIVP  390



>ref|XP_011088173.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=373

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNV+NGDV+K
Sbjct  208  YAAICKHEGKVLRFPGCKEAWDGYSDCSDADLIAEHQIWAAVDPHAKNEAFNVNNGDVYK  267

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA +F V   E EE  ++   E +MK+KG VWDE+VRENGL  TKLEDVG WW
Sbjct  268  WKHLWKVLAKQFGVECGEHEE-GQTITFEGLMKDKGGVWDEMVRENGLTPTKLEDVGLWW  326

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   +  LD MNKSKEHGFLGFRNS+K+FISWI+K+KA KIVP
Sbjct  327  FADVILGNKCFLDTMNKSKEHGFLGFRNSKKSFISWIEKVKANKIVP  373



>ref|XP_011088183.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Sesamum indicum]
Length=389

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNV+NGDV+K
Sbjct  224  YAAICKHEGKVLRFPGCKEAWDGYSDCSDADLIAEHQIWAAVDPHAKNEAFNVNNGDVYK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F V   E EE  ++   E +MK+KG VWDE+VRENGL  TKLEDVG WW
Sbjct  284  WKHLWKVLAEQFGVECGEHEE-GQTITFEGLMKDKGGVWDEMVRENGLTPTKLEDVGLWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   +  LD MNKSKEHGFLGFRNS+K+FISWI+K+KA KIVP
Sbjct  343  FADVILGNKCFLDTMNKSKEHGFLGFRNSKKSFISWIEKVKANKIVP  389



>ref|XP_011088182.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Sesamum indicum]
Length=390

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G K AWDGY++CSDADLIAE +IWAAVDP AKNEAFNV+NGDV+K
Sbjct  225  YAAICKHEGKVLRFPGCKEAWDGYSDCSDADLIAEHQIWAAVDPHAKNEAFNVNNGDVYK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F V   E EE  ++   E +MK+KG VWDE+VRENGL  TKLEDVG WW
Sbjct  285  WKHLWKVLAEQFGVECGEHEE-GQTITFEGLMKDKGGVWDEMVRENGLTPTKLEDVGLWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   +  LD MNKSKEHGFLGFRNS+K+FISWI+K+KA KIVP
Sbjct  344  FADVILGNKCFLDTMNKSKEHGFLGFRNSKKSFISWIEKVKANKIVP  390



>gb|AAU88205.1| progesterone 5-beta-reductase [Digitalis thapsi]
Length=389

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG   RF G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVFRFPGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K  VW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEAVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>emb|CAC80137.1| progesterone 5-beta-reductase [Digitalis purpurea]
Length=389

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  LRF G KAAWDGY++CSDADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAAICKHEGKVLRFPGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+ E  +   L+ +MK K  VW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYGEGVDL-KLQDLMKGKEAVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>ref|XP_010271744.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=389

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 135/168 (80%), Gaps = 3/168 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKHEG+PLRF G + AW+GY++ SDAD+IAE +IWA+VDP AKNEAFN SNGDVFK
Sbjct  224  YATICKHEGMPLRFPGTRIAWEGYSDASDADMIAEHQIWASVDPYAKNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVL ++F V  +  EE   S  LE MMK+KGPVWDEIVRE  L+ TKLE+VG WW
Sbjct  284  WKHLWKVLGEQFGVEELMMEEGGLS--LEEMMKDKGPVWDEIVREKELVPTKLEEVGVWW  341

Query  339  FVDLLFSV-ESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +F + ES L +MNKSKEHGFLGFRNS  +FISWIDKMK+YKIVP
Sbjct  342  FVDAIFGLKESYLASMNKSKEHGFLGFRNSTNSFISWIDKMKSYKIVP  389



>gb|ABD33273.2| VEP1 , putative [Medicago truncatula]
Length=407

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LIAEQ IW A DP+AKNEAFN SNGDVFK
Sbjct  242  YAAICKHEGLPLRFPGSKGAWECYSTASDANLIAEQHIWGAADPNAKNEAFNCSNGDVFK  301

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  302  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  360

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D    +E  LD+MNK+KEHGF+GFRNS+ +FISWIDK KAYKIVP
Sbjct  361  FADFSLRLEGVLDSMNKAKEHGFIGFRNSKNSFISWIDKTKAYKIVP  407



>ref|XP_010111562.1| hypothetical protein L484_011348 [Morus notabilis]
 gb|EXC31269.1| hypothetical protein L484_011348 [Morus notabilis]
Length=389

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G KAAWD Y+  SDADLIAEQ+IWAAVD  AKNEAFN +NGDVF+
Sbjct  224  YAAICKHEGRPLKFPGTKAAWDSYSVASDADLIAEQQIWAAVDLYAKNEAFNCNNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     EE  E   L  +MK+KGPVW+EIV+EN L  TKLE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEDWGLEE-GERLRLTELMKDKGPVWEEIVKENQLEPTKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+FS  +PL +MNKSKEHGFLGFRNS+ +FISWIDK+KAYKIVP
Sbjct  343  FADLMFSGRAPLSSMNKSKEHGFLGFRNSKNSFISWIDKVKAYKIVP  389



>ref|XP_003589110.1| hypothetical protein MTR_1g018590 [Medicago truncatula]
Length=399

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LIAEQ IW A DP+AKNEAFN SNGDVFK
Sbjct  234  YAAICKHEGLPLRFPGSKGAWECYSTASDANLIAEQHIWGAADPNAKNEAFNCSNGDVFK  293

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  294  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  352

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D    +E  LD+MNK+KEHGF+GFRNS+ +FISWIDK KAYKIVP
Sbjct  353  FADFSLRLEGVLDSMNKAKEHGFIGFRNSKNSFISWIDKTKAYKIVP  399



>gb|AES59361.2| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=394

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y+  SDA+LIAEQ IW A DP+AKNEAFN SNGDVFK
Sbjct  229  YAAICKHEGLPLRFPGSKGAWECYSTASDANLIAEQHIWGAADPNAKNEAFNCSNGDVFK  288

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEE SE   L  +MK+KG VW+EIVREN LL TKLE+VG WW
Sbjct  289  WKHLWKVLAERFEIDDYGFEEGSEL-RLSDLMKDKGGVWEEIVRENELLYTKLEEVGDWW  347

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D    +E  LD+MNK+KEHGF+GFRNS+ +FISWIDK KAYKIVP
Sbjct  348  FADFSLRLEGVLDSMNKAKEHGFIGFRNSKNSFISWIDKTKAYKIVP  394



>ref|XP_009771310.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=390

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+ L+F G+K+AWDGY++CSDA+LIAE +IWA+V+P+AKNEAF+VSNGDVFK
Sbjct  224  YAAICKHEGLKLKFPGVKSAWDGYSDCSDAELIAEHQIWASVNPNAKNEAFDVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LA++FEV   EF+E+ +   LE MMK+KG +WDEIV+ENGL+  KLE VG WW
Sbjct  284  WKHLWGILAEEFEVEAEEFDEKKKRWRLEEMMKDKGEIWDEIVKENGLVPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++ S E PLD MNKSKEHGFLGFRNS+ AFISWIDK+KAYKIVP
Sbjct  344  FVDIVLSGECPLDTMNKSKEHGFLGFRNSKNAFISWIDKVKAYKIVP  390



>gb|AAS93805.1| putative progesterone 5-beta-reductase [Digitalis purpurea]
Length=389

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA CKHEG  LRF G KAAWDGY++CS ADLIAE  IWAAVDP AKNEAFNVSNGDVFK
Sbjct  224  YAATCKHEGKLLRFPGCKAAWDGYSDCSGADLIAEHHIWAAVDPYAKNEAFNVSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F V   E+EE  +   L+ +MK K  VW+EIVRENGL  TKL+D+G WW
Sbjct  284  WKHFWKVLAEQFGVECGEYEEGVDL-KLQDLMKGKEAVWEEIVRENGLTPTKLKDIGIWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  LD+MNKSKEHGFLGFRNS+ AFISWIDK KAYKIVP
Sbjct  343  FGDVILGNECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  389



>gb|AFW16645.1| putative progesterone 5beta-reductase [Bupleurum falcatum]
Length=388

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA+ICKHEG+ +RF G K AW  Y+  SDADLIAEQEIWA VDP AKNEAFN SNGDVFK
Sbjct  223  YASICKHEGVAMRFPGTKEAWSSYSEASDADLIAEQEIWAVVDPYAKNEAFNCSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA+KFEV   EF E  E   L  +MK+KG VWDEIV+EN L+  KLED+G WW
Sbjct  283  WKHFWKVLAEKFEVECGEF-EGGERLTLVELMKDKGSVWDEIVKENNLVPAKLEDIGLWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +  +E PLD MNKSKEHGFLGFRNS+ +FI+WI+K+K  K+VP
Sbjct  342  FVDYILGLEYPLDTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP  388



>gb|AFZ41790.1| putative progesterone 5-beta-reductase [Spinacia oleracea]
Length=398

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G KA+W+ Y+  SDADLIAE +IW +VDP AKNEAFN SNGDVFK
Sbjct  232  YAAICKHEGVPLQFPGTKASWESYSQASDADLIAEHQIWTSVDPYAKNEAFNCSNGDVFK  291

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   +VL ++FEV + +F+E  E  ++E  MK K  VW+EI+RENGL++TKLE+VG WW
Sbjct  292  WKQLWRVLGEQFEVEIADFDEDGERFSIEERMKGKEGVWEEIIRENGLVATKLEEVGSWW  351

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F+D  F  E  LD MNKSKEHGFLGFRN++ +F+SWIDKMKAYKIVP
Sbjct  352  FLDKAFDGEWHLDTMNKSKEHGFLGFRNTKNSFVSWIDKMKAYKIVP  398



>ref|XP_003638459.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35787.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G K AW+ Y+  SDADLIAEQ IWAAVDP AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLKFPGTKGAWESYSVASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA++F +    F+E      L  +MK+KGPVWDEIV+EN L +TK+++VG WW
Sbjct  284  WKQLWKVLAEQFGIEEYGFDEEGPRLKLSELMKDKGPVWDEIVKENQLEATKIDEVGEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+F  E  +D+MNK+KEHGF+GFRN++ + ISWIDK +AYKIVP
Sbjct  344  FVDLMFGGEGAVDSMNKAKEHGFVGFRNTKNSLISWIDKTRAYKIVP  390



>gb|ADG56539.1| progesterone 5-beta-reductase [Hoya carnosa]
Length=387

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG+PL+F G K  W+GY+  SDADLIAE EIWAAVDP+AKNEAFNVSNGDVFK
Sbjct  223  YAAICKQEGVPLKFPGCKEVWEGYSVASDADLIAEHEIWAAVDPNAKNEAFNVSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF K+LA++F V   E+    E  + E +MK+KG VW+EIV ENGL+ TKLE+VG WW
Sbjct  283  WKHFWKLLAEQFGVEYAEY--GGEKLSFEELMKDKGRVWEEIVAENGLVPTKLEEVGLWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL F  E  + +MNKSKEHGFLGFRNS+ AFISWI+KMKAYKIVP
Sbjct  341  FGDLCFGYECAVLSMNKSKEHGFLGFRNSKNAFISWIEKMKAYKIVP  387



>ref|XP_010277137.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=390

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKHEG  LRF G +  W+GY+N SDAD+IAE +IWA+VDP AKNEAFN SNGDVFK
Sbjct  224  YATICKHEGKLLRFPGSREVWEGYSNASDADMIAEHQIWASVDPHAKNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVL ++F V   EFEE     +LE MMK+KG VWDEIV +NGL+ +KLE++G WW
Sbjct  284  WKHLWKVLGEQFGVECAEFEEE-RGLSLEEMMKDKGAVWDEIVNDNGLVPSKLEEIGFWW  342

Query  339  FVDLLFSV-ESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++    ++ LDNMNKSKEHGFLGFRNS  AFISWIDKMKA+KIVP
Sbjct  343  FVDIVLGAKDTYLDNMNKSKEHGFLGFRNSTNAFISWIDKMKAFKIVP  390



>ref|XP_006387422.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
 gb|ERP46336.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
Length=391

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AW+ Y+  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  225  YAAICKHEGVPLIFRGSKEAWNSYSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA++F +    FEE   S      MK+KGPVW+EIVREN LL  KLE VG WW
Sbjct  285  WKHLWTVLAEEFGIEKYGFEEGESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWW  344

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+FSV   +  +NKSKEHGFLGFRNS+K+F+SWIDKMKAYK+VP
Sbjct  345  FADLMFSVPGSVICLNKSKEHGFLGFRNSKKSFVSWIDKMKAYKVVP  391



>gb|EYU37597.1| hypothetical protein MIMGU_mgv11b006498mg [Erythranthe guttata]
Length=391

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+P++F G K AW+GY++CSDADLIAE +IWAAVD  AKNEAFNVSNGDVFK
Sbjct  225  YAAICKHEGVPMKFPGSKIAWEGYSDCSDADLIAEHQIWAAVDRFAKNEAFNVSNGDVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF K LA+ F V  VE+EE  E   LE +MK+KG VWDEIVRENGL  TKLE+VG WW
Sbjct  285  WKHFWKALAEHFGVEFVEYEEGGEEVKLEELMKDKGSVWDEIVRENGLTVTKLEEVGTWW  344

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+   E  LD+MNKSKEHGFLGFRNS+ +F+SW+ K++A KIVP
Sbjct  345  FSDLILGGECSLDSMNKSKEHGFLGFRNSKSSFVSWMYKVQACKIVP  391



>ref|XP_002285152.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=390

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEGIPL+F G KAAWD Y++ SDADLIAEQ+IWA VDP A+NEAFN++NGD+FK
Sbjct  224  YAAICKHEGIPLKFPGSKAAWDCYSDASDADLIAEQQIWATVDPYARNEAFNITNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F++   EFEE  E  ++  MMK+KGPVW+EIVRE  LL TKLEDV  WW
Sbjct  284  WKHLWKVLAEQFDMEYAEFEEGEEKQSMVEMMKDKGPVWEEIVREKELLPTKLEDVAQWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F+DL+   ES L+ MNKSKEHGFLGFRNS  +F+ WIDKM+ +K++P
Sbjct  344  FIDLVLGGESLLNCMNKSKEHGFLGFRNSRNSFVWWIDKMRGHKLIP  390



>ref|XP_006386483.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
 gb|ERP64280.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
Length=390

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AW+ Y+  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGVPLIFHGSKEAWNSYSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA++F +    FEE   S      MK+KGPVW+EIVREN LL  KLE VG WW
Sbjct  284  WKHLWTVLAEEFGIEKYGFEEGESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+FS+   +  +NKSKEHGFLGFRNS+K+F+SWIDKMKAYK+VP
Sbjct  344  FADLVFSIPGSVLCLNKSKEHGFLGFRNSKKSFVSWIDKMKAYKVVP  390



>ref|XP_006374842.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
 gb|ERP52639.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
Length=391

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 133/170 (78%), Gaps = 6/170 (4%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  +RF G+K  W+ YA  SDADLIAE EIWA VDPSAKNEAFN+ NGDVFK
Sbjct  225  YAAICKHEGTLMRFPGVKEVWNCYAIASDADLIAEHEIWACVDPSAKNEAFNIHNGDVFK  284

Query  519  WKHFCKVLADKF---EVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKH  KVL ++F   E G VE EER    +L   MKEKG VW+EIVREN LL TKLE+VG
Sbjct  285  WKHLWKVLGEQFGLEEYGFVETEERI---SLAETMKEKGAVWEEIVRENQLLPTKLEEVG  341

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             WWFVDL+F  E  + +MNKSKEHGFLGFRNS+K+FISWI+KMKA K+VP
Sbjct  342  AWWFVDLIFGGEVSIPSMNKSKEHGFLGFRNSKKSFISWIEKMKASKVVP  391



>gb|KDP44462.1| hypothetical protein JCGZ_16295 [Jatropha curcas]
Length=269

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKH+G+PL F G + AWDGY   SDADLIAE +IWAAVDP+AKNEAFN SNGDVFK
Sbjct  103  YATICKHKGLPLTFPGNQLAWDGYWYASDADLIAEHQIWAAVDPNAKNEAFNCSNGDVFK  162

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA+KFE+    FE   +  +L   MK+ GPVWDEIVRE  L+ T+LE+VG WW
Sbjct  163  WKHLWKVLAEKFEIDNYGFEAGDKKLSLVERMKDMGPVWDEIVREKELVPTRLEEVGAWW  222

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             +DL F   + LD MNKSKEHGF+GFRNS+  F SWIDKMK+++IVP
Sbjct  223  LIDLFFQGAAYLDTMNKSKEHGFVGFRNSKTCFASWIDKMKSHRIVP  269



>ref|XP_011069776.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=387

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL+F G KAAW+ Y   SDADLIAEQ+IW +VDP+ KNEAFN SNGDVFK
Sbjct  221  YAAICKHEKVPLKFPGTKAAWNCYFVASDADLIAEQQIWCSVDPNGKNEAFNCSNGDVFK  280

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLADKF V   EF+E  E  +L   MK+KGPVWDEIV++N L  TKLE+V  +W
Sbjct  281  WKHLWKVLADKFGVEYEEFDENQEYVSLAERMKDKGPVWDEIVKKNNLTPTKLEEVSTFW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+F  E  LD+MNKSKEHGF GFRNS+ + IS IDKMKA+KIVP
Sbjct  341  FVDLMFGGECMLDSMNKSKEHGFFGFRNSQNSLISVIDKMKAHKIVP  387



>ref|XP_011016706.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AW+ Y+  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGVPLIFRGSKEAWNSYSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH    LA++F +    FEE   S      MK+KGPVW+EIVREN LL  KLE VG WW
Sbjct  284  WKHLWTALAEEFGIEKYGFEEGESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+FS+   +  +NKSKEHGFLGFRNS+K+F+SWIDKMKAYK+VP
Sbjct  344  FADLMFSIPGSVLCLNKSKEHGFLGFRNSKKSFVSWIDKMKAYKVVP  390



>ref|XP_006366601.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K+AWDGY+ CSDADLIAEQ IWA+VDP+AKNEAFN+SNGDVFK
Sbjct  223  YAAICKHEGLPLRFPGSKSAWDGYSICSDADLIAEQHIWASVDPNAKNEAFNISNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  + LA++FEV  +E  + ++   LE MMK+KG +WD IV+ENGL+ +KLE++G WW
Sbjct  283  WKHLWEGLAEEFEV-EIEEFDENKRWTLEEMMKDKGQIWDGIVKENGLVESKLEEIGGWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + E PLD MNKSKEHGFLGFRNS+ AFISWI K+KA KIVP
Sbjct  342  FVDLVLNEECPLDTMNKSKEHGFLGFRNSKNAFISWIYKIKACKIVP  388



>ref|XP_007018551.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY15776.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=389

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G++AAW+ Y+N SDADLIAE +IWAAVDP AKNEAFNV+NGDVFK
Sbjct  224  YAAICKHEGQPLWFPGIRAAWESYSNGSDADLIAEHQIWAAVDPYAKNEAFNVNNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  + LA++F +    FEE  ++  L  MMK K  VW+EIV+EN L  T+LE+VG WW
Sbjct  284  WKHLWRALAEQFGIEEFGFEE-GQNLGLVEMMKGKERVWEEIVKENQLEETRLEEVGLWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+ + E PL +MNKSKEHGFLGFRNS+ +FI+WIDKMKAYKIVP
Sbjct  343  FVDLILAGEPPLSSMNKSKEHGFLGFRNSKNSFITWIDKMKAYKIVP  389



>ref|XP_004152001.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 ref|XP_004163586.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 gb|KGN58303.1| hypothetical protein Csa_3G610790 [Cucumis sativus]
Length=394

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G K AW+ +   SDADLIAEQ IW AVDP +KNEAFN +NGDVFK
Sbjct  228  YAAICKHEGRPLKFPGNKLAWEDFQVASDADLIAEQHIWTAVDPYSKNEAFNCNNGDVFK  287

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +    F+E  ES  L  +MK+K  VWDEIV+EN L  TKLE++G WW
Sbjct  288  WKHFWKVLAEQFNIEEYGFDEEGESLTLVDLMKDKSDVWDEIVKENQLQQTKLEEIGTWW  347

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +FS+   +D+MNKSKEHGFLGFRNS+ +FISWIDK+KA+KIVP
Sbjct  348  FVDSIFSMSGNIDSMNKSKEHGFLGFRNSKNSFISWIDKIKAFKIVP  394



>gb|AIW09146.1| progesterone 5-beta-reductase 4 [Catharanthus roseus]
Length=390

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL F G KAAW+ Y+  SDADLIAE +IWAAVDP AKNEAFN SNGD+FK
Sbjct  224  YAAICKHENVPLTFPGTKAAWNCYSVASDADLIAEHQIWAAVDPYAKNEAFNCSNGDIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FEV  VEF+E  E  +L   MK+KG VWDEIV +N L+ TKLE+V  +W
Sbjct  284  WKHLWKVLAEQFEVDYVEFDENQEFVSLSDRMKDKGSVWDEIVEKNQLIPTKLEEVATFW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+   E  LD+MNKSKEHGFLGFRN+ K+ +S +DKMKA+KIVP
Sbjct  344  FADLILGFECMLDSMNKSKEHGFLGFRNTAKSLVSVVDKMKAHKIVP  390



>ref|XP_008236416.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like 
[Prunus mume]
Length=395

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKH G  LRFSG + AW+GY + SDADLIAE EIWAAVDP AKNEAFN SNGDV K
Sbjct  224  YAAICKHIGKKLRFSGSRGAWNGYXDASDADLIAEHEIWAAVDPYAKNEAFNCSNGDVCK  283

Query  519  WKHFCKVLADKFEVGVVEFEERS-----ESNNLEVMMKEKGPVWDEIVRENGLLSTKLED  355
            WK+  +VLA++F++   +F++          ++E MMK+KGPVWDEIVRENGL+ TKLE+
Sbjct  284  WKNLWRVLAEQFDMEFEDFDDDDEGEGESRPSMEEMMKDKGPVWDEIVRENGLVPTKLEE  343

Query  354  VGHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +G+WWFVD++F VES +D+MNKSK+HGF+GFRNS  +F++WIDKMK+Y++VP
Sbjct  344  IGNWWFVDVIFGVESSVDSMNKSKDHGFVGFRNSRTSFVTWIDKMKSYRLVP  395



>ref|XP_011017140.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AW+ Y+  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGVPLIFRGSKEAWNSYSIASDADLIAEHEIWACVDPNAQNEAFNIQNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LA++F +    FEE   S      MK+KGPVW+EIVREN LL  KLE VG WW
Sbjct  284  WKHLWTILAEEFGIEKYGFEEGESSVTFAEKMKDKGPVWEEIVRENQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +FS+   +  +NKSKEHGFLGFRNS+K+F+SWIDKMKAYK+VP
Sbjct  344  FADFVFSIPGSVLCLNKSKEHGFLGFRNSKKSFVSWIDKMKAYKVVP  390



>ref|XP_010059860.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Eucalyptus 
grandis]
 gb|KCW66304.1| hypothetical protein EUGRSUZ_F00129 [Eucalyptus grandis]
Length=392

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AWD Y+   DADLIAEQ IWAAVDP A+NEAFN SNGDVFK
Sbjct  224  YAAICKHEGVPLMFPGTKEAWDCYSAAGDADLIAEQHIWAAVDPYARNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +    F+E      L   MK K  VW+EIVREN L  TKLE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGFDEGGPRLRLTEAMKGKEKVWEEIVRENQLQETKLEEVGLWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+F   + LD+MNKSKEHGFLGFRNS+ +F+SWIDK+K YKIVP
Sbjct  344  FVDLMFDGPALLDSMNKSKEHGFLGFRNSKNSFLSWIDKVKGYKIVP  390



>ref|XP_008447374.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Cucumis 
melo]
Length=393

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G K AW+ +   SDADL+AEQ IW AVDP +KNEAFN +NGDVFK
Sbjct  228  YAAICKHEGRPLKFPGTKLAWEDFQAASDADLVAEQHIWTAVDPYSKNEAFNCNNGDVFK  287

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +    FEE  E   L  +MK+K  VWDEIV+EN L  TKLE++G+WW
Sbjct  288  WKHFWKVLAEQFNIEEYGFEE-GERLTLVDLMKDKSDVWDEIVKENQLQPTKLEEIGNWW  346

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +VD++FSV   +D+MNKSKEHGFLGFRNS+ +FISWIDK+KA+KIVP
Sbjct  347  YVDVIFSVSGNIDSMNKSKEHGFLGFRNSKNSFISWIDKIKAFKIVP  393



>gb|KJB83174.1| hypothetical protein B456_013G233500 [Gossypium raimondii]
Length=282

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G KAAW+ Y   S ADLIAEQ IWAAVDP AKNE FNV+NGDVFK
Sbjct  117  YAAICKHEGKPLHFPGSKAAWNCYYEASGADLIAEQHIWAAVDPYAKNEPFNVTNGDVFK  176

Query  519  WKHFCKVLADKF---EVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WK    VLA++F   E G VE E R     LE MMK K  VW+EIV+E  L    LE+VG
Sbjct  177  WKQLWTVLAEQFGIEEYGFVEGENRG----LEEMMKGKEGVWEEIVKEKQLQKRSLEEVG  232

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +WWFVDL FS E PL N NKSKEHGFLGFRNS+K+F++WIDKMKAYKIVP
Sbjct  233  NWWFVDLAFSAEVPLLNTNKSKEHGFLGFRNSQKSFVTWIDKMKAYKIVP  282



>ref|XP_004289734.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=389

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 139/171 (81%), Gaps = 9/171 (5%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PLRF G K  W+G+ + SDAD+IAE EIWAAV+P AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGQPLRFPGSKGTWEGFWDASDADMIAEHEIWAAVEPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEV--GVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGH  346
            WKH   +LAD+FEV  G V+ E R     +E MMK+KGPVWDEIVR++ L+ +KLE+VG+
Sbjct  284  WKHLWGILADQFEVESGGVDEELR-----VEEMMKDKGPVWDEIVRKHDLVPSKLEEVGN  338

Query  345  WWFVDLLF--SVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            WW VD++F   V+S +D+MNKS+EHGF+GFRNS+ +F+SWIDKMK+Y+IVP
Sbjct  339  WWLVDIIFRIGVDSSMDSMNKSREHGFVGFRNSKTSFLSWIDKMKSYRIVP  389



>ref|XP_010673631.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEGIP RF G K  W+ Y+  SDADLIAE +IWAAVDP AKNEAFN SNGDVFK
Sbjct  229  YAAICKHEGIPFRFPGSKIIWESYSQASDADLIAEHQIWAAVDPYAKNEAFNCSNGDVFK  288

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  +VL ++F V V EF+ER    +L   +K K  VW+EIV+EN L++TKLE+VG W 
Sbjct  289  WKHLWQVLGEQFGVEVAEFDERVGGFSLAEWIKGKDSVWEEIVKENDLVATKLEEVGTWQ  348

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD+ FS   PLD MNKSKEHGFLGFRN++ + I W+DKMKAYKIVP
Sbjct  349  FVDMAFSWNWPLDTMNKSKEHGFLGFRNTKNSLIYWVDKMKAYKIVP  395



>ref|XP_007201077.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
 gb|EMJ02276.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
Length=392

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKH G  LRFSG +  W+GY + SDADLIAE +IWAAVDP AKNEAFN SNGDV+K
Sbjct  223  YAAICKHVGKKLRFSGSRGVWNGYWDASDADLIAEHQIWAAVDPYAKNEAFNCSNGDVYK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESN---NLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKH  +VLA++F++   +F++  E     ++E MMK+KGPVWDEIVREN L+ TKLE++G
Sbjct  283  WKHLWRVLAEQFDMEFEDFDDDDEGELRPSMEEMMKDKGPVWDEIVRENDLVPTKLEEIG  342

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +WWFVD++F VES +D+MNKSKEHGF+GFRNS  +F++WIDKMK+Y++VP
Sbjct  343  NWWFVDVMFGVESSVDSMNKSKEHGFVGFRNSRTSFVTWIDKMKSYRLVP  392



>ref|XP_002518657.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43582.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKH+G+PL F G + AWDGY + SDADLIAE +IWAAVDP AKNEAFN SNGDVFK
Sbjct  224  YAAICKHQGLPLTFPGNRDAWDGYWDASDADLIAEHQIWAAVDPYAKNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESN-NLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHW  343
            WKH  K LA++FE+    FEE ++   +L  MMK KGPVWDEIV+E  LL T+LE+V  +
Sbjct  284  WKHLWKELAEQFEIENYGFEEENDKRPSLVEMMKNKGPVWDEIVKEKELLPTRLEEVAAF  343

Query  342  WFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            W VDLL    S LD+MNKSKEHGFLGFRNS K+F SWIDK+KA +IVP
Sbjct  344  WLVDLLLQGASLLDSMNKSKEHGFLGFRNSNKSFASWIDKLKAQRIVP  391



>gb|AJE29749.1| putative progesterone 5-beta-reductase [Cucurbita pepo]
Length=393

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G K+AW+GY+  SDADLIAEQ IW AVDP AKNEAFN SNGDVFK
Sbjct  228  YAAICKHEGRPLKFPGTKSAWEGYSVVSDADLIAEQHIWTAVDPYAKNEAFNCSNGDVFK  287

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +    FEE  E   L  +MK K  VW+EIV+EN L  TKLEDV +WW
Sbjct  288  WKHFWKVLAEQFNIEDYGFEE-GERLPLRELMKGKNEVWEEIVKENQLQPTKLEDVANWW  346

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D+  S    +D+MNKSKEHGFLGFRNS+ +FISWIDK+KA+KIVP
Sbjct  347  HTDIALSASGNIDSMNKSKEHGFLGFRNSKNSFISWIDKVKAFKIVP  393



>ref|XP_003636813.1| Progesterone 5-beta-reductase [Medicago truncatula]
 ref|XP_003638462.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35786.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09150.1| progesterone 5-beta-reductase 2 [Medicago truncatula]
Length=390

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y   SDADLIAEQ IWAAVDP AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLRFPGTKLAWENYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KV+A++F +    F+E      L  +MK+KGPVWDEIV+ENGL  TKLE+V  WW
Sbjct  284  WKQLWKVIAEQFGIEEYGFDEEGPRLKLTELMKDKGPVWDEIVKENGLQVTKLEEVAEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D  F      D+MNKSKEHGFLGFRN++ + I+WID+ +AYKIVP
Sbjct  344  FADACFGGNGFTDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>ref|XP_003598452.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|AES68703.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y   SDADLIAEQ IWAAVDP AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLRFPGTKLAWENYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KV+A++F +    F+E      L  +MK+KGPVWDEIV+ENGL  TKLE+V  WW
Sbjct  284  WKQLWKVIAEQFGIEEYGFDEEGPRLKLTELMKDKGPVWDEIVKENGLQVTKLEEVAEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D  F      D+MNKSKEHGFLGFRN++ + I+WID+ +AYKIVP
Sbjct  344  FADACFGGNGFTDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>ref|XP_004300685.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=391

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+  +  SDADLIAEQ+IWAAVDP A+N+AFN++NGDVFK
Sbjct  225  YAAICKHEGMPLRFPGTKGAWNCLSTASDADLIAEQQIWAAVDPYARNQAFNINNGDVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA+ F +    F+E+ E  +L  MMK K  VW+EIV+++ L+ TKLE VG WW
Sbjct  285  WKHLWKVLAENFGIEECGFQEKGERVSLREMMKGKSGVWNEIVKKHQLVPTKLEQVGVWW  344

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +FS E     MNKSKEHGF+GFRNS  + ++WIDKMKAYKIVP
Sbjct  345  FVDAIFSGECMFGCMNKSKEHGFVGFRNSRNSLVTWIDKMKAYKIVP  391



>ref|XP_010099074.1| hypothetical protein L484_011508 [Morus notabilis]
 gb|EXB76663.1| hypothetical protein L484_011508 [Morus notabilis]
Length=378

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+ LR  G +   + Y + SDADLIAE +IWAAVD  AKNEAFN SNGDVFK
Sbjct  212  YAAICKHEGMKLRIPGTREGREAYLDASDADLIAEHQIWAAVDTYAKNEAFNCSNGDVFK  271

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVL ++FE+   EFE+  +S  L  MMK+KG VWD+IV+ENGL+ T LE+VG++W
Sbjct  272  WKHMWKVLTEQFELEYEEFEDDGDSLTLVEMMKDKGEVWDQIVKENGLVPTNLEEVGNFW  331

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+ ++ + LD+MNKSKE+GF+GFRNS+ +FISWIDKMK+YKIVP
Sbjct  332  FADLVLTLGTTLDSMNKSKEYGFVGFRNSKSSFISWIDKMKSYKIVP  378



>gb|ABK95160.1| unknown [Populus trichocarpa]
Length=269

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+GYA  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  103  YAAICKHEGAPLIFRGTKEAWNGYAIASDADLIAEHEIWACVDPNAQNEAFNIHNGDLFK  162

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  ++LA+++ +    FEE   S      MK+K PVW+EIV++N LL  KLE VG WW
Sbjct  163  WKHLWRILAEEYGIEEHGFEEGESSITFTEAMKDKEPVWEEIVKKNQLLPNKLEQVGGWW  222

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+F     + N+NK+KEHGFLGFRNS+K+F+SW+DKMK YK+VP
Sbjct  223  FADLIFGGPGIVTNLNKTKEHGFLGFRNSKKSFVSWLDKMKDYKVVP  269



>emb|CAN63254.1| hypothetical protein VITISV_028488 [Vitis vinifera]
Length=1000

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEGIPL+F G KAAWD Y++ SDADLIAEQ+IWA VDP A+NEAFN++NGD+FK
Sbjct  834  YAAICKHEGIPLKFPGSKAAWDCYSDASDADLIAEQQIWATVDPYARNEAFNITNGDLFK  893

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F++   EFEE  E  ++  MMK+KGPVW+EIVRE  LL TKLEDV  WW
Sbjct  894  WKHLWKVLAEQFDMEYAEFEEGEEKQSMVEMMKDKGPVWEEIVREKELLPTKLEDVAQWW  953

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F+DL+   ES L+ MNKSKEHGFLGFRNS  +F+ WIDKM+ +K++P
Sbjct  954  FIDLVLGGESLLNCMNKSKEHGFLGFRNSRNSFVWWIDKMRGHKLIP  1000



>gb|KJB83175.1| hypothetical protein B456_013G233500 [Gossypium raimondii]
Length=376

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G KAAW+ Y   S ADLIAEQ IWAAVDP AKNE FNV+NGDVFK
Sbjct  211  YAAICKHEGKPLHFPGSKAAWNCYYEASGADLIAEQHIWAAVDPYAKNEPFNVTNGDVFK  270

Query  519  WKHFCKVLADKF---EVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WK    VLA++F   E G VE E R     LE MMK K  VW+EIV+E  L    LE+VG
Sbjct  271  WKQLWTVLAEQFGIEEYGFVEGENRG----LEEMMKGKEGVWEEIVKEKQLQKRSLEEVG  326

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +WWFVDL FS E PL N NKSKEHGFLGFRNS+K+F++WIDKMKAYKIVP
Sbjct  327  NWWFVDLAFSAEVPLLNTNKSKEHGFLGFRNSQKSFVTWIDKMKAYKIVP  376



>ref|XP_007226426.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
 gb|EMJ27625.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
Length=379

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA+ICKHE  PLRF G +AAW+ Y++ SDADLIAEQ+IWAAVDP+AKNEAFNV+NGDVFK
Sbjct  214  YASICKHEKKPLRFPGSEAAWNCYSDVSDADLIAEQQIWAAVDPNAKNEAFNVNNGDVFK  273

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK F  VLA++FE+    F+E     +L  MMKEK  VW+EIVREN L  TKLE++G WW
Sbjct  274  WKQFWTVLAEQFEIEEYGFDEEGGGFSLLEMMKEKEGVWEEIVRENQLEPTKLEEIG-WW  332

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             +DL FS E  + +MNKSKEHGFLGFRNS K+F+SWIDK KA+KIVP
Sbjct  333  LLDLFFSGEGLMTSMNKSKEHGFLGFRNSRKSFVSWIDKNKAFKIVP  379



>gb|AFK42748.1| unknown [Medicago truncatula]
Length=390

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y   SDADLIAEQ IW AVDP AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLRFPGTKLAWENYYMASDADLIAEQHIWTAVDPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KV+A++F +    F+E      L  +MK+KGPVWDEIV+ENGL  TKLE+V  WW
Sbjct  284  WKQLWKVIAEQFGIEEYGFDEEGPRLKLTELMKDKGPVWDEIVKENGLQVTKLEEVAEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D  F      D+MNKSKEHGFLGFRN++ + I+WID+ +AYKIVP
Sbjct  344  FADACFGGNGFTDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>gb|AFK45113.1| unknown [Medicago truncatula]
Length=390

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW  Y   SDADLIAEQ IWAAVDP AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLRFPGTKLAWANYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KV+A++F +    F+E      L  +MK+KGPVWDEIV+ENGL  TKLE+V  WW
Sbjct  284  WKQLWKVIAEQFGIEEYGFDEEGPRLKLTELMKDKGPVWDEIVKENGLQVTKLEEVAEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D  F      D+MNKSKEHGFLGFRN++ + I+WID+ +AYKIVP
Sbjct  344  FADACFGGNGFTDSMNKSKEHGFLGFRNTKNSLINWIDRTRAYKIVP  390



>ref|XP_009360316.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Pyrus x bretschneideri]
Length=388

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL+F G KAAW+ YA  SDADLIAEQ IWAAVDP+A+NEAFN++NGDVFK
Sbjct  222  YAAICKKEGRPLKFPGTKAAWECYAMASDADLIAEQHIWAAVDPNAQNEAFNINNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK F K LA++F +    F+E  E  +L   MK K  VW+EIVREN L  TKLE+VG WW
Sbjct  282  WKQFWKGLAEQFGIEEYGFDEEGERRSLVEEMKGKEGVWEEIVRENELQPTKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +   E+ LD+MNKSKEHGFLGFRNS K+F+SWI+KMKAYKIVP
Sbjct  342  FADYVLGGEAVLDSMNKSKEHGFLGFRNSYKSFVSWIEKMKAYKIVP  388



>ref|XP_009360311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Pyrus x bretschneideri]
Length=389

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL+F G KAAW+ YA  SDADLIAEQ IWAAVDP+A+NEAFN++NGDVFK
Sbjct  223  YAAICKKEGRPLKFPGTKAAWECYAMASDADLIAEQHIWAAVDPNAQNEAFNINNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK F K LA++F +    F+E  E  +L   MK K  VW+EIVREN L  TKLE+VG WW
Sbjct  283  WKQFWKGLAEQFGIEEYGFDEEGERRSLVEEMKGKEGVWEEIVRENELQPTKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +   E+ LD+MNKSKEHGFLGFRNS K+F+SWI+KMKAYKIVP
Sbjct  343  FADYVLGGEAVLDSMNKSKEHGFLGFRNSYKSFVSWIEKMKAYKIVP  389



>gb|KJB58603.1| hypothetical protein B456_009G217500 [Gossypium raimondii]
Length=391

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 9/172 (5%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G KAAW+ Y   SDADLIAEQ IWAAVDP AKNEAFNV+NGDVFK
Sbjct  224  YAAICKHEGKPLHFPGSKAAWNCYFEASDADLIAEQHIWAAVDPYAKNEAFNVTNGDVFK  283

Query  519  WKHFCKVLADKF---EVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKH   VLA++F   E G VE E R     +E MMKEK  VW+EIV+EN L  T L+ VG
Sbjct  284  WKHLWSVLAEQFGIEEFGFVEGENRG----MEEMMKEKEGVWEEIVKENQLQKTSLQVVG  339

Query  348  HWWFVDLLFS--VESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +WWF D +FS  ++ PL +MNKSKEHGFLGFRNS  +F++WIDKMKAYKIVP
Sbjct  340  NWWFTDTIFSAPLQMPLLSMNKSKEHGFLGFRNSRNSFVTWIDKMKAYKIVP  391



>ref|XP_007223008.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
 gb|EMJ24207.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
Length=394

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 134/170 (79%), Gaps = 4/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE  PL+F G KAAW+ ++  SDADLIAEQ IWAAVDP AKNEAFNV+NGDVFK
Sbjct  226  YAAICKHEKKPLKFPGSKAAWNCFSVASDADLIAEQHIWAAVDPYAKNEAFNVNNGDVFK  285

Query  519  WKHFCKVLADKF---EVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKH  KVLA++F   E G+ E EE     +L  MMK KG VW+EIV++N L  TKLE+VG
Sbjct  286  WKHVWKVLAEQFGIEEYGIDE-EEGERRLSLVEMMKGKGGVWEEIVKKNKLQPTKLEEVG  344

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             WWF D++  VES LD+MNKSKEHGFLGFRNS+++F SW+ KMKAYKIVP
Sbjct  345  VWWFADIVLCVESALDSMNKSKEHGFLGFRNSQESFTSWVQKMKAYKIVP  394



>ref|XP_006420622.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
 gb|ESR33862.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
Length=385

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AWDG+   SDADLIAEQ+IWAAVDP+A+NEAFN +NGDVFK
Sbjct  218  YAAICKHEGVPLLFPGTKEAWDGFTEVSDADLIAEQQIWAAVDPNARNEAFNCANGDVFK  277

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++FE+    F+E+ E   L  +MK K  VW+EIVR+N LL TKL +V  WW
Sbjct  278  WKHFWKVLAERFEIEDYGFDEKGERLRLVEIMKGKESVWEEIVRKNKLLPTKLNEVAIWW  337

Query  339  FVDLLFSV-ESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D+ F V E  L +MNKSK HGFLGFRNS+ +FI+WIDKMK YKIVP
Sbjct  338  HADVSFDVGEDILVSMNKSKGHGFLGFRNSKNSFIAWIDKMKRYKIVP  385



>gb|KDP41649.1| hypothetical protein JCGZ_16056 [Jatropha curcas]
Length=390

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G KA+W+ Y+  SDADLIAE +IWAAVDP AKNEAFN +NGDVFK
Sbjct  224  YAAICKHEGLPLLFPGSKASWNCYSIASDADLIAEHQIWAAVDPYAKNEAFNCNNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  +VLA++F +      E     +L+ MMK+KG VW+EIVREN L  TKLE+V  WW
Sbjct  284  WKHLWQVLAEQFGIENYGLNEGENKLSLQEMMKDKGAVWEEIVRENQLQPTKLEEVAEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  L +MNKSKEHGFLGFRNS+ +FISWIDK+KAYKIVP
Sbjct  344  FADVILWGEDYLQSMNKSKEHGFLGFRNSKNSFISWIDKVKAYKIVP  390



>ref|XP_002302422.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
 gb|EEE81695.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
Length=390

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G ++ WD Y+  SDADLIAEQEIWAAVDP+A+NEAFN+ NGDVFK
Sbjct  224  YAAICKHEGMPLLFPGTESVWDAYSIASDADLIAEQEIWAAVDPNARNEAFNIHNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +      E  +  +L  +MK+KG VW++IV++N LL  KLE+VG WW
Sbjct  284  WKHLWKVLAEQFGIKKYGLPESGKKVSLTELMKDKGAVWEKIVKDNQLLPNKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +   ES +  MNKSKEHGFLGFRNS+ + ISW+DK+KA+KIVP
Sbjct  344  FADFVLGAESIISCMNKSKEHGFLGFRNSKNSLISWVDKLKAHKIVP  390



>ref|XP_007042587.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
 gb|EOX98418.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
Length=390

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PLRF G + AWDGY + SDADLIAE +IWAA++  AKNEAFN SNGDVFK
Sbjct  224  YAAICKHEGKPLRFPGSRQAWDGYWDASDADLIAEHQIWAALNRHAKNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA +F +    F E  E ++L  MMK+KGP+WDEIVRE GL+ TKL +VG W 
Sbjct  284  WKDLWKVLAKQFGIEDYGFHESDERHSLVEMMKDKGPLWDEIVREKGLVHTKLNEVGAWR  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D + S +S LD+MNKSKEHGF+GFRNS+ +F SWIDKMK +KIVP
Sbjct  344  FADAVLSGKSLLDSMNKSKEHGFVGFRNSKTSFNSWIDKMKTHKIVP  390



>gb|AHI88616.2| progesterone 5-beta-reductase [Capsella bursa-pastoris]
Length=386

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+A  SDADLIAEQ+IWAAVDP A NEAFN SNGDVFK
Sbjct  221  YAAICKHEGSPLLFPGSKTAWEGFAVSSDADLIAEQQIWAAVDPYAGNEAFNCSNGDVFK  280

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  ++  L  MM+ K  VW+EIV+EN L  TK+E+VG WW
Sbjct  281  WKHMWKVLAEQFGIEEFGFEE-GKNVGLGKMMEGKERVWEEIVKENQLKKTKMEEVGVWW  339

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  340  FADVILGVEGMIDSMNKSKEHGFLGFRNSKNSFISWIDKYKAYKIVP  386



>ref|XP_009360365.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
 ref|XP_009360373.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G KAAW+ Y+  SDADLIAE  IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHEGLPLRFPGSKAAWNSYSVASDADLIAEHHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     +E     +L   MK K  VW+EIVREN L  TKLE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIDEGGGRLSLAERMKGKEGVWEEIVRENELKETKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++   E  L +MNKSKEHGF+GFRNS  +F++WIDKMK++KIVP
Sbjct  344  FVDVVLGGEGVLSSMNKSKEHGFVGFRNSRNSFVTWIDKMKSFKIVP  390



>gb|AAO63776.1| unknown [Populus tremuloides]
Length=391

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+GYA  SDA+LIAE EIWA V+P AKNEAFN++NGD+FK
Sbjct  225  YAAICKHEGAPLIFPGTKEAWNGYAIASDANLIAEHEIWACVEPKAKNEAFNINNGDLFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA +F +    F E   S      MK+KGPVW+EIV++N LLS KLE VG WW
Sbjct  285  WKHMWTVLAQEFGIEKYGFVEGESSVTFAEKMKDKGPVWEEIVKKNQLLSNKLEQVGGWW  344

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+FS    + +MNK+KEHGFLGFRNS+K+F+SWI KM+AYK+VP
Sbjct  345  FGDLIFSGSGYVASMNKAKEHGFLGFRNSKKSFVSWIHKMRAYKVVP  391



>ref|XP_007042586.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98417.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
Length=407

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PLRF G + AWDGY + SDADLIAE +IWAA++  AKNEAFN SNGDVFK
Sbjct  241  YAAICKHEGKPLRFPGSRQAWDGYWDASDADLIAEHQIWAALNRHAKNEAFNCSNGDVFK  300

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA +F +    F E  E ++L  MMK+KGP+WDEIVRE GL+ TKL +VG W 
Sbjct  301  WKDLWKVLAKQFGIEDYGFHESDERHSLVEMMKDKGPLWDEIVREKGLVHTKLNEVGAWR  360

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D + S +S LD+MNKSKEHGF+GFRNS+ +F SWIDKMK +KIVP
Sbjct  361  FADAVLSGKSLLDSMNKSKEHGFVGFRNSKTSFNSWIDKMKTHKIVP  407



>ref|XP_006374844.1| hypothetical protein POPTR_0014s01970g [Populus trichocarpa]
 gb|ERP52641.1| hypothetical protein POPTR_0014s01970g [Populus trichocarpa]
Length=390

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+GYA  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGAPLIFRGTKEAWNGYAIASDADLIAEHEIWACVDPNAQNEAFNIHNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  ++LA+++ +    FEE   S      MK+K PVW+EIV++N LL  KLE VG WW
Sbjct  284  WKHLWRILAEEYGIEEHGFEEGESSITFTEAMKDKEPVWEEIVKKNQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+F     + N+NK+KEHGFLGFRNS+K+F+SW+DKMK YK+VP
Sbjct  344  FADLIFGGPGIVTNLNKTKEHGFLGFRNSKKSFVSWLDKMKDYKVVP  390



>ref|XP_002510123.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52310.1| conserved hypothetical protein [Ricinus communis]
Length=390

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKHEG+PL F G KAAW+ Y+  SDADLIAE +IWA+VDP AK+EAFN +NGDVFK
Sbjct  224  YATICKHEGLPLLFPGTKAAWNCYSVASDADLIAEHQIWASVDPYAKDEAFNCNNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +    FEE  +  +L  MMK K  VW+EIV EN L  TKL++V  WW
Sbjct  284  WKHFWKVLAEQFGIEEYGFEEGEKRLSLVEMMKGKEAVWEEIVSENQLQPTKLDEVAVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVDL+   E+ + +MNKSKEHGFLGFRNS+ +F SWIDKMKAYKIVP
Sbjct  344  FVDLMLGGEAVISSMNKSKEHGFLGFRNSKNSFASWIDKMKAYKIVP  390



>gb|ABK95134.1| unknown [Populus trichocarpa]
Length=390

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+GYA  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGAPLIFRGTKEAWNGYAIASDADLIAEHEIWACVDPNAQNEAFNIHNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  ++LA+++ +    FEE   S      MK+K PVW+EIV++N LL  KLE VG WW
Sbjct  284  WKHLWRILAEEYGIEEHGFEEGESSITFAEAMKDKEPVWEEIVKKNQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+F     + N+NK+KEHGFLGFRNS+K+F+SW+DKMK YK+VP
Sbjct  344  FADLIFGGPGIVTNLNKTKEHGFLGFRNSKKSFVSWLDKMKDYKVVP  390



>ref|XP_009137807.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY34267.1| BnaA01g13700D [Brassica napus]
Length=390

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G++  SDADLIAEQ+IWAAVDP AKNEAFN +N DVFK
Sbjct  224  YAAICKHEGTKLIFPGSKKAWEGFSTASDADLIAEQQIWAAVDPYAKNEAFNCNNDDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      L  MMK K  VW+E+V+ENGL   KL++VG WW
Sbjct  284  WKHLWKVLAEQFGIEEYGFEEGRNVGGLVEMMKGKESVWEEMVKENGLAEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FVDVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  390



>gb|AFW16644.1| putative progesterone 5beta-reductase [Passiflora incarnata]
Length=389

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K +W+ YA  SDADLIAEQEIWA VDP+A NE FN  NGD+FK
Sbjct  223  YAAICKHEGQPLLFPGTKESWENYAVASDADLIAEQEIWACVDPNAHNEVFNCHNGDLFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+    FEER +   LE  MK+KGPVWD IV+++ L STKLE++G +W
Sbjct  283  WKHLWKVLAEQFEIEKYGFEEREKRVTLEERMKDKGPVWDGIVQKHQLSSTKLEEIGAFW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++    S +  MNK KEHGF GFRNS+ +FISWIDKMKAYKIVP
Sbjct  343  FPDIILGGWSNISCMNKCKEHGFFGFRNSKNSFISWIDKMKAYKIVP  389



>gb|AGN74846.1| putative enone 5-beta-reductase [Brassica juncea var. juncea]
Length=388

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G++  SDADLIAEQ+IWAAVDP AKNEAFN +N DVFK
Sbjct  222  YAAICKHEGSKLIFPGSKKAWEGFSTASDADLIAEQQIWAAVDPYAKNEAFNCNNDDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      L  MMK K  VW+E+V+ENGL   KL++VG WW
Sbjct  282  WKHLWKVLAEQFGIEEYGFEEGRNVGGLVEMMKGKESVWEEMVKENGLAEKKLDEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FVDVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  388



>ref|XP_008351978.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=392

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G K AW+ Y++ SDADLIAEQ+IWAAVDP AKN+AFNV+NGDVFK
Sbjct  226  YAAICKHEGMPLKFPGSKEAWNCYSDASDADLIAEQQIWAAVDPYAKNKAFNVNNGDVFK  285

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA++FE+    F+E  E  +L  +MK K  VW++IV+EN L   KL ++G WW
Sbjct  286  WKQLWKVLAEQFEIEEYGFDEEGEKLSLAELMKVKEGVWEQIVKENQLEPMKLVEIGQWW  345

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             VDL+F  E  + +MNKSKEHGFLGFRNS  +F+SWIDK+KA+KIVP
Sbjct  346  LVDLVFGGEGLMTSMNKSKEHGFLGFRNSGNSFVSWIDKLKAFKIVP  392



>ref|XP_011028990.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G ++ W+ Y+  SDADLIAEQEIWAAVDP+A+NEAFN+ NGDVFK
Sbjct  224  YAAICKHEGMPLLFPGTESVWNAYSIASDADLIAEQEIWAAVDPNAQNEAFNIHNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +      E  +  +L  +MK+KG VW++IV++N LL  KLE+VG WW
Sbjct  284  WKHLWKVLAEQFGIEKYGLPESGKKVSLTELMKDKGAVWEKIVKDNQLLPNKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +   ES +  MNKSKEHGFLGFRNS+ + ISW+DK+KA+KIVP
Sbjct  344  FADFVLGAESIISCMNKSKEHGFLGFRNSKNSLISWVDKLKAHKIVP  390



>ref|XP_010521424.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=389

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+A  SDADLIAEQ+IWAAVDP A NEAFN SNGDVFK
Sbjct  224  YAAICKHEGSPLLFPGSKTAWEGFAVSSDADLIAEQQIWAAVDPYAGNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  ++  L  MM+ K   W+EIV+EN L  TK+E+VG WW
Sbjct  284  WKHMWKVLAEQFGIEEFGFEE-GKNVGLGKMMEGKXXXWEEIVKENQLKKTKMEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS+ +FISWIDK KAYKIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSKNSFISWIDKYKAYKIVP  389



>ref|XP_009360382.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G KAAW+ Y+  SDADLIAEQ IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHEGRPLKFPGSKAAWNCYSVASDADLIAEQHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     +E     +L  +MK K  VW+EIVREN L  TKL +VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIDEGGGRLSLVELMKGKEKVWEEIVRENELQPTKLAEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD+  S E  L +MNKSKEHGFLGFRNS  +F++WIDKMKA+KIVP
Sbjct  344  FVDVWLSGEGLLCSMNKSKEHGFLGFRNSRNSFVTWIDKMKAFKIVP  390



>ref|XP_011017142.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Populus euphratica]
Length=389

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL F G ++ WD Y+  SDADLIAEQEIWAAVDP+A+NEAFN+ NGDVFK
Sbjct  223  YAAICKHERMPLLFPGTESVWDAYSIASDADLIAEQEIWAAVDPNARNEAFNIHNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +      E  +  +L  +MK+KG VW++IV++N LL  KLE+VG WW
Sbjct  283  WKHLWKVLAEQFRIKKYGLPESGKKVSLTELMKDKGAVWEKIVKDNQLLPNKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +   ES +  MNKSKEHGFLGFRNS+ + ISW+DK+KA+KIVP
Sbjct  343  FADFVLGAESIISCMNKSKEHGFLGFRNSKNSLISWVDKLKAHKIVP  389



>ref|XP_011017141.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Populus euphratica]
Length=390

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL F G ++ WD Y+  SDADLIAEQEIWAAVDP+A+NEAFN+ NGDVFK
Sbjct  224  YAAICKHERMPLLFPGTESVWDAYSIASDADLIAEQEIWAAVDPNARNEAFNIHNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +      E  +  +L  +MK+KG VW++IV++N LL  KLE+VG WW
Sbjct  284  WKHLWKVLAEQFRIKKYGLPESGKKVSLTELMKDKGAVWEKIVKDNQLLPNKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +   ES +  MNKSKEHGFLGFRNS+ + ISW+DK+KA+KIVP
Sbjct  344  FADFVLGAESIISCMNKSKEHGFLGFRNSKNSLISWVDKLKAHKIVP  390



>ref|XP_003636810.1| Progesterone 5-beta-reductase [Medicago truncatula]
Length=809

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G K AW+ Y+  SDADLIAEQ IWAAVDP AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEGVPLKFPGTKGAWESYSVASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA++F +    F+E      L  +MK+KGPVWDEIV+EN L +TK+++VG WW
Sbjct  284  WKQLWKVLAEQFGIEEYGFDEEGPRLKLSELMKDKGPVWDEIVKENQLEATKIDEVGEWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKI  205
            FVDL+F  E  +D+MNK+KEHGF+GFRN++ + ISWIDK +AYKI
Sbjct  344  FVDLMFGGEGAVDSMNKAKEHGFVGFRNTKNSLISWIDKTRAYKI  388


 Score =   209 bits (533),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE I L+F G K AW+ Y   SDADLIAEQ IWAAVD  AKNEAFN SNGDVF+
Sbjct  644  YAAICKHEHISLKFPGTKRAWESYYMASDADLIAEQHIWAAVDTYAKNEAFNCSNGDVFR  703

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVL ++FE+    +E+      L  MMK+KGPVWDEIV+EN L  TKLE+V  WW
Sbjct  704  WKQLWKVLTEQFEIEEYGYEDGPRLR-LAEMMKDKGPVWDEIVKENELQPTKLEEVAEWW  762

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D  F +E  +D+MNK+KEHGFLGFRNS+ + I+WIDK +AYKIVP
Sbjct  763  VADATFGMEDIVDSMNKAKEHGFLGFRNSKNSLINWIDKTRAYKIVP  809



>ref|XP_011022580.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=389

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+ YA  SDA+LIAE EIWA V+P AKNEAFN++NGD+FK
Sbjct  223  YAAICKHEGAPLIFPGTKEAWNSYAIASDANLIAEHEIWACVEPKAKNEAFNINNGDLFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA +F +    F E   S  L   MK+KGPVW+EIV++N LLS KLE VG WW
Sbjct  283  WKHLWTVLAQEFGIEKYGFVEGESSVTLAEKMKDKGPVWEEIVKKNQLLSNKLEQVGGWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++FS    + +MNK+KEHGFLGFRNS+K+F+SWI KM+AYK+VP
Sbjct  343  FGDMMFSGPGIVASMNKAKEHGFLGFRNSKKSFVSWIHKMRAYKVVP  389



>ref|XP_008393755.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL+F G KAAW+ Y+  SDADLIAEQ IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHEGRPLKFPGSKAAWNCYSVASDADLIAEQHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     +E     +L  +MK K  VW+EIVREN L  TKL +VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIDEGGXRLSLVELMKGKEKVWEEIVRENELQPTKLAEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD+  S E  L +MNKSKEHGFLGFRNS  +F++WIDKMKA++IVP
Sbjct  344  FVDVWLSGEGLLCSMNKSKEHGFLGFRNSRNSFVTWIDKMKAFQIVP  390



>ref|XP_009137433.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Brassica 
rapa]
Length=379

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL F G KAAW+GY   SDADL+AEQ+IWAAVDP AKNEAFN +NGDVFK
Sbjct  214  YAAICKQEGSPLLFPGSKAAWEGYTAASDADLVAEQQIWAAVDPYAKNEAFNCNNGDVFK  273

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  ++  L  MMK K  VW+E+V++N L   KLEDVG WW
Sbjct  274  WKHLWKVLAERFGIEKYGFEE-GKNVGLVKMMKGKERVWEEVVKKNQLQEKKLEDVGVWW  332

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  VE  +D+MNKSKEHGFLGFRNS+ +FISWIDK KA+KIVP
Sbjct  333  FADDVLGVEGMIDSMNKSKEHGFLGFRNSKNSFISWIDKYKAFKIVP  379



>emb|CDY10994.1| BnaA03g46530D [Brassica napus]
Length=379

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL F G KAAW+GY   SDADL+AEQ+IWAAVDP AKNEAFN +NGDVFK
Sbjct  214  YAAICKQEGSPLLFPGSKAAWEGYTAASDADLVAEQQIWAAVDPYAKNEAFNCNNGDVFK  273

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  ++  L  MMK K  VW+E+V++N L   KLEDVG WW
Sbjct  274  WKHLWKVLAERFGIEKYGFEE-GKNVGLVKMMKGKERVWEEVVKKNQLQEKKLEDVGVWW  332

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  VE  +D+MNKSKEHGFLGFRNS+ +FISWIDK KA+KIVP
Sbjct  333  FADDVLGVEGMIDSMNKSKEHGFLGFRNSKNSFISWIDKYKAFKIVP  379



>ref|XP_008220361.1| PREDICTED: uncharacterized protein LOC103320460 [Prunus mume]
Length=830

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 135/171 (79%), Gaps = 6/171 (4%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE  PL+F G KAAW+ ++  SDADLIAEQ IWAAVDP AKNEAFNV+NGDVFK
Sbjct  662  YAAICKHEKKPLKFPGSKAAWNCFSVASDADLIAEQHIWAAVDPYAKNEAFNVNNGDVFK  721

Query  519  WKHFCKVLADKFEVGVVEF----EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDV  352
            WKHF KVLA++F  G+ E+    EE     +L  MMK KG VW+EIV++N L  TKLE+V
Sbjct  722  WKHFWKVLAEQF--GIEEYGLDEEEGERRLSLVEMMKGKGGVWEEIVKKNKLQPTKLEEV  779

Query  351  GHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            G WWF D++  VES LD+MNKSKEHGFLGFRNS+K+F SW+ KMKAYKIVP
Sbjct  780  GVWWFADIVLCVESALDSMNKSKEHGFLGFRNSQKSFTSWVQKMKAYKIVP  830


 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 127/169 (75%), Gaps = 2/169 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL+F G K AW+ YA  SDADLIAEQ IWAAVDP+A NEAFN++NGDVFK
Sbjct  226  YAAICKQEGKPLKFPGSKVAWECYAMASDADLIAEQHIWAAVDPNAANEAFNINNGDVFK  285

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEV--MMKEKGPVWDEIVRENGLLSTKLEDVGH  346
            WK F K LA++F +    F E      L +  MMK K  VW+EIV+EN L  TKLE+VG 
Sbjct  286  WKQFWKGLAEQFGIEEHGFYEEEGEGRLSLVEMMKGKEGVWEEIVKENELQPTKLEEVGV  345

Query  345  WWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            WWF D +   E+ LD+MNKSKEHGFLGFRNS K+FISWI+KMK+YKIVP
Sbjct  346  WWFADYVLGGEAVLDSMNKSKEHGFLGFRNSYKSFISWIEKMKSYKIVP  394



>ref|XP_008393756.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G KAAW+ Y+  SDADLIAE  IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHEGLPLRFPGSKAAWNSYSVASDADLIAEHHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     +E      L   MK K  VW+EIVREN L  TKLE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIDEGGGRLRLAERMKGKEGVWEEIVRENELKETKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++   E  + ++NKSKEHGF+GFRNS  +F++WIDKMK++KIVP
Sbjct  344  FVDVVLGGEGLISSVNKSKEHGFVGFRNSRNSFVTWIDKMKSFKIVP  390



>gb|KJB58604.1| hypothetical protein B456_009G217600 [Gossypium raimondii]
Length=391

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 129/172 (75%), Gaps = 9/172 (5%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G KA W+ Y   SDADLIAEQ IWAAVDP A+NEAFNV+NGDVFK
Sbjct  224  YAAICKHEGKPLHFPGSKATWNCYFEASDADLIAEQHIWAAVDPYAENEAFNVANGDVFK  283

Query  519  WKHFCKVLADKF---EVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKH   VLA++F   E G VE E R     LE MMK K  VW+EIV+EN L  T L++VG
Sbjct  284  WKHLWSVLAEQFGIEEFGFVEGENRG----LEEMMKGKEGVWEEIVKENQLQKTSLQEVG  339

Query  348  HWWFVDLLFS--VESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +WWF D + S  +  PL +MNKSKEHGFLGFRNS+ +F++WIDKMKAYKIVP
Sbjct  340  NWWFTDAMLSAPLPMPLVSMNKSKEHGFLGFRNSQNSFVTWIDKMKAYKIVP  391



>ref|XP_011029002.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+GYA  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGAPLIFRGSKEAWNGYAIASDADLIAEHEIWACVDPNAQNEAFNIHNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  ++LA++F +    FEE   S      MK+K  VW+EIV++N LL  KLE VG WW
Sbjct  284  WKHLWRILAEEFGIEEYGFEEGESSITFAEAMKDKEQVWEEIVKKNQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+F     + N+NK+KEHGFLGFRNS+K+F+SW+DKMK YK+VP
Sbjct  344  FADLIFGGPGIVTNLNKTKEHGFLGFRNSKKSFVSWLDKMKDYKVVP  390



>ref|XP_002304533.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
 gb|ABK95799.1| unknown [Populus trichocarpa]
 gb|EEE79512.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
Length=389

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+ YA  SDA+LIAE EIWA V+P AKNEAFN+ NGD+FK
Sbjct  223  YAAICKHEGAPLIFPGTKEAWNSYAIASDANLIAEHEIWACVEPKAKNEAFNIHNGDIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA +F +    F E   S      MK+KGPVW+EIV++N LL+ KLE VG WW
Sbjct  283  WKHLWTVLAQEFGIEKYGFVEGESSVTFAEKMKDKGPVWEEIVKKNQLLANKLEQVGGWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+FS    + +MNK+KEHGFLGFRNS+K+F+SWI KM+AYK+VP
Sbjct  343  FGDLMFSGPGCVTSMNKAKEHGFLGFRNSKKSFVSWIHKMRAYKVVP  389



>ref|XP_008337044.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=175

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 128/166 (77%), Gaps = 5/166 (3%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL+F G KAAW+ YA  SDA+LIAEQ IWAAVDP AKNEAFNV+NGDVFK
Sbjct  10   YAAICKKEGRPLKFPGSKAAWECYAVASDANLIAEQHIWAAVDPYAKNEAFNVNNGDVFK  69

Query  519  WKHFCKVLADKFEVGVVEF---EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKHF KVLA++F  G+ E+   EE      L  MM+ K  VW+EIVREN L  TKLE+V 
Sbjct  70   WKHFWKVLAEQF--GIEEYGFDEEEGGRLRLVEMMEGKVGVWEEIVRENELQPTKLEEVA  127

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAY  211
             WWF DL+F  E+ LD+ NKSKEHGFLGFRNS+K+FISWI KMKA+
Sbjct  128  VWWFADLVFGGEAVLDSTNKSKEHGFLGFRNSKKSFISWIKKMKAF  173



>ref|XP_006847874.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
 gb|ERN09455.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
Length=389

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 130/168 (77%), Gaps = 3/168 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+P RF G KA W+G+++ SDADLIAEQ IWAAVDP AKNEAFN +NGDVF+
Sbjct  224  YAAICKHEGLPFRFPGSKAQWEGFSDASDADLIAEQHIWAAVDPHAKNEAFNCANGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   K+L ++F + +VE+E +  S  L   MKEKGPVWD IV+EN L  TKL++V  WW
Sbjct  284  WKQLWKILGEQFGLELVEYEGKGFS--LVEAMKEKGPVWDTIVKENELSETKLQEVAQWW  341

Query  339  FVDLLFSVES-PLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E   LD+MNK+KEHGFLGFRN+  +F SWIDKMKA+KIVP
Sbjct  342  FADVMLDNEGVGLDSMNKAKEHGFLGFRNTLTSFSSWIDKMKAHKIVP  389



>gb|ABK96780.1| unknown [Populus trichocarpa x Populus deltoides]
Length=390

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+GYA  SDADLIAE EIWA VDP+A+NEAFN+ NGD+FK
Sbjct  224  YAAICKHEGAPLIFRGSKEAWNGYAIASDADLIAEHEIWACVDPNAQNEAFNIHNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  ++LA++F +    FEE          MK+K PVW+EIV++N LL  KLE VG WW
Sbjct  284  WKHLWRILAEEFGIEEHGFEEGESCITFAEAMKDKEPVWEEIVKKNQLLPNKLEQVGGWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+F     + N+NK+KEHGFLGFRNS+K+F+SW+DK+K YK+VP
Sbjct  344  FADLMFGGPGVITNLNKTKEHGFLGFRNSKKSFVSWLDKIKDYKVVP  390



>gb|AHZ44508.1| putative progesterone 5 beta-reductase [Stellaria media]
Length=390

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK+EG PL F G KAAW+G+A  SDADLIAEQ IWA+VDP AKNEAFN +NGDVFK
Sbjct  225  YAAICKYEGKPLVFPGTKAAWEGFAVASDADLIAEQRIWASVDPFAKNEAFNCNNGDVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K LA++F +    FEE  ++  L+ MM  K  VW+EIVR+N L  TKL++VG WW
Sbjct  285  WKHLWKSLAEQFGIEDYGFEE-GKNVGLKTMMDGKQSVWEEIVRKNQLQETKLDEVGSWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++  VE  LD+MNKSKEHGF GFRN + +F+SWIDK KA+KIVP
Sbjct  344  FVDIILGVEGALDSMNKSKEHGFAGFRNPKNSFVSWIDKCKAFKIVP  390



>emb|CDX92623.1| BnaC07g38810D [Brassica napus]
Length=380

 Score =   215 bits (547),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL F G K AW+G+A  SDADL+AEQ+IWAAVDP AKNEAFN +NGDVFK
Sbjct  215  YAAICKQEGSPLLFPGSKEAWEGFAAASDADLVAEQQIWAAVDPCAKNEAFNCNNGDVFK  274

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA+KF +    FEE  ++  L  MMK K  VW+EIV++N L   KLEDVG WW
Sbjct  275  WKHLWKVLAEKFGIEEFGFEE-GKNVGLVKMMKGKERVWEEIVKKNQLKERKLEDVGVWW  333

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  VE  +D+MNKSKEHGFLGFRNS+ +FISWIDK KA+KIVP
Sbjct  334  FADDVLGVEGMIDSMNKSKEHGFLGFRNSKNSFISWIDKYKAFKIVP  380



>ref|XP_006489807.1| PREDICTED: uncharacterized protein LOC102610524 [Citrus sinensis]
Length=826

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AWDG+   SDADLIAEQ+IWAAVDP+A+NEAFN +NGDVFK
Sbjct  659  YAAICKHEGVPLLFPGTKEAWDGFTEVSDADLIAEQQIWAAVDPNARNEAFNCANGDVFK  718

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++FE+    F+E+ E   L  +MK K  VW+EIVR+N LL TKL +V  WW
Sbjct  719  WKHFWKVLAERFEIEDYGFDEKGERLRLVEIMKGKESVWEEIVRKNKLLPTKLNEVAIWW  778

Query  339  FVDLLFSV-ESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D+ F V E  L +MNKSKEHGFLGFRNS+ +FI+WIDKMK YKIVP
Sbjct  779  HADVSFDVGEDILVSMNKSKEHGFLGFRNSKNSFIAWIDKMKRYKIVP  826



>gb|AFD96485.1| putative enone 5-beta-reductase [Brassica oleracea var. gemmifera]
Length=382

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL F G K AW+G+A  SDADL+AEQ+IWAAVDP AKNEAFN +NGDVFK
Sbjct  217  YAAICKQEGSPLLFPGSKEAWEGFAAASDADLVAEQQIWAAVDPYAKNEAFNCNNGDVFK  276

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  ++  L  MMK K  VW+EIV++N L   KLEDVG WW
Sbjct  277  WKHLWKVLAERFGIKEFGFEE-GKNVGLVKMMKGKERVWEEIVKKNQLKDRKLEDVGVWW  335

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  VE  +D+MNKSKEHGFLGFRNS+ +FISWIDK KA+KIVP
Sbjct  336  FADDVLGVEGMIDSMNKSKEHGFLGFRNSKNSFISWIDKYKAFKIVP  382



>ref|XP_008377976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
 ref|XP_008347607.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL+F G  AAW+ Y+  SDADLIAEQ+IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHEGLPLKFPGSSAAWNCYSVASDADLIAEQQIWAAVDPHAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     +E     +L   MK K  VW+EIVREN L +T+LE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIDEGGGRLSLAERMKGKEGVWEEIVRENELQATRLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +   E+ + +MNKSKEHGF+GFRNS  +F++WIDK+K++KIVP
Sbjct  344  FVDAMLGGEAMICSMNKSKEHGFVGFRNSRNSFVTWIDKVKSFKIVP  390



>ref|XP_006387765.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
 gb|ERP46679.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
Length=388

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+ YA  SDADL+AEQEIWA V+P+A+N+AFN+ N D FK
Sbjct  221  YAAICKHEGAPLMFPGTKEAWNCYAIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFK  280

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E   L   MK+KGPVW+EIV++N L  TKLE+VG WW
Sbjct  281  WKHLWKVLAEQFGIEKYGFEEGGERETLAERMKDKGPVWEEIVKKNQLSPTKLEEVGGWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD + S ++ +  MNKSKEHGFLGFRNS K+F+ WI KM++ KI+P
Sbjct  341  FVDTMLSGDAFISCMNKSKEHGFLGFRNSTKSFVHWIGKMRSQKIIP  387



>ref|XP_008360976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G KAAW+ Y+  SDADLIAE  IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHEGLPLRFPGSKAAWNSYSVASDADLIAEHHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     +E      L   MK K  VW+EIVREN L  TKLE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIDEGGGRLRLAERMKGKEGVWEEIVRENELKETKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++   E    + NKSKEHGF+GFRNS  +F++WIDKMK++KIVP
Sbjct  344  FVDVVLGGEGLXSSXNKSKEHGFVGFRNSRNSFVTWIDKMKSFKIVP  390



>gb|AEX31542.1| putative steroid 5beta-reductase [Vitis vinifera]
Length=390

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEGIPL+F G KAAWD Y++ SDADLIAEQ+IWA VDP A+NEAFN++NGD+FK
Sbjct  224  YAAICKHEGIPLKFPGSKAAWDCYSDASDADLIAEQQIWATVDPYARNEAFNITNGDLFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F++   EFEE  E  ++  MMK+KGPVW+EIVRE  LL TKLEDV  WW
Sbjct  284  WKHLWKVLAEQFDMEYAEFEEGEEKQSMVEMMKDKGPVWEEIVREKELLPTKLEDVAQWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F+DL+   ES L+ MNKSKEHGFLGFRNS  +F+ W+ +      +P
Sbjct  344  FIDLVLGGESLLNCMNKSKEHGFLGFRNSRNSFVWWMPQEVTNSFLP  390



>gb|ADG56544.1| progesterone 5-beta-reductase [Erysimum crepidifolium]
Length=389

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  284  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>gb|ADG56542.1| progesterone 5-beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  284  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>ref|XP_009354120.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA ICKHEG+PL+F G  AAW+ Y+  SDADLIAEQ+IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YATICKHEGLPLKFPGSSAAWNCYSVASDADLIAEQQIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKHF KVLA++F +     EE     +L   MK K  VW+EIVREN L +T+LE+VG WW
Sbjct  284  WKHFWKVLAEQFGIEEYGIEEGGGRLSLAERMKGKEGVWEEIVRENELQATRLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +   ES + +MNKSKEHGF+GFRNS  +F++WIDKMK++KIVP
Sbjct  344  FVDAMLGGESMICSMNKSKEHGFVGFRNSRNSFVTWIDKMKSFKIVP  390



>ref|XP_006471792.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
Length=396

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ+IWAAVDP A+NEAFN SNGDVFK
Sbjct  229  YAAICKHEGVPLLFPGSKDCWEGYSVASDADLIAEQQIWAAVDPYARNEAFNCSNGDVFK  288

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      E  +   LE +MK K  VW+EIVREN L   KL +V  WW
Sbjct  289  WKHLWKVLAEQFEIANYGLPEEGDRVRLEEIMKGKEGVWEEIVRENQLQPAKLSEVAVWW  348

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+       LD+MNKSKEHGFLGFRNS+ +F++WIDKMK Y+IVP
Sbjct  349  FADLMLDGGFLLLDSMNKSKEHGFLGFRNSKNSFVNWIDKMKTYRIVP  396



>ref|XP_006471790.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471791.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=397

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ+IWAAVDP A+NEAFN SNGDVFK
Sbjct  230  YAAICKHEGVPLLFPGSKDCWEGYSVASDADLIAEQQIWAAVDPYARNEAFNCSNGDVFK  289

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      E  +   LE +MK K  VW+EIVREN L   KL +V  WW
Sbjct  290  WKHLWKVLAEQFEIANYGLPEEGDRVRLEEIMKGKEGVWEEIVRENQLQPAKLSEVAVWW  349

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+       LD+MNKSKEHGFLGFRNS+ +F++WIDKMK Y+IVP
Sbjct  350  FADLMLDGGFLLLDSMNKSKEHGFLGFRNSKNSFVNWIDKMKTYRIVP  397



>ref|XP_006433107.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
 gb|ESR46347.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
Length=397

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ+IWAAVDP A+NEAFN SNGDVFK
Sbjct  230  YAAICKHEGVPLLFPGSKDCWEGYSVASDADLIAEQQIWAAVDPYARNEAFNCSNGDVFK  289

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      E  +   LE +MK K  VW+EIVREN L   KL +V  WW
Sbjct  290  WKHLWKVLAEQFEIANYGLPEEGDRVRLEEIMKGKEGVWEEIVRENQLQPAKLSEVAVWW  349

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+       LD+MNKSKEHGFLGFRNS+ +F++WIDKMK Y+IVP
Sbjct  350  FADLMLDGGFLLLDSMNKSKEHGFLGFRNSKNSFVNWIDKMKTYRIVP  397



>ref|XP_006283899.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
 gb|EOA16797.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
Length=388

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLMFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLME-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVMLGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  388



>gb|AEZ01593.1| progesterone 5-beta-reductase [Erysimum odoratum]
Length=389

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  284  WKHLWKILAEQFGIEQYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>ref|XP_009406008.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Musa 
acuminata subsp. malaccensis]
Length=406

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAIC+ EG PL++ G + AWDG+++ SDADLIAE +IWAAVDP AKNEAFN SNGDVFK
Sbjct  239  YAAICRKEGAPLKWFGSRTAWDGFSDASDADLIAEHQIWAAVDPYAKNEAFNCSNGDVFK  298

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LAD+F +  V +E       LE  M+EK  VW+EIV EN L+ TKLE+VG WW
Sbjct  299  WKHLWALLADQFGLESVGYEGEEGRFKLEDAMREKELVWNEIVAENELVPTKLEEVGTWW  358

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  VE P LD+MNKSKEHGFLGFRN+  +F SWIDKMKA++IVP
Sbjct  359  FADAILGVEMPQLDSMNKSKEHGFLGFRNTLTSFNSWIDKMKAFRIVP  406



>gb|ADG56545.1| progesterone 5-beta-reductase [Erysimum rhaeticum]
Length=389

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  284  WKHLWKILAEQFGIEQYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>dbj|BAH57049.1| AT4G24220 [Arabidopsis thaliana]
Length=351

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  186  YAAICKHEGSPLLFPGSKKAWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  245

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  246  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  304

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  305  FADVILGVEGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  351



>gb|AIA58905.1| putative progesterone 5-beta-reductase [Malcolmia maritima]
Length=388

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  388



>ref|XP_006374843.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
 gb|ERP52640.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
Length=388

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+ YA  SDADL+AEQEIWA V+P+A+N+AFN+ N D FK
Sbjct  221  YAAICKHEGAPLMFPGTKEAWNCYAIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFK  280

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  +   L   MK+KGPVW+EIV++N L  TKLE+VG WW
Sbjct  281  WKHLWKVLAEQFGIEKYGFEEGGKRATLAERMKDKGPVWEEIVKKNQLSPTKLEEVGGWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD + S ++ +  MNKSKEHGFLGFRNS K+F+ WI KM++ KI+P
Sbjct  341  FVDTMLSGDAFISCMNKSKEHGFLGFRNSTKSFVHWIGKMRSQKIIP  387



>gb|ADG56543.1| progesterone 5-beta-reductase [Erysimum x marshallii]
Length=389

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  284  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>ref|XP_002869731.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45990.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  V+  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVILGVDGLIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  388



>ref|XP_008372977.1| PREDICTED: uncharacterized protein LOC103436331 [Malus domestica]
Length=643

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 133/170 (78%), Gaps = 5/170 (3%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL+F G KAAW+ YA  SDA+LIAEQ IWAAVDP AKNEAFNV+NGDVFK
Sbjct  476  YAAICKKEGRPLKFPGRKAAWECYAVASDANLIAEQHIWAAVDPYAKNEAFNVNNGDVFK  535

Query  519  WKHFCKVLADKFEVGVVEFE-ERSESNNLEV--MMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKHF +VLA++F  G+ E+  ++ ES  L +  MM+ K  VW+EIVREN L  TKLE+V 
Sbjct  536  WKHFWEVLAEQF--GIEEYGFDKEESGRLRLVEMMEGKVGVWEEIVRENELQPTKLEEVA  593

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             WWF D +   E+  D+MNKSKEHGFLGFRNS+K+FISWI KMKAYKIVP
Sbjct  594  VWWFADFVLGGEALSDSMNKSKEHGFLGFRNSKKSFISWIKKMKAYKIVP  643



>gb|AGT29342.1| putative progesterone 5-beta reductase [Barbarea vulgaris]
Length=388

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADL+AEQ+IWA VDP AKNEAFN SN D+FK
Sbjct  223  YAAICKHEGSPLLFPGSKNAWEGFTTASDADLVAEQQIWAVVDPYAKNEAFNCSNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      +E MMK K  VW+E+V+EN L    LE+VG WW
Sbjct  283  WKHLWKVLAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQERNLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADIILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  388



>gb|KJB29426.1| hypothetical protein B456_005G100200 [Gossypium raimondii]
Length=394

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 130/170 (76%), Gaps = 4/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK+EG PL F G K  W+ Y+  SDADLIAE +IWAAVDP AKNEAFNV+NGD+FK
Sbjct  226  YAAICKYEGKPLLFPGNKVTWESYSEVSDADLIAEHQIWAAVDPYAKNEAFNVNNGDIFK  285

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +     EE  ++  L+ MMK K  VW++IV E GL  T+LE+VG WW
Sbjct  286  WKHLWKVLAEQFGIEKYGLEE-GKNVGLKEMMKGKESVWEKIVNEKGLQKTRLEEVGFWW  344

Query  339  FVDLLFS---VESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD+L S   +ESP+  MNKSKEHGFLGFRNS+ + I+WIDKMKA+KIVP
Sbjct  345  FVDILLSMMPMESPILCMNKSKEHGFLGFRNSKSSLITWIDKMKAFKIVP  394



>ref|XP_006387764.1| hypothetical protein POPTR_0602s00200g [Populus trichocarpa]
 gb|ERP46678.1| hypothetical protein POPTR_0602s00200g [Populus trichocarpa]
Length=446

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+ YA  SDADL+AEQEIWA V+P+A+N+AFN+ N D FK
Sbjct  279  YAAICKHEGAPLMFPGTKEAWNCYAIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFK  338

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  +   L   MK+KGPVW+EIV++N L  TKLE+VG WW
Sbjct  339  WKHLWKVLAEQFGIEKYGFEEGGKRATLAERMKDKGPVWEEIVKKNQLFPTKLEEVGGWW  398

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +VD + S ++ +  MNKSKEHGFLGFRNS K+F+ WI KM++ K++P
Sbjct  399  YVDTMLSGDAFISCMNKSKEHGFLGFRNSTKSFVHWIGKMRSQKVIP  445



>gb|AHI88614.1| putative progesterone 5-beta-reductase [Hesperis matronalis]
Length=388

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKH   PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHRRSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  283  WKHLWKVLAEQFGIEEYGFEEGKNLGLVE-MMKGKDRVWEEMVKENQLQEMKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KAYKIVP
Sbjct  342  FADVILGVEGMIDSMNKSKEHGFLGFRNSTNSFISWIDKYKAYKIVP  388



>gb|KJB32255.1| hypothetical protein B456_005G233200 [Gossypium raimondii]
Length=393

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PLRF G + AW+GY + SDADLIAE +IWAA+   AKNEAFN SNGDVFK
Sbjct  226  YAAICKHEGEPLRFPGNRQAWEGYWDASDADLIAEHQIWAAMSRRAKNEAFNCSNGDVFK  285

Query  519  WKHFCKVLADKFEVGVVEFEERSES-NNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHW  343
            WK   KVLAD+F +    F+E  E   +L  MMK+KGPVWD IVRENGLL  KL + G W
Sbjct  286  WKDLWKVLADQFGIEHYGFQETEEKVPSLVEMMKDKGPVWDNIVRENGLLPMKLSNAGAW  345

Query  342  WFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             FVD + S +S LD+MNKSKEHGF+GFRNS+ +F SWI KMK + IVP
Sbjct  346  QFVDSVLSGKSLLDSMNKSKEHGFVGFRNSKTSFNSWIKKMKTHNIVP  393



>gb|KDO53351.1| hypothetical protein CISIN_1g045430mg, partial [Citrus sinensis]
Length=309

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ IWAAVDP A+NEAFN SNGDVFK
Sbjct  142  YAAICKHEGVPLLFPGSKDCWEGYSVASDADLIAEQHIWAAVDPYARNEAFNCSNGDVFK  201

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      +  E   LE +M+ K  VW++IV+EN L  TKL +V  WW
Sbjct  202  WKHLWKVLAEQFEIENYGLPQDGERVRLEEIMRGKEGVWEQIVKENQLQLTKLSEVAVWW  261

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++       LD+MNKSKEHGFLGFRNS+ +F++WIDKMK Y+IVP
Sbjct  262  FADMMLDGGFLLLDSMNKSKEHGFLGFRNSKNSFVNWIDKMKTYRIVP  309



>ref|XP_008220298.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Prunus mume]
 ref|XP_008220299.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Prunus mume]
 ref|XP_008220300.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Prunus mume]
Length=391

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL+F G KAAW+ Y+  SDADLIAEQ IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHERVPLKFPGSKAAWNCYSVASDADLIAEQHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEF---EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKH  KVLA++F  G+ E+   EE     +L  +MK K  VW+EIV+EN L  T+LE+VG
Sbjct  284  WKHVWKVLAEQF--GIEEYGIDEEEGAKLSLVELMKGKERVWEEIVKENQLQPTRLEEVG  341

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             WWFVD+    E  L +MNKSKEHGF+GFRNS  +F++WIDKMKA+KIVP
Sbjct  342  VWWFVDVWLGGEGLLCSMNKSKEHGFVGFRNSRNSFVTWIDKMKAFKIVP  391



>ref|NP_001078438.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84869.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=387

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  222  YAAICKHEGSPLLFPGSKKAWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  282  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  341  FADVILGVEGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  387



>ref|NP_194153.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 sp|Q9STX2.1|VEP1_ARATH RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR; 
AltName: Full=Protein VEIN PATTERNING 1 [Arabidopsis thaliana]
 emb|CAB45057.1| putative protein [Arabidopsis thaliana]
 emb|CAB79332.1| putative protein [Arabidopsis thaliana]
 gb|AAL32529.1| putative protein [Arabidopsis thaliana]
 gb|AAM64873.1| induced upon wounding stress [Arabidopsis thaliana]
 gb|AAP37838.1| At4g24220 [Arabidopsis thaliana]
 gb|ABU55811.1| progesterone 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84868.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=388

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLLFPGSKKAWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVILGVEGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  388



>gb|AEZ01594.1| progesterone 5-beta-reductase [Erysimum cheiri]
Length=389

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDSYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  284  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS K+FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNKSFISWIDKYKAFKIVP  389



>gb|KDO81569.1| hypothetical protein CISIN_1g0159921mg, partial [Citrus sinensis]
Length=384

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 11/176 (6%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPLRF G KAAW+ Y+  SDADLIAE +IWAAVDP AKNEAFN +NGDVFK
Sbjct  211  YAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAEHQIWAAVDPYAKNEAFNCNNGDVFK  270

Query  519  WKHFCKVLADKFEVGVVEF---------EERSESNNLEVMMKEKGPVWDEIVRENGLLST  367
            WKH  KVLA++F  G+ ++            ++   L   MK K  VW+EIVREN L  T
Sbjct  271  WKHLWKVLAEQF--GIEDYGLSEEEEEGGGGTQRVKLAEFMKGKEGVWEEIVRENQLQPT  328

Query  366  KLEDVGHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +L++VG WWFVDL+ + E+ L +MNKSKEHGF GFRNS+ +FI+WIDK+K +KIVP
Sbjct  329  RLDEVGAWWFVDLVLTGEAKLASMNKSKEHGFSGFRNSKNSFITWIDKVKGFKIVP  384



>emb|CDY03474.1| BnaC01g16080D [Brassica napus]
Length=389

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G++  SDADLIAEQ+IWAAVDP AKNEAFN +N DVFK
Sbjct  224  YAAICKHEGTKLSFPGSKKAWEGFSTASDADLIAEQQIWAAVDPYAKNEAFNCNNDDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL +VG WW
Sbjct  284  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKESVWEEMVKENQLQEKKLGEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FVDVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>gb|AEX31541.1| putative steroid 5beta-reductase [Armoracia rusticana]
Length=388

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGLPLLFPGSKNAWEGFTAASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K LA++F +    FEE      +E MMK K  VW+E+V+EN L  TKLE+VG WW
Sbjct  283  WKHLWKFLAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQGTKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKE+GFLGFRNS  +FISWIDK +A+KIVP
Sbjct  342  FADVIHGVEGLIDSMNKSKEYGFLGFRNSNNSFISWIDKYEAFKIVP  388



>gb|AGM16376.1| putative progesterone 5-beta-reductase [Cakile maritima]
Length=389

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G++  SDADLIAEQ+IWAAVDP AK EAFN +N D+FK
Sbjct  224  YAAICKHEGSKLVFPGSKKAWEGFSTASDADLIAEQQIWAAVDPYAKKEAFNCNNDDIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      +E MM+ K  VW+E+V+ENGL   KL++VG WW
Sbjct  284  WKHLWKVLAEQFGIEEYGFEEGKNVGLVE-MMRGKESVWEEMVKENGLQEKKLDEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FVDVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>ref|XP_007223026.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
 gb|EMJ24225.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
Length=391

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 5/170 (3%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE +PL+F G KAAW+ Y+  SDADLIAEQ IWAAVDP AKNEAFN++NGDVFK
Sbjct  224  YAAICKHERVPLKFPGSKAAWNCYSVASDADLIAEQHIWAAVDPYAKNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEF---EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WKHF KVLA++F  G+ E+   EE     +L  +MK K  VW+EIV+EN L  T+LE+VG
Sbjct  284  WKHFWKVLAEQF--GIEEYGIDEEEGAKLSLVELMKGKERVWEEIVKENQLQPTRLEEVG  341

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             WWFVD     E  L +MNKSKEHGF+GFRNS  +F++WIDK KA+KIVP
Sbjct  342  VWWFVDAWLGGEGLLCSMNKSKEHGFVGFRNSRNSFVTWIDKTKAFKIVP  391



>ref|XP_010448593.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Camelina 
sativa]
Length=388

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLMFPGSKKAWEGFMTASDADLIAEQQIWAAVDDYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN LL  KL++VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLLEKKLDEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  388



>gb|AFZ41789.1| putative progesterone 5-beta-reductase [Raphanus sativus]
Length=390

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G+A  SDADL+AEQ+IWAAVDP AKNEAFN SN DVFK
Sbjct  225  YAAICKHEGSKLVFPGRKEAWEGFATASDADLVAEQQIWAAVDPYAKNEAFNCSNADVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGLWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F DL+  V+  LD+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADLVLGVDGMLDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  390



>gb|KDO81567.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=397

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 11/176 (6%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPLRF G KAAW+ Y+  SDADLIAE +IWAAVDP AKNEAFN +NGDVFK
Sbjct  224  YAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAEHQIWAAVDPYAKNEAFNCNNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEF---------EERSESNNLEVMMKEKGPVWDEIVRENGLLST  367
            WKH  KVLA++F  G+ ++            ++   L   MK K  VW+EIVREN L  T
Sbjct  284  WKHLWKVLAEQF--GIEDYGLSEEEEEGGGGTQRVKLAEFMKGKEGVWEEIVRENQLQPT  341

Query  366  KLEDVGHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +L++VG WWFVDL+ + E+ L +MNKSKEHGF GFRNS+ +FI+WIDK+K +KIVP
Sbjct  342  RLDEVGAWWFVDLVLTGEAKLASMNKSKEHGFSGFRNSKNSFITWIDKVKGFKIVP  397



>ref|XP_003638458.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35788.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09149.1| progesterone 5-beta-reductase 1 [Medicago truncatula]
Length=389

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE I L+F G K AW+ Y   SDADLIAEQ IWAAVD  AKNEAFN SNGDVF+
Sbjct  224  YAAICKHEHISLKFPGTKRAWESYYMASDADLIAEQHIWAAVDTYAKNEAFNCSNGDVFR  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVL ++FE+    +E+      L  MMK+KGPVWDEIV+EN L  TKLE+V  WW
Sbjct  284  WKQLWKVLTEQFEIEEYGYEDGPRLR-LAEMMKDKGPVWDEIVKENELQPTKLEEVAEWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D  F +E  +D+MNK+KEHGFLGFRNS+ + I+WIDK +AYKIVP
Sbjct  343  VADATFGMEDIVDSMNKAKEHGFLGFRNSKNSLINWIDKTRAYKIVP  389



>gb|AEO36948.1| progesterone 5beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHE  PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHERSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  284  WKHLWKILAEQFGIDQYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>gb|KDO81568.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=396

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 11/176 (6%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPLRF G KAAW+ Y+  SDADLIAE +IWAAVDP AKNEAFN +NGDVFK
Sbjct  223  YAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAEHQIWAAVDPYAKNEAFNCNNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEF---------EERSESNNLEVMMKEKGPVWDEIVRENGLLST  367
            WKH  KVLA++F  G+ ++            ++   L   MK K  VW+EIVREN L  T
Sbjct  283  WKHLWKVLAEQF--GIEDYGLSEEEEEGGGGTQRVKLAEFMKGKEGVWEEIVRENQLQPT  340

Query  366  KLEDVGHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +L++VG WWFVDL+ + E+ L +MNKSKEHGF GFRNS+ +FI+WIDK+K +KIVP
Sbjct  341  RLDEVGAWWFVDLVLTGEAKLASMNKSKEHGFSGFRNSKNSFITWIDKVKGFKIVP  396



>ref|XP_006433602.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
 gb|ESR46842.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
Length=400

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 130/179 (73%), Gaps = 14/179 (8%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPLRF G KAAW+ Y+  SDADLIAE +IWAAVDP AKNEAFN +NGDVFK
Sbjct  224  YAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAEHQIWAAVDPYAKNEAFNCNNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEF------------EERSESNNLEVMMKEKGPVWDEIVRENGL  376
            WKH  KVLA++F  G+ ++               ++   L   MK K  VW+EIVREN L
Sbjct  284  WKHLWKVLAEQF--GIEDYGLSEEEEEEEEGGGGTQRVKLAEFMKGKEGVWEEIVRENQL  341

Query  375  LSTKLEDVGHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              T+L++VG WWFVDL+ + E+ L +MNKSKEHGF GFRNS+ +FI+WIDK K YKIVP
Sbjct  342  QPTRLDEVGAWWFVDLVLTGEAKLASMNKSKEHGFSGFRNSKNSFITWIDKAKGYKIVP  400



>ref|XP_010530504.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=388

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G    SDADLIAEQ+IW AVD  AKNEAFN +NGDVFK
Sbjct  223  YAAICKHEGSPLLFPGSKVAWEGLTVSSDADLIAEQQIWTAVDRYAKNEAFNCNNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K LA++F +    F+E  ++  L  MMK K  +W EIV+EN L  T+LE+VG WW
Sbjct  283  WKHLWKDLAEQFGIEEYGFKE-GKNVGLVKMMKGKEALWQEIVKENQLQKTRLEEVGTWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD++  V+  +D+MNKSKEHGFLGFRNS+ +FISW+DK KAYKIVP
Sbjct  342  FVDMMLGVQGMIDSMNKSKEHGFLGFRNSKNSFISWVDKYKAYKIVP  388



>ref|XP_006471787.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=399

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ+IWAAVDP A+NEAFN SNGDVFK
Sbjct  232  YAAICKHEGVPLLFPGSKDCWEGYSVASDADLIAEQQIWAAVDPYARNEAFNCSNGDVFK  291

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      +  E   LE +M+ K  VW++IV+EN L  TKL +V  WW
Sbjct  292  WKHLWKVLAEQFEIENYGLPQEGERVRLEEIMRGKEGVWEQIVKENQLQLTKLSEVAVWW  351

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++       LD+MNKSKEHGFLGFRNS+ +F++WIDKMK Y+IVP
Sbjct  352  FADMMLDGGFLLLDSMNKSKEHGFLGFRNSKNSFVNWIDKMKTYRIVP  399



>gb|KHG08322.1| Uncharacterized protein F383_14595 [Gossypium arboreum]
Length=393

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PLRF G + AW+GY + SDADLIAE +IWAA+   AKNEAFN SNGDVFK
Sbjct  226  YAAICKHEGEPLRFPGNRQAWEGYWDASDADLIAEHQIWAAMSRRAKNEAFNCSNGDVFK  285

Query  519  WKHFCKVLADKFEVGVVEFEERSES-NNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHW  343
            WK   KVLAD+F +    F+E  E   +L  MMK+KGPVWD IVREN LL  KL D G W
Sbjct  286  WKDLWKVLADQFGIEHYGFQETEEKVPSLVEMMKDKGPVWDNIVRENDLLPMKLNDAGAW  345

Query  342  WFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             FVD + S +S LD+MNKSKEHGF+GFRNS+ +F SWI KMK + IVP
Sbjct  346  QFVDSVLSGKSLLDSMNKSKEHGFVGFRNSKTSFNSWIKKMKTHNIVP  393



>ref|XP_006433101.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
 gb|ESR46341.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
Length=399

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ+IWAAVDP A+NEAFN SNGDVFK
Sbjct  232  YAAICKHEGVPLLFPGSKDCWEGYSVASDADLIAEQQIWAAVDPYARNEAFNCSNGDVFK  291

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      +  E   LE +M+ K  VW++IV+EN L  TKL +V  WW
Sbjct  292  WKHLWKVLAEQFEIENYGLPQEGERVRLEEIMRGKEGVWEQIVKENQLQLTKLSEVAVWW  351

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++       LD+MNKSKEHGFLGFRNS+ +F++WIDKMK Y+IVP
Sbjct  352  FADMMLDGGFLLLDSMNKSKEHGFLGFRNSKNSFVNWIDKMKTYRIVP  399



>gb|AFN22088.1| putative progesterone 5-beta-reductase [Draba aizoides]
Length=389

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADL+AEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLVFPGSKKAWEGFTTASDADLVAEQQIWAAVDSYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  284  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKEKVWEEMVKENQLQERKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D +  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADFILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>gb|ABK96579.1| unknown [Populus trichocarpa x Populus deltoides]
Length=388

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKH G PL F G K AW+ YA  SDADL+AEQEIWA V+P+A+N+AFN+ N D FK
Sbjct  221  YAAICKHVGAPLMFPGTKEAWNCYAIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFK  280

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  +   L   MK+KGPVW+EIV++N L  TKLE+VG WW
Sbjct  281  WKHLWKVLAEQFGIEKYGFEEGGKRATLAERMKDKGPVWEEIVKKNQLFPTKLEEVGGWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            +VD + S ++ +  MNKSKEHGFLGFRNS K+F+ WI KM++ K++P
Sbjct  341  YVDTMLSGDAFISCMNKSKEHGFLGFRNSTKSFVHWIGKMRSQKVIP  387



>gb|AEO36945.1| progesterone 5beta-reductase [Erysimum albescens]
Length=390

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  225  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDQYAKNEAFNCNNADIFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  390



>gb|AEO36946.1| progesterone 5beta-reductase [Erysimum scoparium]
Length=390

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  225  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDQYAKNEAFNCNNADIFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  390



>ref|XP_006472269.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=397

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 129/174 (74%), Gaps = 7/174 (4%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPLRF G KAAW+ Y+  SDADLIAE +IWAAVDP AKNEAFN +NGDVFK
Sbjct  224  YAAVCKHEGIPLRFPGTKAAWECYSIASDADLIAEHQIWAAVDPYAKNEAFNCNNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEER-------SESNNLEVMMKEKGPVWDEIVRENGLLSTKL  361
            WKH  KVLA++F +      E        ++   L   MK K  VW+EIVREN L  T+L
Sbjct  284  WKHLWKVLAEQFGIEDYGLSEEEEECGGGTQRVKLAEFMKGKEGVWEEIVRENQLQPTRL  343

Query  360  EDVGHWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            ++VG WWFVDL+ + E+ L +MNKSKEHGF GFRNS+ +FI+WIDK+K +KIVP
Sbjct  344  DEVGAWWFVDLVLTGEAKLASMNKSKEHGFSGFRNSKNSFITWIDKVKGFKIVP  397



>gb|AEO36947.1| progesterone 5beta-reductase [Erysimum caboverdeanum]
Length=390

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  225  YAAICKHEGSPLLFPGSKKAWEGFTTASDADLIAEQQIWAAVDQYAKNEAFNCNNADIFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  390



>gb|AGT29341.1| putative progesterone 5-beta reductase [Cardamine pratensis]
Length=388

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G KAAW+G+   SDADL+AEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLFFPGSKAAWEGFTAASDADLVAEQQIWAAVDQYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  283  WKHLWKFLAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVILGVEGMIDSMNKSKEHGFLGFRNSNSSFISWIDKYKAFKIVP  388



>gb|AHZ44507.1| putative progesterone 5 beta-reductase [Isatis tinctoria]
Length=390

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  225  YAAICKHEGSKLVFPGSKKAWEGFTAASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKERVWEEMVKENQLQENKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  390



>ref|XP_004299763.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=390

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+ LRF G KAAW+  +  SDADLIAEQ IWAAVDP A+NEAFN++NGDVFK
Sbjct  224  YAAICKHEGVLLRFPGTKAAWNCLSTASDADLIAEQHIWAAVDPYARNEAFNINNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK F KVLA+ F +    FEE  E   L+ +M+ K  VW+EIV+EN L+ TKLE+VG WW
Sbjct  284  WKQFWKVLAENFGIEEFGFEEEGEVVGLQKLMEGKSGVWEEIVKENQLVPTKLEEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD + S ES    MNKSKEHGF+GFRNS  + ++WIDKMKAYKIVP
Sbjct  344  FVDAVLSGESMFGCMNKSKEHGFVGFRNSRNSLVTWIDKMKAYKIVP  390



>gb|AHZ44505.1| putative progesterone 5 beta-reductase [Erophila verna]
Length=387

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADL+AEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  222  YAAICKHEGSPLVFPGSKKAWEGFTTASDADLVAEQQIWAAVDSYAKNEAFNCNNADIFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F++    F E  ++  L  MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  282  WKHLWKILAEQFDIKEYGFVE-GKNLGLVKMMKGKEKVWEEMVKENQLQEEKLEEVGVWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  341  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  387



>ref|XP_006433601.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
 gb|ESR46841.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
Length=390

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEGIPL F G K  W+G++  SDADLIAEQ+IWAAVDP A+NEAFN SNGDVFK
Sbjct  223  YAAICKHEGIPLLFPGTKDCWEGFSVASDADLIAEQQIWAAVDPCARNEAFNCSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E+  LE ++K K  VW+EIV+EN L  TKL +V   W
Sbjct  283  WKHLWKVLAERFGIEKYGFEEGGETVRLEEILKVKESVWEEIVKENQLRPTKLNEVAAGW  342

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D+ F + +  L +MNKSKEHGFLGFRNS K+F +WID++K YKIVP
Sbjct  343  IADVTFDIGAGMLVSMNKSKEHGFLGFRNSNKSFATWIDRLKHYKIVP  390



>gb|KDO53786.1| hypothetical protein CISIN_1g030297mg [Citrus sinensis]
Length=179

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K  W+G++  SDADLIAEQEIWAAVDP+A+NEAFN +NGDVFK
Sbjct  10   YAAICKHEGFPLLFPGTKETWEGFSEYSDADLIAEQEIWAAVDPNARNEAFNCTNGDVFK  69

Query  519  WKHFCKVLADKFEVGVVEF--EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGH  346
            WKH  KVLA++FE+    F  E+ SE   LE +MK K  VW+EIVREN L  TKL +V  
Sbjct  70   WKHLWKVLAEQFEIENYGFGDEKGSERVRLEEIMKGKESVWEEIVRENQLQPTKLNEVAV  129

Query  345  WWFVDLLFSVESPLD-NMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            W + D++ +V +    +MNKSKEHGFLGFRNS+ +F++WI ++K+++IVP
Sbjct  130  WSYADMVMNVGAGYSVSMNKSKEHGFLGFRNSKNSFVAWIGRLKSHRIVP  179



>gb|AFZ42258.1| putative progesterone 5-beta-reductase [Nasturtium officinale]
Length=388

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G++  SDADLIAEQ+IWAAVD  AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLLFPGSKNAWEGFSAASDADLIAEQQIWAAVDEYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      +E  MK K  VW+EIV+EN L  TKL +VG WW
Sbjct  283  WKHLWKVLAEQFGIEEYGFEEGKNLGLVET-MKGKERVWEEIVKENQLQETKLVEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  V+  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  342  FADVILGVDGMIDSMNKSKEHGFLGFRNSNSSFISWIDKYKAFKIVP  388



>ref|XP_006413460.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
 gb|ESQ54913.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
Length=390

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  225  YAAICKHEGSKLVFPGSKKAWEGFTAASDADLVAEQQIWAAVDPYAKNEAFNCNNADMFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKVLAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVILGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  390



>ref|XP_006284965.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
 gb|EOA17863.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
Length=388

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLMFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D+   VE  +D+MNKSKEHGFLGFRNS  +F  WIDK KA++IVP
Sbjct  342  FADVALGVEGVIDSMNKSKEHGFLGFRNSNNSFTYWIDKYKAFRIVP  388



>ref|XP_004501803.1| PREDICTED: uncharacterized protein LOC101510608 [Cicer arietinum]
Length=805

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K AW+ Y   SDADLIAEQ IWAAVDP AKNEAFN SNGDVFK
Sbjct  224  YAAICKHEGVPLRFPGTKLAWENYYMASDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA++F +    +EE      L  +MK+KGPVWDEIV+ N L  TKLE+V  WW
Sbjct  284  WKQLWKVLAEQFGIEEYGYEEGPRL-KLSELMKDKGPVWDEIVKVNQLQPTKLEEVAEWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D+        D MNKSKEHGFLGFRN++ + I+WIDK +AYKIVP
Sbjct  343  FADVSLGGNGFTDTMNKSKEHGFLGFRNTKNSLINWIDKTRAYKIVP  389


 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G K  W+ Y   SDADLIAEQ IWAAVDP AKNEAFN SNGDVF+
Sbjct  640  YAAICKHEGVPLRFPGTKEVWEDYYVVSDADLIAEQHIWAAVDPYAKNEAFNCSNGDVFR  699

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA++F +    +EE      L  +MK+KGPVWDEIV+ N L +T +++VG+WW
Sbjct  700  WKQLWKVLAEQFGIEEYGYEEGPRL-KLSELMKDKGPVWDEIVKLNKLEATNIDEVGNWW  758

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D  F     +D+MNK+KEHGF GFRN++ + I+WID+ +A+KIVP
Sbjct  759  FADFTFGGIRIVDSMNKAKEHGFFGFRNTKNSLITWIDRTRAFKIVP  805



>ref|XP_006472267.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
Length=390

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPL F G K  W+G++  SDADLIAEQ+IWA VDP A+NEAFN SNGDVFK
Sbjct  223  YAALCKHEGIPLLFPGTKDCWEGFSVASDADLIAEQQIWAVVDPRARNEAFNCSNGDVFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E+  LE ++K K  VW+EIV+EN L  TKL +V  WW
Sbjct  283  WKHLWKVLAERFGIEKYGFEEGGETVRLEEILKGKESVWEEIVKENQLRPTKLNEVAAWW  342

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D+ F + +  L +MNKSKE+GFLGFR+S K+F +WID++K YKIVP
Sbjct  343  IADVTFDIGAGMLVSMNKSKEYGFLGFRDSNKSFATWIDRLKHYKIVP  390



>ref|XP_010099073.1| hypothetical protein L484_011507 [Morus notabilis]
 gb|EXB76662.1| hypothetical protein L484_011507 [Morus notabilis]
Length=332

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+ LR  G +   + Y + SDADLIAE +IWAAVD  AKNEAFN SNGDVFK
Sbjct  166  YAAICKHEGLKLRIPGTREGREAYWDVSDADLIAEHQIWAAVDTYAKNEAFNCSNGDVFK  225

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+   EFE+  +S  L  MMK+KG VWD+IV+ENGL+ T LE+VG++W
Sbjct  226  WKHMWKVLAEQFELEDEEFEDDGDSLTLVEMMKDKGEVWDQIVKENGLVPTNLEEVGNFW  285

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              DL+ ++ + LD+MNKSKE+GFLGFRNS+ +FISWI+KMK+YKIVP
Sbjct  286  LADLVLTLGTTLDSMNKSKEYGFLGFRNSKSSFISWINKMKSYKIVP  332



>ref|XP_009109253.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY24831.1| BnaA08g14790D [Brassica napus]
Length=390

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN SN DVFK
Sbjct  225  YAAICKHEGSKLVFPGSKEAWEGFTTASDADLVAEQQIWAAVDPYAKNEAFNCSNADVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKESVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  V+  +D+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVVLGVDGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  390



>ref|XP_006472268.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=389

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+CKHEGIPL F G K  W+G++  SDADLIAEQ+IWA VDP A+NEAFN SNGDVFK
Sbjct  222  YAALCKHEGIPLLFPGTKDCWEGFSVASDADLIAEQQIWAVVDPRARNEAFNCSNGDVFK  281

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E+  LE ++K K  VW+EIV+EN L  TKL +V  WW
Sbjct  282  WKHLWKVLAERFGIEKYGFEEGGETVRLEEILKGKESVWEEIVKENQLRPTKLNEVAAWW  341

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
              D+ F + +  L +MNKSKE+GFLGFR+S K+F +WID++K YKIVP
Sbjct  342  IADVTFDIGAGMLVSMNKSKEYGFLGFRDSNKSFATWIDRLKHYKIVP  389



>ref|XP_007223050.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
 gb|EMJ24249.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
Length=389

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PLRF G KA WD Y+  SDADLIAEQ+IWAAVDP AKNEAFN++NGDVF+
Sbjct  226  YAAICKHEGLPLRFPGSKAGWDSYSEASDADLIAEQQIWAAVDPYAKNEAFNINNGDVFR  285

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   KVLA++FE+    F+   E  +L  MM++KG VW+EIV EN L   KLE+VG W 
Sbjct  286  WKQLWKVLAEEFEIEEYGFD---EGFSLVEMMRDKGGVWEEIVGENQLRHAKLEEVGLWE  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             V+++    + L +MNK+KEHGF GFRN+  +F+ WIDKMKA+KIVP
Sbjct  343  VVEVVLGGGAELSSMNKNKEHGFCGFRNTRNSFVYWIDKMKAHKIVP  389



>ref|XP_007222999.1| hypothetical protein PRUPE_ppa006780mg [Prunus persica]
 gb|EMJ24198.1| hypothetical protein PRUPE_ppa006780mg [Prunus persica]
Length=395

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL+F G K AW+ YA  SDADLIAEQ IWAAVDP+A NEAFN++NGDVFK
Sbjct  226  YAAICKKEGKPLKFPGSKVAWECYAMASDADLIAEQHIWAAVDPNAANEAFNINNGDVFK  285

Query  519  WKHFCKVLADKFEVGVVEFEERSESN---NLEVMMKEKGPVWDEIVRENGLLSTKLEDVG  349
            WK F K LA++F +    F E  E     +L  MMK K  VW+EIV+EN L  TKLE+VG
Sbjct  286  WKQFWKGLAEQFGIEEHGFYEEEEGEGRLSLVEMMKGKEGVWEEIVKENELQPTKLEEVG  345

Query  348  HWWFVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
             WWF D +   E+ LD+MNKSKEHGFLGFRNS K+FISWI+KMK+YKIVP
Sbjct  346  VWWFADYVLGGEAVLDSMNKSKEHGFLGFRNSYKSFISWIEKMKSYKIVP  395



>gb|AEY82380.1| putative progesterone 5-beta-reductase [Lunaria annua]
Length=389

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLVFPGSKKAWEGFTAASDADLVAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  ++  L  MMK K  VW+E+V+EN L   +LE+VG WW
Sbjct  284  WKHMWKVLAEQFGIEEYGFEE-GKNLGLVQMMKGKERVWEEMVKENQLQERRLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++   E  +D+MNKSKEHGFLGFRNS  +F SW+DK KA+KIVP
Sbjct  343  FADVILGGEGMIDSMNKSKEHGFLGFRNSNNSFSSWVDKYKAFKIVP  389



>emb|CDY08911.1| BnaC08g11410D [Brassica napus]
Length=390

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN SN DVFK
Sbjct  225  YAAICKHEGSKLVFPGSKEAWEGFTTASDADLVAEQQIWAAVDPYAKNEAFNCSNADVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKERVWEEMVKENQLQVKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  V+  +D+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVVLGVDGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  390



>ref|XP_009394340.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=412

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA+IC+ EG+PLR+ G + AW G+++ SDADL+AE +IWAAVDP AKNEAFN SNGDVFK
Sbjct  245  YASICRKEGVPLRWFGSEEAWYGFSDASDADLVAEHQIWAAVDPYAKNEAFNCSNGDVFK  304

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA++F V  V +        LE  MK K  VW++IVREN L+ T L++VGHWW
Sbjct  305  WKHLWPVLAEQFGVPAVGYTGYDGRFKLEDAMKGKEAVWEDIVRENELVPTALDEVGHWW  364

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            + D +  +E   LDNMNKSKEHGFLGFRNS  +F +WIDK++AYK+VP
Sbjct  365  YADAVLGLEFEHLDNMNKSKEHGFLGFRNSVTSFNTWIDKLRAYKVVP  412



>gb|AHZ44509.1| putative progesterone 5 beta-reductase [Thlaspi arvense]
Length=389

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN +N D+FK
Sbjct  224  YAAICKHEGSPLVFPGSKKAWEGFTAASDADLVAEQQIWAAVDPYAKNEAFNCNNADIFK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  ++LA++F +    F E      +E MMK K  VW+E+V+EN L   KL +VG WW
Sbjct  284  WKHLWRILAEQFGIEEYGFVEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLGEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS  +FISWIDK KA+KIVP
Sbjct  343  FADVVLGVEGMIDSMNKSKEHGFLGFRNSNNSFISWIDKYKAFKIVP  389



>gb|AHI88613.1| putative steroid 5-beta-reductase [Sinapis arvensis]
Length=390

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G+   SDADLIAEQ+IWAAVDP AKNEAFN SN DVFK
Sbjct  225  YAAICKHEGSKLVFPGSKKAWEGFTTASDADLIAEQQIWAAVDPYAKNEAFNCSNADVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKERVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  V+  +D+MNKSKE+GFLGFRNS  +FISWIDK K +KIVP
Sbjct  344  FADVVLGVDGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKVFKIVP  390



>gb|AGN74845.1| putative enone 5-beta-reductase [Lepidium sativum]
Length=392

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 126/171 (74%), Gaps = 5/171 (3%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK+EG PL F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN SN D+FK
Sbjct  223  YAAICKYEGSPLLFPGSKKAWEGFTTASDADLVAEQQIWAAVDPYAKNEAFNCSNADIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KLE+VG WW
Sbjct  283  WKHLWKILAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKENQLQEKKLEEVGVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLG----FRNSEKAFISWIDKMKAYKIVP  199
              D++ SVE  +D+MNKSKEHGFLG    FRNS  +FISWIDK KA+KIVP
Sbjct  342  VADVILSVEGMIDSMNKSKEHGFLGFRNSFRNSNNSFISWIDKYKAFKIVP  392



>ref|XP_011042197.1| PREDICTED: uncharacterized protein LOC105137942 [Populus euphratica]
Length=803

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 10/193 (5%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+ YA  SDADL+AEQEIWA V+P+A+N+AFN+ N D FK
Sbjct  221  YAAICKHEGAPLMFPGTKEAWNCYAIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFK  280

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  +   L   MK+KGPVW+EIV++N L  TKLE+VG WW
Sbjct  281  WKHLWKVLAEQFGIEKYGFEEGGKRATLAERMKDKGPVWEEIVKKNQLFPTKLEEVGGWW  340

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP*LN*LISLAKNSC  160
            +VD + S ++ +  MNKSKEHGFLGFRNS K+F+ WI KM++ K++P          N C
Sbjct  341  YVDTMLSGDAFISCMNKSKEHGFLGFRNSTKSFVYWIGKMRSQKVIP----------NCC  390

Query  159  SSDITVALSNGSH  121
             +  T  LS   H
Sbjct  391  FNTPTTHLSYLLH  403


 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG PL F G K AW+ YA  SDADL+AEQEIWA V+P+A+N+AFN+ N D FK
Sbjct  636  YAAICKLEGAPLMFPGTKEAWNCYAIASDADLVAEQEIWACVEPNAQNQAFNIHNADYFK  695

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE  E   L   MK+K PVW+EIV++N L  TKLE+VG WW
Sbjct  696  WKHLWKVLAEQFGIEKYGFEEGGERATLAERMKDKEPVWEEIVKKNQLSPTKLEEVGGWW  755

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD + S ++ +  MNKSKEHGFLGFRNS K+F+ WI KM++ KI+P
Sbjct  756  FVDTMLSGDAFISCMNKSKEHGFLGFRNSTKSFVYWIGKMRSQKIIP  802



>gb|AFZ42259.1| putative progesterone 5-beta-reductase [Aethionema grandiflorum]
Length=388

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K AW+G+   SDADLIAEQ+IWA+VD  AKNEAFN +N D+FK
Sbjct  223  YAAICKHEGSPLLFPGSKKAWEGFTAASDADLIAEQQIWASVDQYAKNEAFNCNNDDIFK  282

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK   K+LA++F +    FEE      +E MMK K  VW+EIV+EN L  +KLE+V  WW
Sbjct  283  WKQLWKILAEQFGIEEFGFEEGKNLGLVE-MMKGKERVWEEIVKENQLQESKLEEVAVWW  341

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +  V+  +D+MNKSKEHGFLGFRNS K+F+SW+DK KA+KIVP
Sbjct  342  FVDAILGVDGMIDSMNKSKEHGFLGFRNSNKSFVSWVDKYKAFKIVP  388



>ref|XP_006433105.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
 gb|ESR46345.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
Length=397

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG+PL F G K  W+GY+  SDADLIAEQ+IWAAVDP  +NEAFN SNGDVFK
Sbjct  230  YAAICKHEGVPLLFPGSKDCWEGYSIASDADLIAEQQIWAAVDPYGRNEAFNCSNGDVFK  289

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++FE+      +  E   LE +MK K  VW+EIVREN L  TKL +V  W 
Sbjct  290  WKHLWKVLAEQFEIENYGLPQEGERVRLEEIMKGKEGVWEEIVRENQLQPTKLSEVAVWG  349

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++       L +MNKSKEHGFLGFRNS+ +F+ WIDKMK Y+IVP
Sbjct  350  FADMMLDGGFLWLGSMNKSKEHGFLGFRNSKNSFVYWIDKMKTYRIVP  397



>gb|AGL96526.1| putative progesterone 5-beta-reductase, partial [Brassica rapa 
subsp. pekinensis]
Length=390

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICK EG  L F G K AW+G+   SDADL+AEQ+IWAAVDP AKNEAFN SN DVFK
Sbjct  225  YAAICKQEGSKLVFPGSKEAWEGFTTASDADLVAEQQIWAAVDPYAKNEAFNCSNADVFK  284

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  K+LA++F +    FEE      +E MMK K  VW+E+V+EN L   KL++VG WW
Sbjct  285  WKHLWKILAEQFGIEEYGFEEGKNVGLVE-MMKGKESVWEEMVKENQLQEKKLDEVGVWW  343

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  V+  +D+MNKSKE+GFLGFRNS  +FISWIDK KA+KIVP
Sbjct  344  FADVVLGVDGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP  390



>ref|XP_010905261.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Elaeis 
guineensis]
Length=398

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAIC+ EG PLR+ G + AW+G+++ SDADLIAEQ+IWAAVD  AKNEAFN SNGDVFK
Sbjct  231  YAAICQREGAPLRWPGSRVAWEGFSDASDADLIAEQQIWAAVDLHAKNEAFNCSNGDVFK  290

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LA  F V  V ++       LE  MK +  +W+E+V E+GL  T+LEDVG+WW
Sbjct  291  WKHLWPLLARAFGVDWVGYQGEEARFKLEDAMKGREALWEEMVAEHGLAPTRLEDVGNWW  350

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +F  E   L +MNKSKEHGFLGFRN+  +F SWIDKM+ YKIVP
Sbjct  351  FVDAVFGAEEMYLGSMNKSKEHGFLGFRNTVSSFDSWIDKMRVYKIVP  398



>ref|XP_009396895.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAIC+ EG PL++ G +  WDG+ + SDADLIAEQ+IWAAVDP AKNEAFN+SNGD+FK
Sbjct  243  YAAICRKEGAPLKWFGSRTTWDGFNDASDADLIAEQQIWAAVDPYAKNEAFNISNGDLFK  302

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH    LAD+F +  V +E  +    LE  M+ K  VW EIV EN L+ TKLE+V  WW
Sbjct  303  WKHLWAALADQFGLESVGYEGEASRFKLEDAMRGKEAVWAEIVAENELVPTKLEEVASWW  362

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  +E + LD+MNKSKEHGFLGFRN+  +F S IDKMKA+KIVP
Sbjct  363  FADVVLGLELAHLDSMNKSKEHGFLGFRNTVASFNSCIDKMKAFKIVP  410



>ref|XP_008790634.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Phoenix 
dactylifera]
Length=400

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAA+C+  G+PLR+ G +  W+G+++ SDADLIAE +IWAAVDP AKNEAFN SNGDVFK
Sbjct  233  YAAVCRRAGVPLRWPGSRVVWEGFSDASDADLIAEHQIWAAVDPYAKNEAFNCSNGDVFK  292

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LA +F VG   ++  +    LE  MK K  +W+E+V E+ L  TKLE+VG+WW
Sbjct  293  WKHLWPLLAKEFGVGWEGYQGEAARFKLEDAMKGKEGLWEEMVAEHELAPTKLEEVGNWW  352

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +  +E   LDNMNKSKEHGFLGFRN+  +F SWIDK++AYKIVP
Sbjct  353  FVDAVLGLEEEYLDNMNKSKEHGFLGFRNTVSSFNSWIDKIRAYKIVP  400



>ref|XP_008790041.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Phoenix 
dactylifera]
Length=400

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAIC+ EG PL++ G + AW+G+++ SDADLIAE  IWAA+DP AKNE FN SNGD+FK
Sbjct  233  YAAICRREGAPLKWPGSRVAWEGFSDASDADLIAEHHIWAAIDPYAKNEPFNCSNGDLFK  292

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   +LA +F V  V +E       L   MKEK  +W+E+V E+ L  T+LE+VG+WW
Sbjct  293  WKHLWPLLAREFGVEWVGYEGEERRFKLVDAMKEKEGLWEEMVAEHALAPTRLEEVGNWW  352

Query  339  FVDLLFSVES-PLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +  VE   LD+MNKSKEHGFLGFRN+  +FISWIDKM+AY+IVP
Sbjct  353  FVDAVLGVEEVHLDSMNKSKEHGFLGFRNTVSSFISWIDKMRAYRIVP  400



>ref|XP_006471285.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=393

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K  W+G++  SDADLIAEQEIWAAVDP+A+NEAFN +NGDVFK
Sbjct  224  YAAICKHEGFPLLFPGTKETWEGFSEYSDADLIAEQEIWAAVDPNARNEAFNCTNGDVFK  283

Query  519  WKHFCKVLADKFEVGVVEF--EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGH  346
            WKH  KVLA++FE+    F  E+ SE   LE +MK K  VW+EIVREN L  TKL +V  
Sbjct  284  WKHLWKVLAEQFEIENYGFGDEKGSERVRLEEIMKGKESVWEEIVRENQLQPTKLNEVAV  343

Query  345  WWFVDLLFSVESPLD-NMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            W + D++ +V +    +MNKSKEHGFLGFRNS+ +F++WI ++K+++IVP
Sbjct  344  WSYADMVMNVGAGYSVSMNKSKEHGFLGFRNSKNSFVAWIGRLKSHRIVP  393



>ref|XP_006432523.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
 ref|XP_006471284.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 gb|ESR45763.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
Length=394

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG PL F G K  W+G++  SDADLIAEQEIWAAVDP+A+NEAFN +NGDVFK
Sbjct  225  YAAICKHEGFPLLFPGTKETWEGFSEYSDADLIAEQEIWAAVDPNARNEAFNCTNGDVFK  284

Query  519  WKHFCKVLADKFEVGVVEF--EERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGH  346
            WKH  KVLA++FE+    F  E+ SE   LE +MK K  VW+EIVREN L  TKL +V  
Sbjct  285  WKHLWKVLAEQFEIENYGFGDEKGSERVRLEEIMKGKESVWEEIVRENQLQPTKLNEVAV  344

Query  345  WWFVDLLFSVESPLD-NMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            W + D++ +V +    +MNKSKEHGFLGFRNS+ +F++WI ++K+++IVP
Sbjct  345  WSYADMVMNVGAGYSVSMNKSKEHGFLGFRNSKNSFVAWIGRLKSHRIVP  394



>gb|EMS53363.1| hypothetical protein TRIUR3_02025 [Triticum urartu]
Length=223

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAIC+ EG  LR+ G K AW+G+ + SDADL+AE EIWAAVDP AKNEAFN SNGDVFK
Sbjct  56   YAAICRKEGATLRWPGCKVAWEGFTDASDADLVAEHEIWAAVDPFAKNEAFNCSNGDVFK  115

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK    +LAD+F V    +E       L   M  K  VW EI++EN L++T+LE++  WW
Sbjct  116  WKQLWPLLADRFGVEWAGYEGEDSRFALADAMAGKEAVWTEIIQENELVTTELEEITSWW  175

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD + S++   LDNMNKSKEHGFLGFRN+  +F +WIDKMKA K+VP
Sbjct  176  FVDAMLSIDIEHLDNMNKSKEHGFLGFRNTVNSFNAWIDKMKASKVVP  223



>gb|AHZ44506.1| putative progesterone 5 beta-reductase [Iberis amara]
Length=389

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAICKHEG  L F G K AW+G++  SDADL+AEQ+IWAAVD  AK EAFN +N D+ K
Sbjct  224  YAAICKHEGSKLVFPGSKKAWEGFSTASDADLVAEQQIWAAVDEYAKTEAFNCNNDDISK  283

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH  KVLA++F +    FEE      +E MMK K  VW+E+V+E+ L   KLE+VG WW
Sbjct  284  WKHLWKVLAEQFGIEEYGFEEGKNLGLVE-MMKGKERVWEEMVKEHQLQEKKLEEVGVWW  342

Query  339  FVDLLFSVESPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            F D++  VE  +D+MNKSKEHGFLGFRNS K+FISWIDK KA+KIVP
Sbjct  343  FADIILGVEGMIDSMNKSKEHGFLGFRNSNKSFISWIDKYKAFKIVP  389



>ref|XP_009394339.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=421

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YA+IC+ EG+PLR+ G + AW G+++ SDADL+AE +IWAAVDP AKNEAFN SNGDVFK
Sbjct  245  YASICRKEGVPLRWFGSEEAWYGFSDASDADLVAEHQIWAAVDPYAKNEAFNCSNGDVFK  304

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WKH   VLA++F V  V +        LE  MK K  VW++IVREN L+ T L++VGHWW
Sbjct  305  WKHLWPVLAEQFGVPAVGYTGYDGRFKLEDAMKGKEAVWEDIVRENELVPTALDEVGHWW  364

Query  339  FVDLLFSVE-SPLDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYK  208
            + D +  +E   LDNMNKSKEHGFLGFRNS  +F +WIDK++AYK
Sbjct  365  YADAVLGLEFEHLDNMNKSKEHGFLGFRNSVTSFNTWIDKLRAYK  409



>ref|XP_002465092.1| hypothetical protein SORBIDRAFT_01g031950 [Sorghum bicolor]
 gb|EER92090.1| hypothetical protein SORBIDRAFT_01g031950 [Sorghum bicolor]
Length=396

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  YAAICKHEGIPLRFSGLKAAWDGYANCSDADLIAEQEIWAAVDPSAKNEAFNVSNGDVFK  520
            YAAIC+ EG  LR+ G +  W+G+++ SDADLIAE EIWAAVDP AKNEAFN SNGD+FK
Sbjct  229  YAAICRKEGATLRWPGSRVTWEGFSDASDADLIAEHEIWAAVDPFAKNEAFNCSNGDIFK  288

Query  519  WKHFCKVLADKFEVGVVEFEERSESNNLEVMMKEKGPVWDEIVRENGLLSTKLEDVGHWW  340
            WK    +LAD F V    +E       LE  M  K  VW EIVREN L++T+L+++ +WW
Sbjct  289  WKQLWPILADHFGVEWAGYEGEENRFRLEDAMAGKEAVWAEIVRENELIATELDEITNWW  348

Query  339  FVDLLFSVESP-LDNMNKSKEHGFLGFRNSEKAFISWIDKMKAYKIVP  199
            FVD +F+VE+  LD+MNKSKEHGFLGFRN+  +F +WI+KMK +KIVP
Sbjct  349  FVDAMFAVETQLLDSMNKSKEHGFLGFRNTVTSFNTWIEKMKVFKIVP  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320