BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035B08

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076650.1|  PREDICTED: uncharacterized protein LOC105160850    203   2e-60   Sesamum indicum [beniseed]
emb|CDP13970.1|  unnamed protein product                                193   2e-56   Coffea canephora [robusta coffee]
ref|XP_009591922.1|  PREDICTED: uncharacterized protein LOC104088...    191   2e-56   Nicotiana tomentosiformis
ref|XP_009591921.1|  PREDICTED: uncharacterized protein LOC104088...    191   6e-56   Nicotiana tomentosiformis
ref|XP_009776957.1|  PREDICTED: uncharacterized protein LOC104226...    189   9e-56   Nicotiana sylvestris
ref|XP_009776956.1|  PREDICTED: uncharacterized protein LOC104226...    190   2e-55   Nicotiana sylvestris
ref|XP_004239953.1|  PREDICTED: uncharacterized protein LOC101260820    187   2e-54   Solanum lycopersicum
gb|EYU20061.1|  hypothetical protein MIMGU_mgv1a011365mg                187   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_006355642.1|  PREDICTED: uncharacterized protein LOC102579...    184   9e-54   Solanum tuberosum [potatoes]
ref|XP_006355641.1|  PREDICTED: uncharacterized protein LOC102579...    185   3e-53   Solanum tuberosum [potatoes]
ref|XP_006591393.1|  PREDICTED: uncharacterized protein LOC100809288    184   3e-53   
gb|KHN04787.1|  hypothetical protein glysoja_031887                     182   8e-53   Glycine soja [wild soybean]
gb|KEH34808.1|  autophagy-related protein                               181   1e-52   Medicago truncatula
ref|XP_003600978.1|  hypothetical protein MTR_3g071640                  180   1e-51   Medicago truncatula
gb|KJB74365.1|  hypothetical protein B456_011G290500                    177   2e-51   Gossypium raimondii
gb|KHG25155.1|  Autophagy-related 27                                    179   6e-51   Gossypium arboreum [tree cotton]
ref|XP_007008867.1|  Leucine-rich repeat and IQ domain-containing...    176   8e-51   
gb|KJB74366.1|  hypothetical protein B456_011G290500                    177   2e-50   Gossypium raimondii
gb|KHN31307.1|  hypothetical protein glysoja_022961                     179   3e-50   Glycine soja [wild soybean]
ref|XP_007163579.1|  hypothetical protein PHAVU_001G246100g             177   3e-50   Phaseolus vulgaris [French bean]
gb|KDP44701.1|  hypothetical protein JCGZ_01201                         176   5e-50   Jatropha curcas
ref|XP_007008865.1|  Leucine-rich repeat and IQ domain-containing...    176   6e-50   
ref|XP_004148171.1|  PREDICTED: uncharacterized protein LOC101220308    176   8e-50   
ref|XP_008454838.1|  PREDICTED: uncharacterized protein LOC103495149    174   2e-49   Cucumis melo [Oriental melon]
gb|KCW65717.1|  hypothetical protein EUGRSUZ_G03091                     171   5e-49   Eucalyptus grandis [rose gum]
ref|XP_006411288.1|  hypothetical protein EUTSA_v10017062mg             171   1e-48   Eutrema salsugineum [saltwater cress]
gb|KCW65716.1|  hypothetical protein EUGRSUZ_G03091                     170   1e-48   Eucalyptus grandis [rose gum]
ref|XP_006411289.1|  hypothetical protein EUTSA_v10017062mg             171   7e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002273745.2|  PREDICTED: uncharacterized protein LOC100255420    171   7e-48   Vitis vinifera
ref|XP_008233814.1|  PREDICTED: uncharacterized protein LOC103332...    170   9e-48   Prunus mume [ume]
ref|XP_010067562.1|  PREDICTED: uncharacterized protein LOC104454422    170   1e-47   Eucalyptus grandis [rose gum]
gb|EPS63394.1|  hypothetical protein M569_11391                         166   2e-47   Genlisea aurea
ref|XP_008233813.1|  PREDICTED: uncharacterized protein LOC103332...    169   3e-47   Prunus mume [ume]
ref|XP_011003078.1|  PREDICTED: uncharacterized protein LOC105109...    169   4e-47   Populus euphratica
emb|CDY18864.1|  BnaC04g04860D                                          168   5e-47   Brassica napus [oilseed rape]
ref|XP_010264548.1|  PREDICTED: uncharacterized protein LOC104602...    165   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009369219.1|  PREDICTED: uncharacterized protein LOC103958...    166   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_002879864.1|  hypothetical protein ARALYDRAFT_903321             166   3e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_010264547.1|  PREDICTED: uncharacterized protein LOC104602...    165   8e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009369218.1|  PREDICTED: uncharacterized protein LOC103958...    165   9e-46   Pyrus x bretschneideri [bai li]
ref|XP_009345387.1|  PREDICTED: uncharacterized protein LOC103937190    164   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_006294774.1|  hypothetical protein CARUB_v10023827mg             162   3e-45   Capsella rubella
ref|XP_010264546.1|  PREDICTED: uncharacterized protein LOC104602...    164   3e-45   Nelumbo nucifera [Indian lotus]
ref|NP_001078029.1|  uncharacterized protein                            160   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAX55150.1|  hypothetical protein At2g40316                          160   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294775.1|  hypothetical protein CARUB_v10023827mg             162   2e-44   Capsella rubella
ref|XP_010692932.1|  PREDICTED: uncharacterized protein LOC104905961    162   2e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO86846.1|  hypothetical protein                                    159   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505758.1|  PREDICTED: uncharacterized protein LOC104782...    159   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004307687.1|  PREDICTED: uncharacterized protein LOC101315282    160   6e-44   Fragaria vesca subsp. vesca
gb|AAY82253.1|  hypothetical protein At2g40316                          157   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181562.4|  uncharacterized protein                               160   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143226.1|  PREDICTED: uncharacterized protein LOC103866...    158   1e-43   Brassica rapa
ref|XP_010505757.1|  PREDICTED: uncharacterized protein LOC104782...    159   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009143225.1|  PREDICTED: uncharacterized protein LOC103866...    159   2e-43   Brassica rapa
ref|XP_006847437.1|  hypothetical protein AMTR_s00153p00085570          158   3e-43   
ref|XP_010508882.1|  PREDICTED: uncharacterized protein LOC104785...    156   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008363772.1|  PREDICTED: uncharacterized protein LOC103427...    157   7e-43   
ref|XP_008804113.1|  PREDICTED: uncharacterized protein LOC103717...    154   2e-42   Phoenix dactylifera
ref|XP_008363771.1|  PREDICTED: uncharacterized protein LOC103427...    156   2e-42   
ref|XP_010508881.1|  PREDICTED: uncharacterized protein LOC104785...    155   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010534619.1|  PREDICTED: uncharacterized protein LOC104810122    155   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_008804111.1|  PREDICTED: uncharacterized protein LOC103717...    154   9e-42   Phoenix dactylifera
gb|KFK36924.1|  hypothetical protein AALP_AA4G190300                    154   1e-41   Arabis alpina [alpine rockcress]
ref|XP_006435816.1|  hypothetical protein CICLE_v10032369mg             152   1e-40   Citrus clementina [clementine]
ref|XP_007008868.1|  Leucine-rich repeat and IQ domain-containing...    147   5e-39   
ref|XP_002311247.2|  hypothetical protein POPTR_0008s07320g             148   1e-38   
ref|XP_004173078.1|  PREDICTED: uncharacterized protein LOC101226795    139   6e-38   
gb|AAD25948.1|AF085279_21  hypothetical protein                         140   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416304.1|  PREDICTED: uncharacterized protein LOC103996952    144   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX74798.1|  BnaA05g05440D                                          142   7e-37   
ref|XP_007219770.1|  hypothetical protein PRUPE_ppa025595mg             134   3e-35   
ref|XP_010517450.1|  PREDICTED: uncharacterized protein LOC104792...    135   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010517449.1|  PREDICTED: uncharacterized protein LOC104792...    135   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010921016.1|  PREDICTED: uncharacterized protein LOC105044726    132   3e-33   Elaeis guineensis
ref|XP_003558130.1|  PREDICTED: uncharacterized protein LOC100823098    124   4e-30   Brachypodium distachyon [annual false brome]
dbj|BAJ90180.1|  predicted protein                                      120   9e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007008869.1|  Leucine-rich repeat and IQ domain-containing...    120   1e-28   
ref|XP_010087539.1|  hypothetical protein L484_006944                   116   2e-27   
ref|NP_001183686.1|  uncharacterized protein LOC100502280 precursor     116   4e-27   Zea mays [maize]
gb|AFK44428.1|  unknown                                                 113   1e-26   Lotus japonicus
ref|XP_006651281.1|  PREDICTED: uncharacterized protein LOC102717143    115   3e-26   Oryza brachyantha
ref|XP_004984880.1|  PREDICTED: uncharacterized protein LOC101783...    112   1e-25   
ref|NP_001049832.1|  Os03g0296700                                       106   8e-24   
ref|XP_008343653.1|  PREDICTED: uncharacterized protein LOC103406452    106   9e-24   
emb|CAN76264.1|  hypothetical protein VITISV_001854                     101   6e-22   Vitis vinifera
ref|XP_008374955.1|  PREDICTED: uncharacterized protein LOC103438201  98.2    7e-21   
gb|ACU20834.1|  unknown                                               91.3    2e-18   Glycine max [soybeans]
gb|EMT00564.1|  hypothetical protein F775_08095                       89.4    1e-17   
ref|XP_008647628.1|  PREDICTED: uncharacterized protein LOC100502...  87.4    8e-17   Zea mays [maize]
ref|XP_002979286.1|  hypothetical protein SELMODRAFT_110390           83.6    3e-16   
ref|XP_001756445.1|  predicted protein                                83.6    4e-15   
ref|XP_002520790.1|  conserved hypothetical protein                   79.3    2e-14   
ref|XP_001759768.1|  predicted protein                                78.6    3e-14   
ref|XP_007008866.1|  Leucine-rich repeat and IQ domain-containing...  77.4    8e-14   
ref|XP_011003184.1|  PREDICTED: uncharacterized protein LOC105109...  76.3    2e-13   Populus euphratica
gb|EEC75047.1|  hypothetical protein OsI_11153                        73.9    1e-12   Oryza sativa Indica Group [Indian rice]
gb|EEE58880.1|  hypothetical protein OsJ_10490                        73.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KDO68854.1|  hypothetical protein CISIN_1g037714mg                 65.9    7e-10   Citrus sinensis [apfelsine]
dbj|GAD91664.1|  vacuolar sorting receptor (Mrl1), putative           63.2    3e-08   Byssochlamys spectabilis No. 5
gb|ACR36424.1|  unknown                                               58.9    1e-07   Zea mays [maize]
ref|XP_001212231.1|  conserved hypothetical protein                   60.8    2e-07   Aspergillus terreus NIH2624
dbj|BAE54833.1|  unnamed protein product                              59.7    3e-07   Aspergillus oryzae RIB40
ref|XP_002383235.1|  vacuolar sorting receptor (Mrl1), putative       60.1    3e-07   Aspergillus flavus NRRL3357
ref|XP_001816835.2|  vacuolar sorting receptor (Mrl1)                 60.1    3e-07   
gb|EIT72508.1|  cation-independent mannose-6-phosphate receptor C...  60.1    3e-07   Aspergillus oryzae 3.042
ref|XP_002480488.1|  vacuolar sorting receptor (Mrl1), putative       59.7    4e-07   Talaromyces stipitatus ATCC 10500
ref|XP_001265096.1|  vacuolar sorting receptor (Mrl1), putative       59.7    4e-07   Aspergillus fischeri NRRL 181
ref|XP_008647632.1|  PREDICTED: uncharacterized protein LOC100502...  59.3    5e-07   Zea mays [maize]
tpg|DAA44898.1|  TPA: hypothetical protein ZEAMMB73_360049            58.5    5e-07   
ref|XP_001269587.1|  vacuolar sorting receptor (Mrl1), putative       59.3    6e-07   Aspergillus clavatus NRRL 1
dbj|GAM39181.1|  hypothetical protein TCE0_034f10514                  58.9    7e-07   Talaromyces cellulolyticus
gb|KFX50812.1|  putative mannose 6-phosphate receptor-like protein    58.2    1e-06   Talaromyces marneffei PM1
ref|XP_002144095.1|  vacuolar sorting receptor (Mrl1), putative       58.2    1e-06   Talaromyces marneffei ATCC 18224
ref|XP_750322.1|  vacuolar sorting receptor (Mrl1)                    56.2    7e-06   Aspergillus fumigatus Af293
ref|XP_006819098.1|  PREDICTED: uncharacterized protein LOC102807910  55.5    7e-06   Saccoglossus kowalevskii
ref|XP_002542561.1|  conserved hypothetical protein                   53.9    1e-05   Uncinocarpus reesii 1704
ref|XP_002110654.1|  expressed protein                                54.7    2e-05   Trichoplax adhaerens
gb|KIV88105.1|  hypothetical protein, variant                         54.3    3e-05   Exophiala mesophila
ref|XP_008197150.1|  PREDICTED: uncharacterized protein LOC103314060  53.1    4e-05   Tribolium castaneum [rust-red flour beetle]
gb|EAS32866.3|  vacuolar sorting receptor                             53.5    5e-05   Coccidioides immitis RS
ref|XP_001244449.1|  hypothetical protein CIMG_03890                  53.5    5e-05   
emb|CDH52540.1|  autophagy protein atg27                              53.1    5e-05   Lichtheimia corymbifera JMRC:FSU:9682
gb|EFW20208.1|  vacuolar sorting receptor                             53.5    6e-05   Coccidioides posadasii str. Silveira
gb|EZF30130.1|  hypothetical protein H101_06229                       53.5    6e-05   Trichophyton interdigitale H6
gb|KIM75495.1|  hypothetical protein PILCRDRAFT_827204                53.1    6e-05   Piloderma croceum F 1598
gb|EYE90402.1|  mannose 6-phosphate receptor domain-containing pr...  53.1    7e-05   Aspergillus ruber CBS 135680
gb|EEQ83764.1|  vacuolar sorting receptor                             53.1    7e-05   Blastomyces dermatitidis ER-3
ref|XP_007579807.1|  putative vacuolar sorting receptor protein       53.1    7e-05   
gb|EQL29309.1|  hypothetical protein BDFG_08039                       53.1    8e-05   Blastomyces dermatitidis ATCC 26199
ref|XP_002625151.1|  vacuolar sorting receptor                        53.1    8e-05   Blastomyces gilchristii SLH14081
gb|EGE80100.1|  vacuolar sorting receptor                             53.1    8e-05   Blastomyces dermatitidis ATCC 18188
gb|KIL71248.1|  hypothetical protein M378DRAFT_154764                 53.1    8e-05   Amanita muscaria Koide BX008
emb|CEI91741.1|  hypothetical protein RMCBS344292_06022               53.1    8e-05   Rhizopus microsporus
emb|CEG71777.1|  hypothetical protein RMATCC62417_07449               52.8    9e-05   Rhizopus microsporus
emb|CEI92604.1|  hypothetical protein RMCBS344292_06858               52.8    9e-05   Rhizopus microsporus
gb|EPB85865.1|  hypothetical protein HMPREF1544_07364                 52.4    9e-05   Mucor circinelloides f. circinelloides 1006PhL
gb|KIV88104.1|  hypothetical protein PV10_09031                       52.0    1e-04   Exophiala mesophila
ref|XP_001792289.1|  hypothetical protein SNOG_01653                  52.0    1e-04   Parastagonospora nodorum SN15
gb|KDQ57471.1|  hypothetical protein JAAARDRAFT_177653                51.6    2e-04   Jaapia argillacea MUCL 33604
ref|XP_661699.1|  hypothetical protein AN4095.2                       51.6    2e-04   Aspergillus nidulans FGSC A4
ref|XP_007328525.1|  hypothetical protein AGABI1DRAFT_112688          51.6    2e-04   Agaricus bisporus var. burnettii JB137-S8
gb|EHJ65657.1|  hypothetical protein KGM_06525                        51.6    2e-04   
ref|XP_009067010.1|  hypothetical protein LOTGIDRAFT_134805           50.1    3e-04   Lottia gigantea
gb|ELU12794.1|  hypothetical protein CAPTEDRAFT_127669                50.1    3e-04   Capitella teleta
ref|XP_005109119.1|  PREDICTED: cation-dependent mannose-6-phosph...  51.2    3e-04   Aplysia californica
ref|XP_010755848.1|  hypothetical protein PADG_00481                  51.2    3e-04   Paracoccidioides brasiliensis Pb18
gb|EEH19822.1|  hypothetical protein PABG_02081                       50.8    4e-04   Paracoccidioides brasiliensis Pb03
gb|KFH62810.1|  hypothetical protein MVEG_11336                       50.8    4e-04   Mortierella verticillata NRRL 6337
emb|CDS08563.1|  hypothetical protein LRAMOSA09924                    50.4    5e-04   Lichtheimia ramosa
gb|EKG17326.1|  Mannose-6-phosphate receptor binding protein          50.4    5e-04   Macrophomina phaseolina MS6
ref|XP_002795908.1|  conserved hypothetical protein                   50.4    5e-04   Paracoccidioides lutzii Pb01
ref|XP_003176966.1|  hypothetical protein MGYG_08915                  50.4    6e-04   Nannizzia gypsea CBS 118893
gb|KIY50344.1|  hypothetical protein FISHEDRAFT_39344                 50.1    6e-04   Fistulina hepatica ATCC 64428
ref|XP_006461115.1|  hypothetical protein AGABI2DRAFT_192652          50.1    7e-04   Agaricus bisporus var. bisporus H97
gb|EGC41025.1|  vacuolar sorting receptor                             50.1    8e-04   Histoplasma capsulatum H88
ref|XP_011451964.1|  PREDICTED: cation-dependent mannose-6-phosph...  49.7    8e-04   Crassostrea gigas
ref|XP_007720149.1|  cation-dependent mannose-6-phosphate receptor    49.7    8e-04   Capronia coronata CBS 617.96
ref|XP_003856449.1|  hypothetical protein MYCGRDRAFT_66596            49.7    0.001   Zymoseptoria tritici IPO323
gb|EEH04996.1|  conserved hypothetical protein                        49.7    0.001   Histoplasma capsulatum G186AR
gb|EER45071.1|  vacuolar sorting receptor                             49.7    0.001   Histoplasma capsulatum H143



>ref|XP_011076650.1| PREDICTED: uncharacterized protein LOC105160850 [Sesamum indicum]
Length=284

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  HT    NCSL+VSV+C+ +   GPQTLE VG CD++TEL+HP GC  +IS+ G GLG
Sbjct  149  KMTHTGSKRNCSLSVSVICNSNGVQGPQTLETVGFCDYSTELKHPLGCAKIISSHGNGLG  208

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT +IIILCLFGAYLL G +YRY+FLHIRGID+IPNLEFW+SLPH++QS+F S+ +RF
Sbjct  209  WFGTFMIIILCLFGAYLLAGAVYRYYFLHIRGIDVIPNLEFWASLPHRIQSFFLSLVRRF  268

Query  321  RGPSQHHRSTYSPVEF  274
            RGPSQ +RS+YSPV F
Sbjct  269  RGPSQGYRSSYSPVNF  284



>emb|CDP13970.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCS++VSV+CD +   GP+ LEKVGTCD+ T+LRHP+GC  VIS+ G G G
Sbjct  158  KMSNSQPKLNCSVSVSVICDYNGVEGPRMLEKVGTCDYVTQLRHPAGCAKVISSHGSGWG  217

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT L+IILCLFGAYLL G++YRYFFL+I GID IPNLEFW+++PHKVQS+F ++ +RF
Sbjct  218  WFGTFLVIILCLFGAYLLAGVVYRYFFLNIHGIDAIPNLEFWATVPHKVQSFFVALVRRF  277

Query  321  RGPSQHHRSTYSPVEF  274
            RGPSQ +RS+YSPV F
Sbjct  278  RGPSQGYRSSYSPVNF  293



>ref|XP_009591922.1| PREDICTED: uncharacterized protein LOC104088879 isoform X2 [Nicotiana 
tomentosiformis]
Length=213

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 107/136 (79%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  +     NCSLAVS+VCD +   GP+TLE VGTC +ATE+ HPSGC  +IS+ G+G+G
Sbjct  78   KMSYRGPKLNCSLAVSIVCDTNGVQGPRTLELVGTCAYATEIHHPSGCAVIISSHGQGMG  137

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT++IIILCLFG YLLGG  YRYF L IRGIDIIPNLEFW+SLPH +QS F S+ +RF
Sbjct  138  WFGTMMIIILCLFGIYLLGGAAYRYFSLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRF  197

Query  321  RGPSQHHRSTYSPVEF  274
            RGPS  HRSTYSPV F
Sbjct  198  RGPSHGHRSTYSPVNF  213



>ref|XP_009591921.1| PREDICTED: uncharacterized protein LOC104088879 isoform X1 [Nicotiana 
tomentosiformis]
Length=283

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSLAVS+VCD +   GP+TLE VGTC +ATE+ HPSGC  +IS+ G+G+GWFGT++III
Sbjct  157  NCSLAVSIVCDTNGVQGPRTLELVGTCAYATEIHHPSGCAVIISSHGQGMGWFGTMMIII  216

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCLFG YLLGG  YRYF L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS
Sbjct  217  LCLFGIYLLGGAAYRYFSLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRS  276

Query  294  TYSPVEF  274
            TYSPV F
Sbjct  277  TYSPVNF  283



>ref|XP_009776957.1| PREDICTED: uncharacterized protein LOC104226625 isoform X2 [Nicotiana 
sylvestris]
Length=213

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSLAVS+VCD +    P+TLE VGTCD+AT++ HPSGC  +IS+ G+G+GWFGT++III
Sbjct  87   NCSLAVSIVCDTNGVQVPRTLELVGTCDYATQIHHPSGCAMIISSHGQGMGWFGTMMIII  146

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCLFG YLLGG  YRYF L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS
Sbjct  147  LCLFGVYLLGGAAYRYFSLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRS  206

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  207  SYSPVNF  213



>ref|XP_009776956.1| PREDICTED: uncharacterized protein LOC104226625 isoform X1 [Nicotiana 
sylvestris]
Length=283

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSLAVS+VCD +    P+TLE VGTCD+AT++ HPSGC  +IS+ G+G+GWFGT++III
Sbjct  157  NCSLAVSIVCDTNGVQVPRTLELVGTCDYATQIHHPSGCAMIISSHGQGMGWFGTMMIII  216

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCLFG YLLGG  YRYF L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HRS
Sbjct  217  LCLFGVYLLGGAAYRYFSLGIRGIDIIPNLEFWASLPHTLQSMFLSLVRRFRGPSHGHRS  276

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  277  SYSPVNF  283



>ref|XP_004239953.1| PREDICTED: uncharacterized protein LOC101260820 [Solanum lycopersicum]
Length=283

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 107/136 (79%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K ++    +NCSLAVS+VCD +   GPQTLE VGTCD+AT++ HPSGC  +IS+ G G+G
Sbjct  146  KLFNRGSKSNCSLAVSIVCDTNGVQGPQTLELVGTCDYATKIHHPSGCALIISSHGNGMG  205

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT+LI+IL   G YLLGG +YRY+ L IRGIDIIPNLEFW+SLPH +QS F S+ +RF
Sbjct  206  WFGTMLILILFFLGVYLLGGAVYRYYSLGIRGIDIIPNLEFWASLPHTLQSSFTSLVRRF  265

Query  321  RGPSQHHRSTYSPVEF  274
            RGPS  HRS+YSPV F
Sbjct  266  RGPSHGHRSSYSPVNF  281



>gb|EYU20061.1| hypothetical protein MIMGU_mgv1a011365mg [Erythranthe guttata]
Length=284

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCSL+VSV+C+ +   GPQ LE  GTCD+ TEL+HP GC   IS+ G G G
Sbjct  149  KMTNSGPKRNCSLSVSVICNSNGVQGPQKLETNGTCDYTTELKHPLGCAKTISSGGNGWG  208

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT +IIILCL G YLL G  YRYFFLH+RGID+IPNLEFW+SLPH +Q+ FQS+ +RF
Sbjct  209  WFGTFMIIILCLSGGYLLAGAGYRYFFLHVRGIDVIPNLEFWASLPHTIQTLFQSLVRRF  268

Query  321  RGPSQHHRSTYSPVEF  274
            RGPSQ +RS+YSPV F
Sbjct  269  RGPSQGYRSSYSPVNF  284



>ref|XP_006355642.1| PREDICTED: uncharacterized protein LOC102579236 isoform X2 [Solanum 
tuberosum]
Length=213

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  +    +NCSLAVSVVCD +   GPQTLE VGTCD+AT++ HPSGC  +IS+   G+G
Sbjct  78   KLSNRGSKSNCSLAVSVVCDTNGVQGPQTLELVGTCDYATKIHHPSGCALIISSHRNGMG  137

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT+LI+IL  FG YL+GG +YRY+ L IRGIDIIPNLEFW+SLPH +QS F S+ +RF
Sbjct  138  WFGTMLILILFFFGVYLVGGAVYRYYSLGIRGIDIIPNLEFWASLPHTLQSSFTSLVRRF  197

Query  321  RGPSQHHRSTYSPVEF  274
            RGPS  HRS+YSPV F
Sbjct  198  RGPSHGHRSSYSPVNF  213



>ref|XP_006355641.1| PREDICTED: uncharacterized protein LOC102579236 isoform X1 [Solanum 
tuberosum]
Length=283

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = -3

Query  654  TNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            +NCSLAVSVVCD +   GPQTLE VGTCD+AT++ HPSGC  +IS+   G+GWFGT+LI+
Sbjct  156  SNCSLAVSVVCDTNGVQGPQTLELVGTCDYATKIHHPSGCALIISSHRNGMGWFGTMLIL  215

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHR  298
            IL  FG YL+GG +YRY+ L IRGIDIIPNLEFW+SLPH +QS F S+ +RFRGPS  HR
Sbjct  216  ILFFFGVYLVGGAVYRYYSLGIRGIDIIPNLEFWASLPHTLQSSFTSLVRRFRGPSHGHR  275

Query  297  STYSPVEF  274
            S+YSPV F
Sbjct  276  SSYSPVNF  283



>ref|XP_006591393.1| PREDICTED: uncharacterized protein LOC100809288 [Glycine max]
Length=278

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 108/136 (79%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCSLAVSV+C+ +   GP+TLE++G CD+ TEL+HPSGC  +++  G GLG
Sbjct  143  KMSNSGPKYNCSLAVSVLCNLNGVQGPRTLERLGACDYVTELKHPSGCAIIVNVHGGGLG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTLLII+LCLF AYLL G++YR+FFL IRGIDIIPNL+FW SLP + QS   S+A++F
Sbjct  203  WFGTLLIIVLCLFAAYLLAGIVYRFFFLGIRGIDIIPNLDFWVSLPRRTQSLCASLARKF  262

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ HRSTYSPV F
Sbjct  263  KGPSEGHRSTYSPVNF  278



>gb|KHN04787.1| hypothetical protein glysoja_031887 [Glycine soja]
Length=259

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCSLAVSV+C+ +   GP+TLE++G CD+ TEL+HPSGC  +++  G GLG
Sbjct  124  KMSNSGPKYNCSLAVSVLCNLNGVQGPRTLERLGACDYVTELKHPSGCAIIVNVHGGGLG  183

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTLLII+LCLF AYLL G++YR+FFL IRGIDIIPNL+FW SLP + QS   S+ ++F
Sbjct  184  WFGTLLIIVLCLFAAYLLAGIVYRFFFLGIRGIDIIPNLDFWVSLPRRTQSLCASLGRKF  243

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ HRSTYSPV F
Sbjct  244  KGPSEGHRSTYSPVNF  259



>gb|KEH34808.1| autophagy-related protein [Medicago truncatula]
Length=201

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   ++L  NCSLAVSV+C+ +   GPQTLE+ G C++ATEL+HPSGC  ++   G G G
Sbjct  66   KMSSSSLKYNCSLAVSVLCNVNGVQGPQTLERSGDCNYATELKHPSGCAMIVHVHGSGWG  125

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTLL+I+LCLF AYLL G++YRYFFL IRG ++IPNL+ W+SLP + QS   S+ ++F
Sbjct  126  WFGTLLVIVLCLFAAYLLAGIVYRYFFLKIRGTEVIPNLDLWTSLPRRTQSLCSSVVRKF  185

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ HRSTYSPV F
Sbjct  186  KGPSEGHRSTYSPVNF  201



>ref|XP_003600978.1| hypothetical protein MTR_3g071640 [Medicago truncatula]
 gb|AES71229.1| autophagy-related protein [Medicago truncatula]
Length=284

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   ++L  NCSLAVSV+C+ +   GPQTLE+ G C++ATEL+HPSGC  ++   G G G
Sbjct  149  KMSSSSLKYNCSLAVSVLCNVNGVQGPQTLERSGDCNYATELKHPSGCAMIVHVHGSGWG  208

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTLL+I+LCLF AYLL G++YRYFFL IRG ++IPNL+ W+SLP + QS   S+ ++F
Sbjct  209  WFGTLLVIVLCLFAAYLLAGIVYRYFFLKIRGTEVIPNLDLWTSLPRRTQSLCSSVVRKF  268

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ HRSTYSPV F
Sbjct  269  KGPSEGHRSTYSPVNF  284



>gb|KJB74365.1| hypothetical protein B456_011G290500 [Gossypium raimondii]
Length=201

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            + +CSL+VS++CD + A GP ++EK+GTCD+AT LRHPSGC  +IS  GKG GWFGTL+I
Sbjct  73   DPSCSLSVSILCDSNGAQGPDSVEKLGTCDYATTLRHPSGCATIISIGGKGFGWFGTLII  132

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            II+CLFGAYLL G +YRYFFL + GI+ IPNL+ W+SLPH+ Q +F S+ ++F GPS  H
Sbjct  133  IIICLFGAYLLAGTVYRYFFLGVHGIEAIPNLDLWASLPHRTQIFFSSLVRQFSGPSTSH  192

Query  300  RSTYSPVE  277
            R++YSPV 
Sbjct  193  RNSYSPVN  200



>gb|KHG25155.1| Autophagy-related 27 [Gossypium arboreum]
Length=279

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            + +CSL+VS++CD + A GP ++EK+GTCD+AT LRHPSGC  VIS  GKG GWFGTLLI
Sbjct  151  DPSCSLSVSIICDSNGAQGPDSVEKLGTCDYATTLRHPSGCATVISIGGKGFGWFGTLLI  210

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            II+CLFGAYLL G +YRYFFL + GI+ +PNL+ W+SLPH+ Q +F S+ ++F GPS  H
Sbjct  211  IIICLFGAYLLAGTVYRYFFLGVYGIEAVPNLDLWASLPHRTQIFFSSLVRQFSGPSTSH  270

Query  300  RSTYSPVE  277
            R++YSPV 
Sbjct  271  RNSYSPVN  278



>ref|XP_007008867.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 3 [Theobroma cacao]
 gb|EOY17677.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 3 [Theobroma cacao]
Length=201

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VS++CD     GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ II
Sbjct  75   NCSLSVSIICDSTGVQGPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTII  134

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCLFGAYLL G +YR+FFL +RG+++IPNLEFW+SL H+ QS+F S+ ++F GPS  HRS
Sbjct  135  LCLFGAYLLAGTVYRFFFLGVRGVEVIPNLEFWASLQHRTQSFFSSLVRKFSGPSAGHRS  194

Query  294  TYSPVEF  274
            +YS V F
Sbjct  195  SYSRVNF  201



>gb|KJB74366.1| hypothetical protein B456_011G290500 [Gossypium raimondii]
Length=279

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            + +CSL+VS++CD + A GP ++EK+GTCD+AT LRHPSGC  +IS  GKG GWFGTL+I
Sbjct  151  DPSCSLSVSILCDSNGAQGPDSVEKLGTCDYATTLRHPSGCATIISIGGKGFGWFGTLII  210

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            II+CLFGAYLL G +YRYFFL + GI+ IPNL+ W+SLPH+ Q +F S+ ++F GPS  H
Sbjct  211  IIICLFGAYLLAGTVYRYFFLGVHGIEAIPNLDLWASLPHRTQIFFSSLVRQFSGPSTSH  270

Query  300  RSTYSPVE  277
            R++YSPV 
Sbjct  271  RNSYSPVN  278



>gb|KHN31307.1| hypothetical protein glysoja_022961 [Glycine soja]
Length=356

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCSLAVSV+C+ +   GPQ LE++G CD+ TEL+HPSGC  +I+  G G G
Sbjct  221  KMSNSGPKYNCSLAVSVLCNLNGVQGPQALERLGACDYVTELKHPSGCAIIINVHGGGWG  280

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTLLII+LCLF AYLL G++YR+FFL IRGIDIIPNL+FW SLP + QS   S+ ++F
Sbjct  281  WFGTLLIIVLCLFAAYLLAGIVYRFFFLGIRGIDIIPNLDFWVSLPRRTQSLCTSLVRKF  340

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ +RS+YSPV F
Sbjct  341  KGPSEGYRSSYSPVNF  356



>ref|XP_007163579.1| hypothetical protein PHAVU_001G246100g [Phaseolus vulgaris]
 gb|ESW35573.1| hypothetical protein PHAVU_001G246100g [Phaseolus vulgaris]
Length=290

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCSLAVSV+C+ +   GPQ +E++G CD+  EL+HPSGC  +++  G GLG
Sbjct  155  KMSNSGPKFNCSLAVSVLCNLNGVQGPQAMERLGACDYVIELKHPSGCAIIVNVHGGGLG  214

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTLLII+LCLF AYLL G++YR+FFL IRG+DIIPNL+FW SLP + QS   S+ +RF
Sbjct  215  WFGTLLIIVLCLFAAYLLAGIVYRFFFLGIRGVDIIPNLDFWVSLPRRTQSLCASLVRRF  274

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ +RS+YSPV F
Sbjct  275  KGPSESYRSSYSPVNF  290



>gb|KDP44701.1| hypothetical protein JCGZ_01201 [Jatropha curcas]
Length=287

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N +CSL+VS++CD + A GP++LEK+GTCD+AT ++HPSGC  V+S  G G GWF TLLI
Sbjct  159  NQSCSLSVSILCDSNGAKGPESLEKLGTCDYATVMQHPSGCAMVVSVHGNGWGWFVTLLI  218

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFG Y+L G  YRYFFL IRG+D+IPNL+ W+ LP + QS+F S+ ++FRGP++ +
Sbjct  219  IILCLFGGYMLVGAAYRYFFLGIRGLDMIPNLDIWARLPQRTQSFFASLVRKFRGPTEGY  278

Query  300  RSTYSPVEF  274
            RS+YSPV F
Sbjct  279  RSSYSPVNF  287



>ref|XP_007008865.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 1 [Theobroma cacao]
 gb|EOY17675.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 1 [Theobroma cacao]
Length=282

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VS++CD     GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ II
Sbjct  156  NCSLSVSIICDSTGVQGPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTII  215

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCLFGAYLL G +YR+FFL +RG+++IPNLEFW+SL H+ QS+F S+ ++F GPS  HRS
Sbjct  216  LCLFGAYLLAGTVYRFFFLGVRGVEVIPNLEFWASLQHRTQSFFSSLVRKFSGPSAGHRS  275

Query  294  TYSPVEF  274
            +YS V F
Sbjct  276  SYSRVNF  282



>ref|XP_004148171.1| PREDICTED: uncharacterized protein LOC101220308 [Cucumis sativus]
 gb|KGN50697.1| hypothetical protein Csa_5G217160 [Cucumis sativus]
Length=281

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  +      CSL+VSV+C  D   GPQ LEK+G CD+AT LRHPSGC  ++    +G G
Sbjct  146  KMSNIDTKVKCSLSVSVICTTDGIQGPQILEKIGPCDYATSLRHPSGCAKIVHVHRRGWG  205

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            +FGT  IIILCLFG YLL G++YRYF L +RG+D+IPNLEFW SLPHK+QS F S+ ++F
Sbjct  206  FFGTFTIIILCLFGGYLLAGIVYRYFVLKVRGVDVIPNLEFWLSLPHKIQSLFASLVRKF  265

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ HR +YSPV F
Sbjct  266  KGPSRGHRDSYSPVNF  281



>ref|XP_008454838.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
 ref|XP_008454839.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
 ref|XP_008454840.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
Length=281

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  +      CSL+VSV+C  D    PQ LEK+G CD+AT LRHPSGC  +I    +G G
Sbjct  146  KMSNIGTKVKCSLSVSVICTTDGIQVPQILEKIGPCDYATSLRHPSGCAKIIHVHRRGWG  205

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            +FGT  IIILCLFG YLL G++YRYF L +RG+D+IPNLEFW SLPHK+QS F S+ ++F
Sbjct  206  FFGTFTIIILCLFGGYLLAGIVYRYFVLKVRGVDVIPNLEFWLSLPHKIQSLFASLVRKF  265

Query  321  RGPSQHHRSTYSPVEF  274
            +GPS+ HR +YSPV F
Sbjct  266  KGPSRGHRDSYSPVNF  281



>gb|KCW65717.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=205

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
             +NCSL+VS+VCD +   GP  LEK GTCD+AT LRHPSGC  +I   G G GWFG LLI
Sbjct  77   KSNCSLSVSIVCDPSRVQGPNLLEKSGTCDYATSLRHPSGCAKIIYVHGHGWGWFGILLI  136

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            I LCLFG YLL G +YRYF L + GID IPNLEFW+SLPH+ Q    S+ Q+FRGPS+ +
Sbjct  137  ISLCLFGGYLLAGTVYRYFMLGVHGIDAIPNLEFWASLPHRTQGLVMSLVQKFRGPSEGY  196

Query  300  RSTYSPVEF  274
            RS+Y+ V F
Sbjct  197  RSSYTSVGF  205



>ref|XP_006411288.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
 gb|ESQ52741.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
Length=214

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +    P TLEK GTC +ATELRHPSGC   IS  G G GWF TLLI
Sbjct  86   NQNCSLSVSVICQKNKVNVPLTLEKSGTCHYATELRHPSGCAAAISGHGSGWGWFSTLLI  145

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG++YRYF L IRG D+IPNL+FW+++PH+ QS F S+ QRF G S   
Sbjct  146  IILCLFGAYLLGGVLYRYFSLGIRGTDVIPNLDFWATVPHRTQSCFGSLFQRFGGSSHGQ  205

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  206  RTSYSQVNF  214



>gb|KCW65716.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=205

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
             +NCSL+VS+VCD +   GP  LEK GTCD+AT LRHPSGC  +I   G G GWFG LLI
Sbjct  77   KSNCSLSVSIVCDPSRVQGPNLLEKSGTCDYATSLRHPSGCAKIIYVHGHGWGWFGILLI  136

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            I LCLFG YLL G +YRYF L + GID IPNLEFW+SLPH+ Q    S+ Q+FRGPS+ +
Sbjct  137  ISLCLFGGYLLAGTVYRYFMLGVHGIDAIPNLEFWASLPHRTQGLVMSLVQKFRGPSEGY  196

Query  300  RSTYSPVEF  274
            RS+Y+ V F
Sbjct  197  RSSYTSVGF  205



>ref|XP_006411289.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
 gb|ESQ52742.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
Length=276

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +    P TLEK GTC +ATELRHPSGC   IS  G G GWF TLLI
Sbjct  148  NQNCSLSVSVICQKNKVNVPLTLEKSGTCHYATELRHPSGCAAAISGHGSGWGWFSTLLI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG++YRYF L IRG D+IPNL+FW+++PH+ QS F S+ QRF G S   
Sbjct  208  IILCLFGAYLLGGVLYRYFSLGIRGTDVIPNLDFWATVPHRTQSCFGSLFQRFGGSSHGQ  267

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  268  RTSYSQVNF  276



>ref|XP_002273745.2| PREDICTED: uncharacterized protein LOC100255420 [Vitis vinifera]
 emb|CBI25422.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 99/136 (73%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K      + NCSL+VSV+C+ +   GP +LE+ GTCD+ATE+RHPSGC  ++S  G+GLG
Sbjct  144  KMSSNGPDVNCSLSVSVICESNGVQGPYSLEQSGTCDYATEMRHPSGCAEIVSVHGRGLG  203

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WF T LII+ C  G YLL G +YR+FFL +RG+DIIPNL FW+SLP + QS   S+ ++F
Sbjct  204  WFSTFLIILFCFLGVYLLVGTVYRFFFLGVRGVDIIPNLGFWTSLPQRTQSSCASLVRKF  263

Query  321  RGPSQHHRSTYSPVEF  274
            RGPSQ HR +YS V F
Sbjct  264  RGPSQGHRDSYSAVNF  279



>ref|XP_008233814.1| PREDICTED: uncharacterized protein LOC103332832 isoform X2 [Prunus 
mume]
Length=261

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++ L  NCSL+VSV+CD +   GP +LEK G CD+AT L HPSGC  V+   G G G
Sbjct  125  KMSNSGLKRNCSLSVSVICDPNRVQGPHSLEKTGKCDYATVLTHPSGCAKVVHVHGHGWG  184

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTL  I+LCLFGAYLL G +YRYF L +RGI +IPNL+FW+SLP + QS F S+ ++F
Sbjct  185  WFGTLGTIVLCLFGAYLLAGAVYRYFSLGVRGIHVIPNLDFWTSLPQRTQSLFASLLRKF  244

Query  321  RG-PSQHHRSTYSPVEF  274
            RG  SQ HRS+YSPV F
Sbjct  245  RGSSSQGHRSSYSPVNF  261



>ref|XP_010067562.1| PREDICTED: uncharacterized protein LOC104454422 [Eucalyptus grandis]
 gb|KCW65715.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=282

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
             +NCSL+VS+VCD +   GP  LEK GTCD+AT LRHPSGC  +I   G G GWFG LLI
Sbjct  154  KSNCSLSVSIVCDPSRVQGPNLLEKSGTCDYATSLRHPSGCAKIIYVHGHGWGWFGILLI  213

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            I LCLFG YLL G +YRYF L + GID IPNLEFW+SLPH+ Q    S+ Q+FRGPS+ +
Sbjct  214  ISLCLFGGYLLAGTVYRYFMLGVHGIDAIPNLEFWASLPHRTQGLVMSLVQKFRGPSEGY  273

Query  300  RSTYSPVEF  274
            RS+Y+ V F
Sbjct  274  RSSYTSVGF  282



>gb|EPS63394.1| hypothetical protein M569_11391, partial [Genlisea aurea]
Length=190

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = -3

Query  711  RQQ*SPQRYXGKTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCG  535
            R++ SP        +     NCSL VSVVCD +   GP+TLE  G C+++TE++HP GC 
Sbjct  42   RERKSPHSGVIVMMNDGTRQNCSLYVSVVCDSNKVQGPRTLEVHGPCEYSTEIKHPLGCA  101

Query  534  GVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKV  355
             + S    G GWFGTL+IIILCLFGAYL+ G +YR+F LH+RG+D+IP+LE W+SLPH V
Sbjct  102  KITSHDRSGFGWFGTLMIIILCLFGAYLVAGAVYRHFVLHVRGLDVIPHLELWTSLPHTV  161

Query  354  QSWFQSIAQRFR--GPSQHHRSTYSPVEF  274
            QS FQS  +R    GPS  HRS+YSPV F
Sbjct  162  QSCFQSSMRRLSGGGPSHVHRSSYSPVNF  190



>ref|XP_008233813.1| PREDICTED: uncharacterized protein LOC103332832 isoform X1 [Prunus 
mume]
Length=279

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++ L  NCSL+VSV+CD +   GP +LEK G CD+AT L HPSGC  V+   G G G
Sbjct  143  KMSNSGLKRNCSLSVSVICDPNRVQGPHSLEKTGKCDYATVLTHPSGCAKVVHVHGHGWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTL  I+LCLFGAYLL G +YRYF L +RGI +IPNL+FW+SLP + QS F S+ ++F
Sbjct  203  WFGTLGTIVLCLFGAYLLAGAVYRYFSLGVRGIHVIPNLDFWTSLPQRTQSLFASLLRKF  262

Query  321  RG-PSQHHRSTYSPVEF  274
            RG  SQ HRS+YSPV F
Sbjct  263  RGSSSQGHRSSYSPVNF  279



>ref|XP_011003078.1| PREDICTED: uncharacterized protein LOC105109879 isoform X1 [Populus 
euphratica]
Length=283

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VSV+CD +   GP +LEK+GTCD+A  L+HPSGC   I+  GKG GWFGTL+I +
Sbjct  158  NCSLSVSVICDSNRVNGPHSLEKLGTCDYAAVLQHPSGCA-TINGHGKGWGWFGTLMITV  216

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
             CLFG YLL G +YR+F+L + G+D+IPNL+FW+ LPH+ Q +F S+ +RFRGP++ +R+
Sbjct  217  FCLFGGYLLAGAVYRHFYLGVHGLDMIPNLDFWTRLPHRTQGFFASLVRRFRGPTEGYRN  276

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  277  SYSPVNF  283



>emb|CDY18864.1| BnaC04g04860D [Brassica napus]
Length=275

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTCD+ATELRHPSGC   IS  G G GWF TLLI
Sbjct  148  NPNCSLSVSVICQKNKVDGPLTLTKSGTCDYATELRHPSGCAVAISGHGSGWGWFSTLLI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG +YRYF L IRGI++IPN +FW ++PH++QS F S+ QRFRG S   
Sbjct  208  IILCLFGAYLLGGSLYRYFSLGIRGIEVIPNSDFWVTVPHRIQSCFGSLFQRFRGSSHGQ  267

Query  300  RSTYSPVE  277
            +++YS V 
Sbjct  268  QASYSRVN  275



>ref|XP_010264548.1| PREDICTED: uncharacterized protein LOC104602522 isoform X3 [Nelumbo 
nucifera]
Length=230

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL VSV CD +   GP +LEK GTCD+AT L+HP+GC  +IS   +G GW GT++ II
Sbjct  104  NCSLTVSVFCDSNGVEGPYSLEKSGTCDYATILKHPAGCAKIISVHRRGWGWLGTIITII  163

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCL G YLL G +YR+FFL IRGI++IPNLEFW SLP + +S   S+ ++FRGPS+ +RS
Sbjct  164  LCLLGGYLLVGAVYRFFFLGIRGIEVIPNLEFWLSLPQRTKSLLGSLVRKFRGPSRGYRS  223

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  224  SYSPVNF  230



>ref|XP_009369219.1| PREDICTED: uncharacterized protein LOC103958653 isoform X2 [Pyrus 
x bretschneideri]
Length=260

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP  LEK G CD+AT L HPSGC  +    GK  G
Sbjct  125  KMSSSGLKFNCSLSVSVICDPNRVQGPHLLEKTGKCDYATVLTHPSGCAKIEHVHGKAWG  184

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTL IIILCLFGAYLL G  YRY  L +RGI I+PNL+FW+SLP   QS F S+  +F
Sbjct  185  WFGTLGIIILCLFGAYLLVGAAYRYIKLGVRGIHIMPNLDFWTSLPQSTQSLFASLLHKF  244

Query  321  RGPSQHHRSTYSPVEF  274
            RG S  HRSTYSPV+F
Sbjct  245  RGSSHGHRSTYSPVDF  260



>ref|XP_002879864.1| hypothetical protein ARALYDRAFT_903321 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56123.1| hypothetical protein ARALYDRAFT_903321 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLI
Sbjct  148  NQNCSLSVSVICQKNKVDGPLTLAKSGTCHYATQLRHPSGCAAAISGHSSGWGWFSTLLI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG +YRYF L IRGID+IPN+++W+++PH VQS F S+  RF G S+  
Sbjct  208  IILCLFGAYLLGGAVYRYFSLGIRGIDVIPNVDYWATVPHSVQSCFGSLFSRFGGSSRGQ  267

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  268  RTSYSQVNF  276



>ref|XP_010264547.1| PREDICTED: uncharacterized protein LOC104602522 isoform X2 [Nelumbo 
nucifera]
Length=262

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL VSV CD +   GP +LEK GTCD+AT L+HP+GC  +IS   +G GW GT++ II
Sbjct  136  NCSLTVSVFCDSNGVEGPYSLEKSGTCDYATILKHPAGCAKIISVHRRGWGWLGTIITII  195

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCL G YLL G +YR+FFL IRGI++IPNLEFW SLP + +S   S+ ++FRGPS+ +RS
Sbjct  196  LCLLGGYLLVGAVYRFFFLGIRGIEVIPNLEFWLSLPQRTKSLLGSLVRKFRGPSRGYRS  255

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  256  SYSPVNF  262



>ref|XP_009369218.1| PREDICTED: uncharacterized protein LOC103958653 isoform X1 [Pyrus 
x bretschneideri]
Length=278

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP  LEK G CD+AT L HPSGC  +    GK  G
Sbjct  143  KMSSSGLKFNCSLSVSVICDPNRVQGPHLLEKTGKCDYATVLTHPSGCAKIEHVHGKAWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTL IIILCLFGAYLL G  YRY  L +RGI I+PNL+FW+SLP   QS F S+  +F
Sbjct  203  WFGTLGIIILCLFGAYLLVGAAYRYIKLGVRGIHIMPNLDFWTSLPQSTQSLFASLLHKF  262

Query  321  RGPSQHHRSTYSPVEF  274
            RG S  HRSTYSPV+F
Sbjct  263  RGSSHGHRSTYSPVDF  278



>ref|XP_009345387.1| PREDICTED: uncharacterized protein LOC103937190 [Pyrus x bretschneideri]
Length=278

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP +LEK G CD+AT L HPSGC  +    G+G G
Sbjct  143  KMSSSGLKFNCSLSVSVICDPNRVQGPHSLEKTGKCDYATVLTHPSGCAKIEHVHGRGWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            W GTL IIILCLFGAYLL G  YRY  L +RGI IIPNL+FW+SLP   QS F S+  +F
Sbjct  203  WLGTLGIIILCLFGAYLLVGAGYRYIKLGVRGIHIIPNLDFWTSLPQSTQSLFASLMHKF  262

Query  321  RGPSQHHRSTYSPVEF  274
            RG S  HRSTYSPV+F
Sbjct  263  RGSSHGHRSTYSPVDF  278



>ref|XP_006294774.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
 gb|EOA27672.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
Length=214

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  +   N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G G
Sbjct  79   KMSNGNRNQNCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCVAAISGHSSGWG  138

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WF TLLIIILCLFGAYL+ G +YRYF L +RGID+IPN++FW+++PH+ QS F SI  RF
Sbjct  139  WFSTLLIIILCLFGAYLVAGAMYRYFSLGVRGIDVIPNVDFWATVPHRTQSCFGSIFSRF  198

Query  321  RGPSQHHRSTYSPVEF  274
             G S+  R++YS V F
Sbjct  199  GGSSRGQRTSYSQVNF  214



>ref|XP_010264546.1| PREDICTED: uncharacterized protein LOC104602522 isoform X1 [Nelumbo 
nucifera]
Length=280

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL VSV CD +   GP +LEK GTCD+AT L+HP+GC  +IS   +G GW GT++ II
Sbjct  154  NCSLTVSVFCDSNGVEGPYSLEKSGTCDYATILKHPAGCAKIISVHRRGWGWLGTIITII  213

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCL G YLL G +YR+FFL IRGI++IPNLEFW SLP + +S   S+ ++FRGPS+ +RS
Sbjct  214  LCLLGGYLLVGAVYRFFFLGIRGIEVIPNLEFWLSLPQRTKSLLGSLVRKFRGPSRGYRS  273

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  274  SYSPVNF  280



>ref|NP_001078029.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09813.1| uncharacterized protein AT2G40316 [Arabidopsis thaliana]
Length=195

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C      GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLI
Sbjct  67   NQNCSLSVSVICQKTKVDGPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLI  126

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYL+GG +YRYF L IRGID+IPN+++W+++PH +QS F S+  RF G  +  
Sbjct  127  IILCLFGAYLVGGAVYRYFSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQ  186

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  187  QTSYSQVNF  195



>gb|AAX55150.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
Length=214

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C      GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLI
Sbjct  86   NQNCSLSVSVICQKTKVDGPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLI  145

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYL+GG +YRYF L IRGID+IPN+++W+++PH +QS F S+  RF G  +  
Sbjct  146  IILCLFGAYLVGGAVYRYFSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQ  205

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  206  QTSYSQVNF  214



>ref|XP_006294775.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
 gb|EOA27673.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
Length=276

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  +   N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G G
Sbjct  141  KMSNGNRNQNCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCVAAISGHSSGWG  200

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WF TLLIIILCLFGAYL+ G +YRYF L +RGID+IPN++FW+++PH+ QS F SI  RF
Sbjct  201  WFSTLLIIILCLFGAYLVAGAMYRYFSLGVRGIDVIPNVDFWATVPHRTQSCFGSIFSRF  260

Query  321  RGPSQHHRSTYSPVEF  274
             G S+  R++YS V F
Sbjct  261  GGSSRGQRTSYSQVNF  276



>ref|XP_010692932.1| PREDICTED: uncharacterized protein LOC104905961 [Beta vulgaris 
subsp. vulgaris]
Length=297

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VS+VCD ++   P+TL+K+GTC +ATELRHP+GC   I+A   G GWFG LL I+
Sbjct  172  NCSLSVSIVCDKNSVKDPETLKKLGTCHYATELRHPAGCPK-IAAHATGWGWFGILLTIL  230

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LC  GAYLL G +YR+ +L IRG+D+IP+L+FW S+PH+++S F S+ QRFRGP+ HHRS
Sbjct  231  LCSIGAYLLIGGVYRFSYLGIRGLDVIPSLDFWISIPHRIKSVFMSLVQRFRGPTYHHRS  290

Query  294  TYSPVEF  274
            +YS V F
Sbjct  291  SYSSVNF  297



>gb|AAO86846.1| hypothetical protein [Arabidopsis thaliana]
Length=214

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C      GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLI
Sbjct  86   NQNCSLSVSVICXKTKVDGPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLI  145

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYL+GG +YRYF L IRGID+IPN+++W+++PH +QS F S+  RF G  +  
Sbjct  146  IILCLFGAYLVGGAVYRYFSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQ  205

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  206  QTSYSQVNF  214



>ref|XP_010505758.1| PREDICTED: uncharacterized protein LOC104782507 isoform X2 [Camelina 
sativa]
Length=214

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLI
Sbjct  86   NENCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWFSTLLI  145

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG  YRYF   IRGID+IPN++FW+++PH+ Q    SI  RF G S+  
Sbjct  146  IILCLFGAYLLGGAAYRYFSFGIRGIDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQ  205

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  206  RTSYSQVNF  214



>ref|XP_004307687.1| PREDICTED: uncharacterized protein LOC101315282 [Fragaria vesca 
subsp. vesca]
Length=278

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K     L  NCSL+VSV+CD +    P  LEK G CD+AT L+HPSGC  ++   GKG G
Sbjct  143  KMSSNGLKGNCSLSVSVMCDPNGVQEPYLLEKTGKCDYATMLKHPSGCAKIVHVYGKGWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WF T LIIILCLFG YLL G  YRYF L   GIDI+PNL+FW+ LP + QS   S+  +F
Sbjct  203  WFVTFLIIILCLFGVYLLAGAGYRYFSLGFHGIDILPNLDFWTGLPQQAQSVSASLLHKF  262

Query  321  RGPSQHHRSTYSPVEF  274
            RG SQ HRS+YSPV F
Sbjct  263  RGSSQVHRSSYSPVNF  278



>gb|AAY82253.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
Length=195

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C      GP TL K GTC + T+LRHP+GC   IS    G GWF TLLI
Sbjct  67   NQNCSLSVSVICQKTKVDGPLTLAKSGTCQYXTQLRHPAGCAAAISGHSSGWGWFSTLLI  126

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYL+GG +YRYF L IRGID+IPN+++W+++PH +QS F S+  RF G  +  
Sbjct  127  IILCLFGAYLVGGAVYRYFSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQ  186

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  187  QTSYSQVNF  195



>ref|NP_181562.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY82252.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
 dbj|BAE99557.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09812.1| uncharacterized protein AT2G40316 [Arabidopsis thaliana]
Length=276

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C      GP TL K GTC +AT+LRHP+GC   IS    G GWF TLLI
Sbjct  148  NQNCSLSVSVICQKTKVDGPLTLAKSGTCQYATQLRHPAGCAAAISGHSSGWGWFSTLLI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYL+GG +YRYF L IRGID+IPN+++W+++PH +QS F S+  RF G  +  
Sbjct  208  IILCLFGAYLVGGAVYRYFSLGIRGIDVIPNMDYWATVPHSIQSCFGSLFSRFGGSIRGQ  267

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  268  QTSYSQVNF  276



>ref|XP_009143226.1| PREDICTED: uncharacterized protein LOC103866960 isoform X2 [Brassica 
rapa]
Length=226

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTCD+ATE+RHPSGC   IS  G G G F TL+I
Sbjct  99   NPNCSLSVSVICQKNKVDGPFTLTKSGTCDYATEMRHPSGCAVAISGHGSGWGLFSTLVI  158

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG +YRYF L IRGI++IPN +FW ++PH++QS F S+ QRF G S   
Sbjct  159  IILCLFGAYLLGGALYRYFSLGIRGIEVIPNSDFWVTVPHRIQSCFGSLFQRFGGSSHGQ  218

Query  300  RSTYSPVE  277
            +++YS V 
Sbjct  219  QASYSRVN  226



>ref|XP_010505757.1| PREDICTED: uncharacterized protein LOC104782507 isoform X1 [Camelina 
sativa]
Length=276

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G GWF TLLI
Sbjct  148  NENCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWFSTLLI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG  YRYF   IRGID+IPN++FW+++PH+ Q    SI  RF G S+  
Sbjct  208  IILCLFGAYLLGGAAYRYFSFGIRGIDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQ  267

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  268  RTSYSQVNF  276



>ref|XP_009143225.1| PREDICTED: uncharacterized protein LOC103866960 isoform X1 [Brassica 
rapa]
Length=275

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTCD+ATE+RHPSGC   IS  G G G F TL+I
Sbjct  148  NPNCSLSVSVICQKNKVDGPFTLTKSGTCDYATEMRHPSGCAVAISGHGSGWGLFSTLVI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCLFGAYLLGG +YRYF L IRGI++IPN +FW ++PH++QS F S+ QRF G S   
Sbjct  208  IILCLFGAYLLGGALYRYFSLGIRGIEVIPNSDFWVTVPHRIQSCFGSLFQRFGGSSHGQ  267

Query  300  RSTYSPVE  277
            +++YS V 
Sbjct  268  QASYSRVN  275



>ref|XP_006847437.1| hypothetical protein AMTR_s00153p00085570 [Amborella trichopoda]
 gb|ERN09018.1| hypothetical protein AMTR_s00153p00085570 [Amborella trichopoda]
Length=279

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -3

Query  666  TALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGT  490
            ++ N+NCSL+VSVVCD + A GP +LE +GTCD+AT LRHP+GC  VIS  G   GWFGT
Sbjct  148  SSYNSNCSLSVSVVCDTNRALGPNSLELLGTCDYATVLRHPAGCAKVISLDGNEWGWFGT  207

Query  489  LLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPS  310
            L+ II+CLFGAY L GM+YR+FFL I+G++++PNLEFW SLP + Q+   +I +R    +
Sbjct  208  LITIIVCLFGAYFLVGMVYRFFFLGIQGVEVVPNLEFWLSLPRRSQNLVGAIWRRTGRQA  267

Query  309  QHHRSTYSPVEF  274
            Q  RS+YS + F
Sbjct  268  QASRSSYSTLNF  279



>ref|XP_010508882.1| PREDICTED: uncharacterized protein LOC104785377 isoform X2 [Camelina 
sativa]
Length=214

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS+   G GWF TLLI
Sbjct  86   NENCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCAAAISSHRSGWGWFSTLLI  145

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            II+CLFGAYLLGG  YRYF L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  
Sbjct  146  IIVCLFGAYLLGGAAYRYFSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQ  205

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  206  QASYSQVNF  214



>ref|XP_008363772.1| PREDICTED: uncharacterized protein LOC103427491 isoform X2 [Malus 
domestica]
Length=260

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP  LEK G CD+AT L HPSGC  +    G+  G
Sbjct  125  KMSSSGLKFNCSLSVSVICDPNRVQGPHLLEKTGKCDYATVLTHPSGCAKIEYVHGRAWG  184

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTL IIILCLFGAYLL G  YRY  L +RGI IIPNL+FW++L    QS F S+  +F
Sbjct  185  WFGTLGIIILCLFGAYLLVGAAYRYIKLGVRGIHIIPNLDFWTTLRQSTQSLFASLLHKF  244

Query  321  RGPSQHHRSTYSPVEF  274
             G S  HRSTYSPV F
Sbjct  245  XGSSHGHRSTYSPVNF  260



>ref|XP_008804113.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804114.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804115.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
Length=201

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = -3

Query  666  TALNTNCSLAVSVVCDDAATG-PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGT  490
             +L  NCSL+VSV CD   T  P +L   G+CD+AT LRHPSGC  VIS  G GLGWFGT
Sbjct  70   NSLEKNCSLSVSVFCDSVKTHVPNSLNISGSCDYATVLRHPSGCAKVISVNGNGLGWFGT  129

Query  489  LLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPS  310
            L+IIILCL G Y+L G IYR+FFL I G + IPN+EFW SLP + +S   S+ +RFRG +
Sbjct  130  LIIIILCLVGGYILIGTIYRFFFLGIHGAEAIPNMEFWFSLPQRARSMLGSLVRRFRGHT  189

Query  309  QHHRSTYSPVE  277
            +  R +Y+P+ 
Sbjct  190  RDSRGSYAPMN  200



>ref|XP_008363771.1| PREDICTED: uncharacterized protein LOC103427491 isoform X1 [Malus 
domestica]
Length=278

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP  LEK G CD+AT L HPSGC  +    G+  G
Sbjct  143  KMSSSGLKFNCSLSVSVICDPNRVQGPHLLEKTGKCDYATVLTHPSGCAKIEYVHGRAWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGTL IIILCLFGAYLL G  YRY  L +RGI IIPNL+FW++L    QS F S+  +F
Sbjct  203  WFGTLGIIILCLFGAYLLVGAAYRYIKLGVRGIHIIPNLDFWTTLRQSTQSLFASLLHKF  262

Query  321  RGPSQHHRSTYSPVEF  274
             G S  HRSTYSPV F
Sbjct  263  XGSSHGHRSTYSPVNF  278



>ref|XP_010508881.1| PREDICTED: uncharacterized protein LOC104785377 isoform X1 [Camelina 
sativa]
Length=276

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS+   G GWF TLLI
Sbjct  148  NENCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCAAAISSHRSGWGWFSTLLI  207

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            II+CLFGAYLLGG  YRYF L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  
Sbjct  208  IIVCLFGAYLLGGAAYRYFSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQ  267

Query  300  RSTYSPVEF  274
            +++YS V F
Sbjct  268  QASYSQVNF  276



>ref|XP_010534619.1| PREDICTED: uncharacterized protein LOC104810122 [Tarenaya hassleriana]
Length=276

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCS++VSV+C  +   GP  LEK G C +ATELRHPSGC   +S  G G GWFGTLLIII
Sbjct  150  NCSVSVSVICQTNKVDGPIKLEKSGACHYATELRHPSGCASAVSGHGGGWGWFGTLLIII  209

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            LCLFGAY L G +YRY  L +RGID+IPNL+FW+++P  +QS F S+ QR RGPS  HRS
Sbjct  210  LCLFGAYFLAGAVYRYSALGVRGIDVIPNLDFWTTVPRGIQSLFASVVQRIRGPSYGHRS  269

Query  294  TYSPVEF  274
            +YSPV F
Sbjct  270  SYSPVNF  276



>ref|XP_008804111.1| PREDICTED: uncharacterized protein LOC103717482 isoform X1 [Phoenix 
dactylifera]
Length=280

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = -3

Query  666  TALNTNCSLAVSVVCDDAATG-PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGT  490
             +L  NCSL+VSV CD   T  P +L   G+CD+AT LRHPSGC  VIS  G GLGWFGT
Sbjct  149  NSLEKNCSLSVSVFCDSVKTHVPNSLNISGSCDYATVLRHPSGCAKVISVNGNGLGWFGT  208

Query  489  LLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPS  310
            L+IIILCL G Y+L G IYR+FFL I G + IPN+EFW SLP + +S   S+ +RFRG +
Sbjct  209  LIIIILCLVGGYILIGTIYRFFFLGIHGAEAIPNMEFWFSLPQRARSMLGSLVRRFRGHT  268

Query  309  QHHRSTYSPVE  277
            +  R +Y+P+ 
Sbjct  269  RDSRGSYAPMN  279



>gb|KFK36924.1| hypothetical protein AALP_AA4G190300 [Arabis alpina]
Length=276

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGT-CDFATELRHPSGCGGVISAKGKGL  505
            K    ++N NCSL+VSV+C  +   GP T+ K  T C +ATELRHPSGC   IS  G G 
Sbjct  140  KMSSGSMNQNCSLSVSVICQKNKVDGPLTMVKSNTSCHYATELRHPSGCAVAISGHGSGW  199

Query  504  GWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQR  325
            GWF TLLIII+CLFG YL+GG +YR+F L IRG D+IPN++FW ++P ++QS F S+ QR
Sbjct  200  GWFSTLLIIIICLFGTYLIGGSLYRHFSLGIRGTDVIPNIDFWVTVPLRIQSCFGSLFQR  259

Query  324  FRGPSQHHRSTYSPVEF  274
            F G S + R++YS V F
Sbjct  260  FGGSSHNQRTSYSQVNF  276



>ref|XP_006435816.1| hypothetical protein CICLE_v10032369mg [Citrus clementina]
 ref|XP_006486247.1| PREDICTED: uncharacterized protein LOC102610808 [Citrus sinensis]
 gb|ESR49056.1| hypothetical protein CICLE_v10032369mg [Citrus clementina]
Length=275

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  H+    +CSL+VSV+CD +   GPQ++EK+GTC++ATE+RHPSGC  +I A+G G G
Sbjct  140  KMTHSGPKYSCSLSVSVICDSNGLQGPQSMEKLGTCNYATEIRHPSGCATIIPAEGGGWG  199

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRF  322
            WFGT + +ILCLFG YLL G  YRYFFL I G+  +PNL+FW S+ H++Q++F S  +RF
Sbjct  200  WFGTFVTVILCLFGIYLLAGTAYRYFFLGIHGLHALPNLDFWGSILHRMQNFFASFVRRF  259

Query  321  RGPSQHHRSTYSPVEF  274
            RGPS+ HRSTYS + F
Sbjct  260  RGPSEGHRSTYSRINF  275



>ref|XP_007008868.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 4 [Theobroma cacao]
 gb|EOY17678.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 4 [Theobroma cacao]
Length=274

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 5/108 (5%)
 Frame = -3

Query  651  NCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VS++CD     GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ II
Sbjct  156  NCSLSVSIICDSTGVQGPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTII  215

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ----SWF  343
            LCLFGAYLL G +YR+FFL +RG+++IPNLEFW+SL H+ Q    SW+
Sbjct  216  LCLFGAYLLAGTVYRFFFLGVRGVEVIPNLEFWASLQHRTQVPLVSWY  263



>ref|XP_002311247.2| hypothetical protein POPTR_0008s07320g [Populus trichocarpa]
 gb|EEE88614.2| hypothetical protein POPTR_0008s07320g [Populus trichocarpa]
Length=354

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 101/171 (59%), Gaps = 46/171 (27%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VSV+CD +   GP +LEK+GTCD+A  L+HPSGC   I+  GKG GWFGTL+II+
Sbjct  185  NCSLSVSVICDSNRVHGPHSLEKLGTCDYAAVLQHPSGCA-TINGHGKGWGWFGTLMIIV  243

Query  474  LCLFGAYLLGGMIYRYFFLHIRGID-----------------------------------  400
             CLFG Y L G +YR+F++ + G+D                                   
Sbjct  244  FCLFGGYFLAGAVYRHFYIGVHGLDQYCPVSNFIPVKQLIRWFKSSDFRDRHCLCCGIRV  303

Query  399  ---------IIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  274
                     +IPNL+FW+ LPH+ QS+F S+ +RFRGP++ +RS+YSPV F
Sbjct  304  PHCGLIRDLMIPNLDFWTRLPHRTQSFFASLVRRFRGPTEGYRSSYSPVNF  354



>ref|XP_004173078.1| PREDICTED: uncharacterized protein LOC101226795, partial [Cucumis 
sativus]
Length=98

 Score =   139 bits (350),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -3

Query  567  ATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPN  388
            AT LRHPSGC  ++    +G G+FGT  IIILCLFG YLL G++YRYF L +RG+D+IPN
Sbjct  1    ATSLRHPSGCAKIVHVHRRGWGFFGTFTIIILCLFGGYLLAGIVYRYFVLKVRGVDVIPN  60

Query  387  LEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  274
            LEFW SLPHK+QS F S+ ++F+GPS+ HR +YSPV F
Sbjct  61   LEFWLSLPHKIQSLFASLVRKFKGPSRGHRDSYSPVNF  98



>gb|AAD25948.1|AF085279_21 hypothetical protein [Arabidopsis thaliana]
 gb|AAM15352.1| hypothetical protein [Arabidopsis thaliana]
Length=142

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAAT-GPQTLEKVGTCDF--ATELRHPSGCGGVISAKGKGLGWFGTL  487
            N NCSL+VSV+C      GP TL K GTC +  AT+LRHP+GC   IS    G GWF TL
Sbjct  21   NQNCSLSVSVICQKTKVDGPLTLAKSGTCQYVSATQLRHPAGCAAAISGHSSGWGWFSTL  80

Query  486  LIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
            LIIILCLFGAYL+GG +YRYF L IRGID+IPN+++W+++PH +Q  F
Sbjct  81   LIIILCLFGAYLVGGAVYRYFSLGIRGIDVIPNMDYWATVPHSIQVLF  128



>ref|XP_009416304.1| PREDICTED: uncharacterized protein LOC103996952 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 5/147 (3%)
 Frame = -3

Query  708  QQ*SPQR-YXGKTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCG  535
             Q SPQ+    KT       NCSL+VSV CD + A    T    G CD+A  LRHPSGC 
Sbjct  135  DQNSPQKGVVVKTSSIGPKVNCSLSVSVFCDSNEAQVSDTFNITGNCDYAVVLRHPSGCA  194

Query  534  GVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKV  355
             VI   GKG GWFGTL++IILCL   Y+L G IYR+FFL I+GI+ IPNLEFW SLP+K 
Sbjct  195  KVIYVNGKGWGWFGTLMMIILCLLVGYVLVGTIYRFFFLGIQGIEAIPNLEFWLSLPYKA  254

Query  354  QSWFQSIAQRFRGPSQHHRSTYSPVEF  274
             S  + + +RF   S+  R +Y+PV +
Sbjct  255  SSMLRGLVRRF---SRDSRGSYAPVNY  278



>emb|CDX74798.1| BnaA05g05440D [Brassica napus]
Length=288

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTCD+ATE+RHPSGC   IS  G G G F TLLI
Sbjct  149  NPNCSLSVSVICQKNKVDGPLTLTKSGTCDYATEMRHPSGCAVAISGHGSGWGLFSTLLI  208

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ-SWF  343
            IILCLFGAYLLGG +YRYF L IRGI++IPN +FW ++PH++Q  WF
Sbjct  209  IILCLFGAYLLGGSLYRYFSLGIRGIEVIPNSDFWVTVPHRIQLLWF  255



>ref|XP_007219770.1| hypothetical protein PRUPE_ppa025595mg, partial [Prunus persica]
 gb|EMJ20969.1| hypothetical protein PRUPE_ppa025595mg, partial [Prunus persica]
Length=175

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++ L  NCSL+VSV+CD +   GP +LEK G CD+AT L HPSGC  V+   G   G
Sbjct  66   KMSNSGLKLNCSLSVSVICDPNRVQGPHSLEKTGKCDYATVLTHPSGCAKVVHVHGHWWG  125

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ  352
            WFGTL  I+LCLFGAYLL G +Y+YF L +RGI +IPNL+FW+SLP + Q
Sbjct  126  WFGTLGTIVLCLFGAYLLAGAVYQYFSLGVRGIHVIPNLDFWTSLPQRTQ  175



>ref|XP_010517450.1| PREDICTED: uncharacterized protein LOC104792889 isoform X2 [Camelina 
sativa]
Length=214

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G GW  TLLI
Sbjct  86   NENCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWSSTLLI  145

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCL GAYLLGG  YRYF L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  
Sbjct  146  IILCLLGAYLLGGSAYRYFSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQ  205

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  206  RTSYSQVNF  214



>ref|XP_010517449.1| PREDICTED: uncharacterized protein LOC104792889 isoform X1 [Camelina 
sativa]
Length=271

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = -3

Query  657  NTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            N NCSL+VSV+C  +   GP TL K GTC +AT+LRHPSGC   IS    G GW  TLLI
Sbjct  143  NENCSLSVSVICQKNKVDGPLTLVKSGTCHYATQLRHPSGCAAAISGHRSGWGWSSTLLI  202

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHH  301
            IILCL GAYLLGG  YRYF L IRG D+IPN++FW+++PH+ Q    SI  RF G S+  
Sbjct  203  IILCLLGAYLLGGSAYRYFSLGIRGTDVIPNVDFWATIPHRTQGCCGSIFSRFGGSSRGQ  262

Query  300  RSTYSPVEF  274
            R++YS V F
Sbjct  263  RTSYSQVNF  271



>ref|XP_010921016.1| PREDICTED: uncharacterized protein LOC105044726 [Elaeis guineensis]
Length=280

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = -3

Query  648  CSLAVSVVCDDAATG-PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIIL  472
            CSL+VSV CD   T  P +L   G+CD+AT LRHPSGC  V S  GKGLGWFGTL+IIIL
Sbjct  155  CSLSVSVFCDSVKTQVPNSLNISGSCDYATMLRHPSGCAKVSSVNGKGLGWFGTLIIIIL  214

Query  471  CLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRST  292
            CL G Y+L G IYR+FFL I G + IPN+EFW SLP + +    S+ +RFRG ++  R +
Sbjct  215  CLLGGYILVGTIYRFFFLGIHGAEAIPNVEFWLSLPQRARGMLDSLGRRFRGHTRDGRGS  274

Query  291  YSPVEF  274
            Y+P+ +
Sbjct  275  YAPMNY  280



>ref|XP_003558130.1| PREDICTED: uncharacterized protein LOC100823098 [Brachypodium 
distachyon]
Length=282

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 2/130 (2%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++V V CD A A       + G CD+ T LRHPSGC   +SA G G GW GT  
Sbjct  152  FSSKCSISVLVFCDSAVAELSDKFSQSGNCDYVTILRHPSGCARSVSASGNGWGWLGTSF  211

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQH  304
            I ILCL G Y+L G IYRY+FL I  I+ IPNLEFW SLP KV+S F S  +  R  S+ 
Sbjct  212  ITILCLLGGYILIGAIYRYYFLGIHSIEAIPNLEFWISLPQKVKSMFVSSTRNPRSRSRD  271

Query  303  HRSTYS-PVE  277
             R  Y+ PV 
Sbjct  272  SRGPYATPVN  281



>dbj|BAJ90180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++V + CD A A  P+   + G+CD+ T LRHPSGC   +S  G G GW GT  
Sbjct  151  FSSKCSISVFIFCDSAVAQLPEKFSQSGSCDYVTILRHPSGCARSVSDTGNGWGWLGTSF  210

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQH  304
            I I+CL G Y+L G IYRY+F+ I  ++ IPNLEFW SLP +++S F    +  R  S+ 
Sbjct  211  ITIVCLLGGYILIGAIYRYYFVGIHSVEAIPNLEFWISLPQRIKSMFVRSRRNPRSQSRD  270

Query  303  HRSTYSPVE  277
             R  Y+ V 
Sbjct  271  SRGPYTTVN  279



>ref|XP_007008869.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 ref|XP_007008870.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 gb|EOY17679.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 gb|EOY17680.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
Length=284

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = -3

Query  651  NCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL+VS++CD     GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ II
Sbjct  156  NCSLSVSIICDSTGVQGPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTII  215

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDI  397
            LCLFGAYLL G +YR+FFL +RG+++
Sbjct  216  LCLFGAYLLAGTVYRFFFLGVRGVEV  241



>ref|XP_010087539.1| hypothetical protein L484_006944 [Morus notabilis]
 gb|EXB29270.1| hypothetical protein L484_006944 [Morus notabilis]
Length=257

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSL VSV+CD +   GP +L + GTC +ATEL+HPSGC  V +   KG GWF TL++II
Sbjct  159  NCSLTVSVICDANGVQGPYSLNRTGTCAYATELKHPSGCAEVANINAKGWGWFSTLILII  218

Query  474  LCLFGAYLLGGMIYRYFFLHIRGID  400
            +CLFGAYLL G +YRYFFL IRGI+
Sbjct  219  VCLFGAYLLAGAVYRYFFLGIRGIE  243



>ref|NP_001183686.1| uncharacterized protein LOC100502280 precursor [Zea mays]
 gb|ACR37963.1| unknown [Zea mays]
 tpg|DAA44896.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
 tpg|DAA44897.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=283

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 1/128 (1%)
 Frame = -3

Query  660  LNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++VSV+CD +A   P      G CD+AT L HPSGC   +SA G G GW  TL 
Sbjct  154  FSSKCSISVSVICDSNAIQVPDKFVLSGLCDYATTLEHPSGCPRSVSASGSGWGWLSTLF  213

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQH  304
            I ILCL G Y+L G +YRY+FL I  ++ IPNLEFW  LP ++++ F    +     S+ 
Sbjct  214  ITILCLLGGYILIGAVYRYYFLGIHSVEAIPNLEFWIGLPQRIKTVFVPATRSHVSYSRD  273

Query  303  HRSTYSPV  280
               T +PV
Sbjct  274  GLGTDAPV  281



>gb|AFK44428.1| unknown [Lotus japonicus]
Length=243

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            NCSLAVSV+C+ +    P TLEK+G C++ATE++HPSGC  ++S  G+G GWFGTL+ II
Sbjct  153  NCSLAVSVLCNVNRVQAPHTLEKLGACNYATEIKHPSGCATIVSVHGRGWGWFGTLITII  212

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDI  397
            LCLF AYLL G+ YR FFL IRGID+
Sbjct  213  LCLFAAYLLAGIAYR-FFLGIRGIDV  237



>ref|XP_006651281.1| PREDICTED: uncharacterized protein LOC102717143 [Oryza brachyantha]
Length=440

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDAATGPQT-LEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++V + CD       T     G+CD+AT LRHPSGC   ++A G G GW     
Sbjct  311  FSSKCSISVYIFCDTTVAQVSTEFVLSGSCDYATTLRHPSGCARSMAASGNGWGWLAISF  370

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQH  304
            + I CL G Y+L G +YRY+FL I  ++ IPNLEFW SLP  ++S     A+  RG ++ 
Sbjct  371  VTIFCLLGGYILSGAVYRYYFLGIHSVEAIPNLEFWISLPQTIKSMLLPSARSARGRNRQ  430

Query  303  HRSTYSPVE  277
                Y+PV+
Sbjct  431  IEDPYAPVD  439



>ref|XP_004984880.1| PREDICTED: uncharacterized protein LOC101783634 isoform X1 [Setaria 
italica]
Length=289

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  NCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
             CS++VSV+CD + A  P      G CD+AT  +HPSGC   +SA G G GW GTL I I
Sbjct  163  KCSISVSVLCDSSVAQVPDKFVVSGRCDYATTFKHPSGCARSVSASGSGWGWLGTLFITI  222

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRS  295
            + L G Y+L G +YRY+FL +  ++ IPNL+FW SLP ++++ F    +     ++    
Sbjct  223  MSLLGGYILLGAVYRYYFLGLHSVEAIPNLDFWISLPRRIKTMFVPATRSRISYNRDGLG  282

Query  294  TYSPVE  277
             Y+P  
Sbjct  283  AYAPAN  288



>ref|NP_001049832.1| Os03g0296700 [Oryza sativa Japonica Group]
 gb|ABF95446.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11746.1| Os03g0296700 [Oryza sativa Japonica Group]
Length=264

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++V + CD   A         G+CD+AT LRHPSGC   +SA G G GW  T  
Sbjct  153  FSSKCSISVYIYCDSTVAHVSDQFVLSGSCDYATTLRHPSGCAQSMSASGNGWGWLATSF  212

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ  352
            + ILCL G Y+L G IYRY+FL I  ++ IPNLEFW SLP  ++
Sbjct  213  VTILCLLGGYILIGSIYRYYFLGIHSVEAIPNLEFWISLPQTIK  256



>ref|XP_008343653.1| PREDICTED: uncharacterized protein LOC103406452 [Malus domestica]
Length=262

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP +LEK G CD+AT L HPSGC  +    G+G G
Sbjct  143  KMSSSGLKFNCSLSVSVICDPNRVQGPHSLEKTGKCDYATVLTHPSGCAKIEHVHGRGWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGI  403
            W GTL IIILCLFGAYLL G  YRY  L +RGI
Sbjct  203  WLGTLGIIILCLFGAYLLVGAGYRYIKLGVRGI  235



>emb|CAN76264.1| hypothetical protein VITISV_001854 [Vitis vinifera]
Length=297

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 79/170 (46%), Gaps = 51/170 (30%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCDDAAT-----------------------------------G  604
            K      + NCSL+VSV+C+                                       G
Sbjct  144  KMSSNGPDVNCSLSVSVICESNGVQFNTTGCALNHHIRVVEDLPIRLSGGQGSSQEVLHG  203

Query  603  PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYF  424
               +++V     ATE+RHPSGC  ++S  G+GLGWF T LII+ C  G YLL G +YR+F
Sbjct  204  EAMMDQVFGKYGATEMRHPSGCAEIVSVHGRGLGWFSTFLIILFCFLGVYLLVGTVYRFF  263

Query  423  FLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  274
            FL +RG+D                S   S+ ++FRGPSQ HR +YS V F
Sbjct  264  FLGVRGVD----------------SSCASLVRKFRGPSQGHRDSYSAVNF  297



>ref|XP_008374955.1| PREDICTED: uncharacterized protein LOC103438201 [Malus domestica]
Length=246

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K   + L  NCSL+VSV+CD +   GP +LEK G CD+AT L HPSGC  +    G+G G
Sbjct  143  KMSSSGLKFNCSLSVSVICDPNRVQGPHSLEKTGKCDYATVLTHPSGCAKIEHVHGRGWG  202

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFL  418
            W GTL IIILCLFGAYLL G +  + FL
Sbjct  203  WLGTLGIIILCLFGAYLLVGAVLWWVFL  230



>gb|ACU20834.1| unknown [Glycine max]
Length=243

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            K  ++    NCSLAVSV+C+ +   GPQ LE++G CD+ TEL+HPSGC  +I+  G G G
Sbjct  147  KMSNSGPKYNCSLAVSVLCNLNGVQGPQALERLGACDYVTELKHPSGCAIIINVHGGGWG  206

Query  501  WFGTLLIIILCLFGAYLLG  445
            WFGTLLII+LCLF    LG
Sbjct  207  WFGTLLIIVLCLFCCISLG  225



>gb|EMT00564.1| hypothetical protein F775_08095 [Aegilops tauschii]
Length=276

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDA-ATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++V + CD A A  P    + G+CD+ T LRHPSGC   +S  G G GW GT  
Sbjct  156  FSSKCSISVFIFCDSAVAQLPDKFTQSGSCDYVTILRHPSGCARSVSDAGNGWGWLGTSF  215

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDI  397
            I ILCL G Y+L G IYRY+FL I  +++
Sbjct  216  ITILCLLGGYILIGAIYRYYFLGIHSVEL  244



>ref|XP_008647628.1| PREDICTED: uncharacterized protein LOC100502280 isoform X1 [Zea 
mays]
Length=335

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 67/128 (52%), Gaps = 19/128 (15%)
 Frame = -3

Query  660  LNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++VSV+CD +A   P      G CD+AT L HPSGC                  
Sbjct  224  FSSKCSISVSVICDSNAIQVPDKFVLSGLCDYATTLEHPSGCPR----------------  267

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQH  304
              ILCL G Y+L G +YRY+FL I  ++ IPNLEFW  LP ++++ F    +     S+ 
Sbjct  268  --ILCLLGGYILIGAVYRYYFLGIHSVEAIPNLEFWIGLPQRIKTVFVPATRSHVSYSRD  325

Query  303  HRSTYSPV  280
               T +PV
Sbjct  326  GLGTDAPV  333



>ref|XP_002979286.1| hypothetical protein SELMODRAFT_110390, partial [Selaginella 
moellendorffii]
 gb|EFJ19694.1| hypothetical protein SELMODRAFT_110390, partial [Selaginella 
moellendorffii]
Length=169

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -3

Query  648  CSLAVSVVCDDAATGPQTLEKV---GTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            CS +VSV C    TG Q L        C +   L+HP+GC  V    G GLGWF TLLI+
Sbjct  61   CSFSVSVYCK--RTGQQELPTSVAGDGCHYTAVLKHPAGCPVVTRLDGGGLGWFSTLLIV  118

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
            +LC    Y++   IYR   L I G++ IP+++FW S+P  +Q  +
Sbjct  119  LLCFLVVYMIAATIYRRKALGIVGVEAIPHMDFWRSIPSNIQVCY  163



>ref|XP_001756445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78841.1| predicted protein [Physcomitrella patens]
Length=434

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 3/103 (3%)
 Frame = -3

Query  651  NCSLAVSVVCDDAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            NCS +V V C  +   P      GT   C+  T L+HP+GC  V +   KG GWFG+LL 
Sbjct  305  NCSFSVLVYCSHSGFEPPKTAMNGTSGECNLETALKHPAGCPVVTNMSKKGWGWFGSLLF  364

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ  352
            ++L +F  Y+  G+ YR   L   G + IPNL+ W +LP K+Q
Sbjct  365  MLLLIFVVYVAVGIGYRVTVLGASGFEAIPNLDTWRALPSKIQ  407



>ref|XP_002520790.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41499.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            NCSL+VSV+C+ + A GP +LEK GTCD+A  L+HPSGC  ++S  G+G GWF TLLI+
Sbjct  162  NCSLSVSVICNSNGAQGPHSLEKTGTCDYAAALQHPSGCATIVSVHGQGWGWFSTLLIM  220



>ref|XP_001759768.1| predicted protein [Physcomitrella patens]
 gb|EDQ75272.1| predicted protein [Physcomitrella patens]
Length=208

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 7/118 (6%)
 Frame = -3

Query  690  RYXGKTYHTALNTNCSLAVSVVCDDAATGPQTLEKV-----GTCDFATELRHPSGCGGVI  526
            R    T +     +CS +V V C  + +G +   KV     G CD+ T L+HP+GC  V 
Sbjct  81   RVKMTTCNKNAKPDCSFSVLVYC--SRSGIEVPTKVTNITSGVCDYETILKHPAGCPVVT  138

Query  525  SAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ  352
            +    G GWFG+L  ++L  F  Y+  G+ YR   L + G + IPNL+ W +LP K+Q
Sbjct  139  NVSKGGWGWFGSLFFMLLLAFVVYMAVGIGYRVTVLGVSGFEAIPNLDTWRTLPSKIQ  196



>ref|XP_007008866.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 2 [Theobroma cacao]
 gb|EOY17676.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 2 [Theobroma cacao]
Length=214

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  651  NCSLAVSVVCDDAAT-GPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            NCSL+VS++CD     GP ++EK+GTCD+AT LRHPSGC  +IS   KG GWF TL+ +
Sbjct  156  NCSLSVSIICDSTGVQGPNSMEKLGTCDYATVLRHPSGCATIISFHEKGFGWFCTLMTM  214



>ref|XP_011003184.1| PREDICTED: uncharacterized protein LOC105109879 isoform X2 [Populus 
euphratica]
Length=215

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
            NCSL+VSV+CD +   GP +LEK+GTCD+A  L+HPSGC   I+  GKG GWFGTL+I
Sbjct  158  NCSLSVSVICDSNRVNGPHSLEKLGTCDYAAVLQHPSGC-ATINGHGKGWGWFGTLMI  214



>gb|EEC75047.1| hypothetical protein OsI_11153 [Oryza sativa Indica Group]
Length=239

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 12/88 (14%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
             ++ CS++V + CD             T   AT LRHPSGC   +SA G G GW  T  +
Sbjct  153  FSSKCSISVYIYCDS------------TVAHATTLRHPSGCAQSMSASGNGWGWLATSFV  200

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDI  397
             ILCL G Y+L G IYRY+FL I  +++
Sbjct  201  TILCLLGGYILIGSIYRYYFLGIHSVEV  228



>gb|EEE58880.1| hypothetical protein OsJ_10490 [Oryza sativa Japonica Group]
Length=239

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 12/88 (14%)
 Frame = -3

Query  660  LNTNCSLAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLI  481
             ++ CS++V + CD             T   AT LRHPSGC   +SA G G GW  T  +
Sbjct  153  FSSKCSISVYIYCDS------------TVAHATTLRHPSGCAQSMSASGNGWGWLATSFV  200

Query  480  IILCLFGAYLLGGMIYRYFFLHIRGIDI  397
             ILCL G Y+L G IYRY+FL I  +++
Sbjct  201  TILCLLGGYILIGSIYRYYFLGIHSVEV  228



>gb|KDO68854.1| hypothetical protein CISIN_1g037714mg, partial [Citrus sinensis]
Length=204

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -3

Query  678  KTYHTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAK  517
            K  H+    +CSL+VSV+CD +   GPQ++EK+GTC++ATE+RHPSGC  +I A+
Sbjct  140  KMTHSGPKYSCSLSVSVICDLNGLQGPQSMEKLGTCNYATEIRHPSGCATIIPAE  194



>dbj|GAD91664.1| vacuolar sorting receptor (Mrl1), putative [Byssochlamys spectabilis 
No. 5]
Length=358

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (51%), Gaps = 4/97 (4%)
 Frame = -3

Query  645  SLAVSVVCDDAATGPQT-LEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD     P+  +  VGT D  T   E+R P+ CGGV  A   GLG  G   +I
Sbjct  186  STIMSFLCDRDPMAPRAAVSFVGTMDQCTYFFEVRSPAACGGVAHAPNTGLGPGGVFGVI  245

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +L    AYLLGG  Y+   +H RG    PN   W+ +
Sbjct  246  VLIAIAAYLLGGCAYQRTVMHQRGWRQCPNYSLWAGM  282



>gb|ACR36424.1| unknown [Zea mays]
Length=155

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -3

Query  660  LNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++VSV+CD +A   P      G CD+AT L HPSGC   +SA G G GW  TL 
Sbjct  68   FSSKCSISVSVICDSNAIQVPDKFVLSGLCDYATTLEHPSGCPRSVSASGSGWGWLSTLF  127

Query  483  I  481
            I
Sbjct  128  I  128



>ref|XP_001212231.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU36327.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=324

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 55/113 (49%), Gaps = 4/113 (4%)
 Frame = -3

Query  669  HTALNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLG  502
             ++ N   S  +S +CD DA     T   VGT D  T   E+R  + CGG+  + G+GLG
Sbjct  149  ESSENRTKSTIMSFLCDRDAGPSQVTPSFVGTMDECTYFFEVRSSAACGGIPLSDGQGLG  208

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
              G   +I L    AYL+GG  Y+   +H RG    PN   W+ +   V+  F
Sbjct  209  PGGVFGVIALIAVAAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGMFDFVKDMF  261



>dbj|BAE54833.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=276

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 52/107 (49%), Gaps = 4/107 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD DA     T   VGT D  T   E+R  + CG V  A G+GLG  G   +I
Sbjct  161  STIMSFLCDRDAPAHQATASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVI  220

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQS  337
             L    AYL+GG  Y+   +H RG    PN   W+ +   V+S   S
Sbjct  221  ALIAVVAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGMFDFVKSSITS  267



>ref|XP_002383235.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus flavus 
NRRL3357]
 gb|EED47055.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus flavus 
NRRL3357]
Length=326

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (49%), Gaps = 4/105 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD DA     T   VGT D  T   E+R  + CG V  A G+GLG  G   +I
Sbjct  161  STIMSFLCDRDAPAHQATASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVI  220

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
             L    AYL+GG  Y+   +H RG    PN   W+ +   V+  F
Sbjct  221  ALIAVVAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGMFDFVKDMF  265



>ref|XP_001816835.2| vacuolar sorting receptor (Mrl1) [Aspergillus oryzae RIB40]
Length=326

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (49%), Gaps = 4/105 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD DA     T   VGT D  T   E+R  + CG V  A G+GLG  G   +I
Sbjct  161  STIMSFLCDRDAPAHQATASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVI  220

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
             L    AYL+GG  Y+   +H RG    PN   W+ +   V+  F
Sbjct  221  ALIAVVAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGMFDFVKDMF  265



>gb|EIT72508.1| cation-independent mannose-6-phosphate receptor CI-MPR [Aspergillus 
oryzae 3.042]
 gb|KDE77400.1| cation-independent mannose-6-phosphate receptor CI-MPR [Aspergillus 
oryzae 100-8]
Length=326

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (49%), Gaps = 4/105 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD DA     T   VGT D  T   E+R  + CG V  A G+GLG  G   +I
Sbjct  161  STIMSFLCDRDAPAHQATASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFGVI  220

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
             L    AYL+GG  Y+   +H RG    PN   W+ +   V+  F
Sbjct  221  ALIAVVAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGMFDFVKDMF  265



>ref|XP_002480488.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED20054.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces stipitatus 
ATCC 10500]
Length=370

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 55/119 (46%), Gaps = 10/119 (8%)
 Frame = -3

Query  693  QRYXGKTYHTALNTNC------SLAVSVVCDDAATGPQ-TLEKVGTCDFAT---ELRHPS  544
            Q Y  KT  T   ++       S  +S +CD  A   Q T+  VGT D  T   E+R  +
Sbjct  181  QNYNRKTVATNAASDSKSTRRKSTIMSFLCDREAPASQATVSFVGTMDSCTYFFEVRSFA  240

Query  543  GCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
             CGGV +A   GLG  G   +I L     YLLGG  Y+   +H RG    PN   WS L
Sbjct  241  ACGGVAAAPEGGLGPAGVFGVIALIAVFVYLLGGCAYQRSVMHQRGWRQCPNYSMWSDL  299



>ref|XP_001265096.1| vacuolar sorting receptor (Mrl1), putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW23199.1| vacuolar sorting receptor (Mrl1), putative [Neosartorya fischeri 
NRRL 181]
Length=331

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 57/119 (48%), Gaps = 8/119 (7%)
 Frame = -3

Query  651  NCSLAVSVVCDDAATGPQTLEK-VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLL  484
            N S  +S +CD  A   Q +   VGT D  T   E+R  + CG +  A G+GLG  G   
Sbjct  161  NKSTIMSFLCDRDALSHQAIASFVGTMDQCTYFFEIRSSAACGSIGHANGEGLGPAGVFG  220

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSW----FQSIAQRFR  319
            +I L    AYL+GG  Y+   +H RG    PN   W+ +   V+      F S+ + FR
Sbjct  221  VIALIAVAAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGIFDFVKDMFIILFSSLGRLFR  279



>ref|XP_008647632.1| PREDICTED: uncharacterized protein LOC100502280 isoform X2 [Zea 
mays]
Length=311

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -3

Query  660  LNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++VSV+CD +A   P      G CD+AT L HPSGC   +SA G G GW  TL 
Sbjct  224  FSSKCSISVSVICDSNAIQVPDKFVLSGLCDYATTLEHPSGCPRSVSASGSGWGWLSTLF  283

Query  483  I  481
            I
Sbjct  284  I  284



>tpg|DAA44898.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=241

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -3

Query  660  LNTNCSLAVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLL  484
             ++ CS++VSV+CD +A   P      G CD+AT L HPSGC   +SA G G GW  TL 
Sbjct  154  FSSKCSISVSVICDSNAIQVPDKFVLSGLCDYATTLEHPSGCPRSVSASGSGWGWLSTLF  213

Query  483  I  481
            I
Sbjct  214  I  214



>ref|XP_001269587.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW08161.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus clavatus 
NRRL 1]
Length=331

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 50/99 (51%), Gaps = 4/99 (4%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLL  484
            N S  +S +CD DA +   T   VGT D  T   E+R  + CG +  A G+GLG  G   
Sbjct  161  NKSTIMSFLCDRDALSYQATASFVGTMDQCTYFFEVRSSAACGSIGHANGEGLGPAGVFG  220

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +I L    AYL+GG  Y+   +H RG    PN   W+ +
Sbjct  221  VIALIAVAAYLIGGCAYQRTVMHQRGWRQCPNYSLWAGI  259



>dbj|GAM39181.1| hypothetical protein TCE0_034f10514 [Talaromyces cellulolyticus]
Length=371

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 49/97 (51%), Gaps = 4/97 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD +AA    T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I
Sbjct  203  STIMSFLCDREAAPSQATVSFVGTMDSCTYFFEVRSFAACGGVAAAPEGGLGPAGVFGVI  262

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
             L     YLLGG  Y+   +H RG    PN   WS L
Sbjct  263  ALIAIFVYLLGGCAYQRSVMHQRGWRQCPNYSMWSDL  299



>gb|KFX50812.1| putative mannose 6-phosphate receptor-like protein [Talaromyces 
marneffei PM1]
Length=344

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 60/128 (47%), Gaps = 8/128 (6%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD +AA    T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I
Sbjct  175  STIMSFLCDREAAPSQATVSFVGTMDSCTYFFEVRTFAACGGVAAAPEGGLGPAGIFGVI  234

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSW----FQSIAQRFRGPS  310
             L     YLLGG  Y+   +H RG    PN   WS L    + +    F S+ + F G  
Sbjct  235  ALIAIFVYLLGGCAYQRSVMHQRGWRQCPNYSMWSELLGFFKDFAIIIFSSLTRCFTGKG  294

Query  309  QHHRSTYS  286
                + YS
Sbjct  295  SPSSAGYS  302



>ref|XP_002144095.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA27580.1| vacuolar sorting receptor (Mrl1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX50811.1| putative mannose 6-phosphate receptor-like protein [Talaromyces 
marneffei PM1]
Length=369

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 60/128 (47%), Gaps = 8/128 (6%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD +AA    T+  VGT D  T   E+R  + CGGV +A   GLG  G   +I
Sbjct  200  STIMSFLCDREAAPSQATVSFVGTMDSCTYFFEVRTFAACGGVAAAPEGGLGPAGIFGVI  259

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSW----FQSIAQRFRGPS  310
             L     YLLGG  Y+   +H RG    PN   WS L    + +    F S+ + F G  
Sbjct  260  ALIAIFVYLLGGCAYQRSVMHQRGWRQCPNYSMWSELLGFFKDFAIIIFSSLTRCFTGKG  319

Query  309  QHHRSTYS  286
                + YS
Sbjct  320  SPSSAGYS  327



>ref|XP_750322.1| vacuolar sorting receptor (Mrl1) [Aspergillus fumigatus Af293]
 gb|EAL88284.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus fumigatus 
Af293]
 gb|EDP55909.1| vacuolar sorting receptor (Mrl1), putative [Aspergillus fumigatus 
A1163]
 gb|KEY82967.1| vacuolar sorting receptor Mrl1 [Aspergillus fumigatus var. RP-2014]
Length=351

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 48/99 (48%), Gaps = 4/99 (4%)
 Frame = -3

Query  651  NCSLAVSVVCDDAATGPQTLEK-VGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLL  484
            N S  +S +CD  A   Q +   VGT D  T   E+R  + CG +  A G GLG  G   
Sbjct  161  NKSTIMSFLCDRDALSHQAVASFVGTMDQCTYFFEVRSAAACGSIGHAHGDGLGPGGVFG  220

Query  483  IIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +I L    AYL+GG  Y+   +H RG    PN   W+ +
Sbjct  221  VIALIAVAAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGI  259



>ref|XP_006819098.1| PREDICTED: uncharacterized protein LOC102807910 [Saccoglossus 
kowalevskii]
Length=244

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 53/113 (47%), Gaps = 10/113 (9%)
 Frame = -3

Query  600  QTLEKVGTCDFAT----ELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIY  433
             TL   G+ DF+T    +L     C   I     GL     L II + L   YL+GG+++
Sbjct  138  DTLHAYGSADFSTNYDFDLSSKYCCP--IDGGNGGLSAGSVLCIIAVVLVVVYLIGGILF  195

Query  432  RYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYSPVEF  274
              F  H  G D+IPN +FW++LP  ++  F         P +   S YS +++
Sbjct  196  NKFIRHAEGSDVIPNKQFWAALPALIKDGFLFAIS----PCRKGSSPYSSIDY  244



>ref|XP_002542561.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP77228.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=199

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
 Frame = -3

Query  645  SLAVSVVCDDAATGPQT----LEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD     P      +    +C +  E+R  + CGGV ++   G+G  G   II
Sbjct  84   STLISFLCDRDLVNPAAAVSFVGSPDSCTYVFEVRSAAACGGVAASTDGGVGPAGVFGII  143

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +     AY++GG  Y+   +H RG    PN   W+++
Sbjct  144  VGIAIAAYMIGGCAYQRTVMHQRGWRQCPNFAMWNNM  180



>ref|XP_002110654.1| expressed protein [Trichoplax adhaerens]
 gb|EDV26658.1| expressed protein [Trichoplax adhaerens]
Length=270

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 3/112 (3%)
 Frame = -3

Query  645  SLAVSVVCDDAATGP--QTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIIL  472
            +  +++VC+  AT P  + L   G   FA EL     C     +   GL     LLII  
Sbjct  150  TFTLTLVCNKTATKPVFEALANNGANYFA-ELSTICACPNGCPSGPGGLSGGSVLLIIFF  208

Query  471  CLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRG  316
             L   Y +GG+I+  +  +  G + IPN+ FWSSLP  ++  F     R  G
Sbjct  209  VLLSVYFIGGIIFMKYVRNAEGFEAIPNVSFWSSLPSLIKEGFAFTFSRCSG  260



>gb|KIV88105.1| hypothetical protein, variant [Exophiala mesophila]
Length=297

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 59/123 (48%), Gaps = 6/123 (5%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAA--TGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFG  493
            N   S  +S VCD A   +G   +  +G+ D  T   E+R  + CGG   ++ KG    G
Sbjct  158  NRRKSTLLSFVCDTAPNLSGRPAISFIGSLDHCTYVFEVRSRNACGGTTQSEEKGTLGPG  217

Query  492  TLLIIILCL-FGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRG  316
             +  +IL +    YL+GG++Y+   +H RG   +PN   W+ L   V S      +R R 
Sbjct  218  AVFAVILGIALLVYLIGGIVYQRNVMHQRGWRQLPNYAVWAGLVSFVSSPLSLHNRRKRR  277

Query  315  PSQ  307
            P+ 
Sbjct  278  PTN  280



>ref|XP_008197150.1| PREDICTED: uncharacterized protein LOC103314060 [Tribolium castaneum]
 gb|EFA08006.1| hypothetical protein TcasGA2_TC005595 [Tribolium castaneum]
Length=243

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = -3

Query  558  LRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEF  379
            L  P  C  VI+ K  GL     LL+I    FGAY +GG++  YF    RG++ IPN++F
Sbjct  154  LGSPHAC--VITEK-SGLSTGSVLLLIFFISFGAYFVGGILILYFMRGARGLETIPNVDF  210

Query  378  WSSLPHKVQS  349
            W SLP  V+ 
Sbjct  211  WRSLPGLVKD  220



>gb|EAS32866.3| vacuolar sorting receptor [Coccidioides immitis RS]
Length=374

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  T   T+  VGT   C +  E+R  + CGGV ++   GL   G   +I
Sbjct  198  STLMSFLCDRDLVTPAATVSYVGTLDSCSYYFEVRTAAACGGVAASTDGGLSPAGVFGVI  257

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +      YL+GG  Y+   +H RG    PN   WS +
Sbjct  258  VGIAVAVYLIGGCAYQRTVMHQRGWRQCPNYAMWSGM  294



>ref|XP_001244449.1| hypothetical protein CIMG_03890 [Coccidioides immitis RS]
Length=402

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  T   T+  VGT   C +  E+R  + CGGV ++   GL   G   +I
Sbjct  198  STLMSFLCDRDLVTPAATVSYVGTLDSCSYYFEVRTAAACGGVAASTDGGLSPAGVFGVI  257

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +      YL+GG  Y+   +H RG    PN   WS +
Sbjct  258  VGIAVAVYLIGGCAYQRTVMHQRGWRQCPNYAMWSGM  294



>emb|CDH52540.1| autophagy protein atg27 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=298

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 34/67 (51%), Gaps = 0/67 (0%)
 Frame = -3

Query  549  PSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSS  370
            PS          +G+   G    II  L G Y +GG +Y Y   + RG+D+IP+ +FW  
Sbjct  210  PSEPDTPAQGDSEGMSGLGIFFTIIFVLLGVYFIGGAVYNYKVYNARGLDLIPHRDFWLD  269

Query  369  LPHKVQS  349
            LP+ ++ 
Sbjct  270  LPYLIKD  276



>gb|EFW20208.1| vacuolar sorting receptor [Coccidioides posadasii str. Silveira]
Length=374

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  T   T+  VGT   C +  E+R  + CGGV ++   GL   G   +I
Sbjct  198  STLMSFLCDRDLVTPAATVSYVGTLDSCSYYFEVRTAAACGGVAASTDGGLSPAGVFGVI  257

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +      YL+GG  Y+   +H RG    PN   WS +
Sbjct  258  VGIAVAVYLIGGCAYQRTVMHQRGWRQCPNYAMWSGM  294



>gb|EZF30130.1| hypothetical protein H101_06229 [Trichophyton interdigitale H6]
 gb|KDB22554.1| hypothetical protein H109_05547 [Trichophyton interdigitale MR816]
Length=382

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 53/117 (45%), Gaps = 8/117 (7%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  T   T   VG+   C +  E+R  + CGGV ++   G+G  G   II
Sbjct  203  STIMSFLCDRDLVTPAATFSFVGSPDSCSYFFEVRTAAACGGVAASTDGGVGPAGIFGII  262

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF----QSIAQRFR  319
                  AYL+GG  Y+   +H RG    PN   WS     V   F     S+A  FR
Sbjct  263  AGIAVAAYLIGGCAYQRTVMHQRGWRQCPNYGMWSGAASFVGDMFIILWSSMANCFR  319



>gb|KIM75495.1| hypothetical protein PILCRDRAFT_827204 [Piloderma croceum F 1598]
Length=280

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (44%), Gaps = 19/133 (14%)
 Frame = -3

Query  642  LAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGK---------------G  508
            L ++++C + A+GP  L   G+     E  HP+GCG   S+ G                G
Sbjct  149  LNLTLLCAETASGPTFLSYNGSM-VDVEWSHPAGCGVGDSSGGSEDENKGGEKKERVGSG  207

Query  507  LGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQ  328
            +GWF   L+++L +  AY   G  Y Y      G+D+IP+ +FW  +P+  +     +  
Sbjct  208  IGWF--FLVLLLAII-AYFALGAYYNYTTYGASGVDLIPHRDFWQEVPYMARDVISHLCS  264

Query  327  RFRGPSQHHRSTY  289
              R      R  Y
Sbjct  265  SVRPRRASARGGY  277



>gb|EYE90402.1| mannose 6-phosphate receptor domain-containing protein [Aspergillus 
ruber CBS 135680]
Length=287

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 5/95 (5%)
 Frame = -3

Query  636  VSVVCDDAATGPQT-LEKVGTCDFAT---ELRHPSGCGGVISA-KGKGLGWFGTLLIIIL  472
            +S +CD  A   QT +  VGT D  T   E+R    CGG+     G+GLG  G   +I L
Sbjct  163  MSFLCDRDAHASQTAVSYVGTMDECTYFFEVRSSVACGGMAPGPDGQGLGPGGVFGVIAL  222

Query  471  CLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
                 YLLGG  Y+   +H RG    PN   W+ +
Sbjct  223  IAVAVYLLGGCAYQRTVMHQRGWRQCPNYSLWAGM  257



>gb|EEQ83764.1| vacuolar sorting receptor [Blastomyces dermatitidis ER-3]
Length=410

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 9/128 (7%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT D  T   E+R  + CGGV   +G GLG  G   +I
Sbjct  218  STLMSFLCDRDLVSPAASVTFVGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVI  276

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPS  310
             L     Y+LGG  Y+   +H RG    PN   W+     V+      F S+++ FR  +
Sbjct  277  ALIAIAVYILGGCAYQRTVMHQRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSN  336

Query  309  QHHRSTYS  286
                + YS
Sbjct  337  FKSPTGYS  344



>ref|XP_007579807.1| putative vacuolar sorting receptor protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD52723.1| putative vacuolar sorting receptor protein [Neofusicoccum parvum 
UCRNP2]
Length=346

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 46/97 (47%), Gaps = 8/97 (8%)
 Frame = -3

Query  636  VSVVCDDAATGPQTLEKVG-------TCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            +S++C+  +  P     V         C +  E R  + CGG I  + + LG  G   +I
Sbjct  193  ISLLCETDSMAPADEATVAFVAASPDECTYFFEARSKAACGG-IEKETQQLGPGGVFGVI  251

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            +L  F  Y +GG +Y+   +H RG   IPN  FW S+
Sbjct  252  VLIAFLVYFVGGCVYQRTVMHQRGWRQIPNFSFWESI  288



>gb|EQL29309.1| hypothetical protein BDFG_08039 [Blastomyces dermatitidis ATCC 
26199]
Length=409

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 9/128 (7%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT D  T   E+R  + CGGV   +G GLG  G   +I
Sbjct  218  STLMSFLCDRDLVSPAASVTFVGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVI  276

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPS  310
             L     Y+LGG  Y+   +H RG    PN   W+     V+      F S+++ FR  +
Sbjct  277  ALIAIAVYILGGCAYQRTVMHQRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSN  336

Query  309  QHHRSTYS  286
                + YS
Sbjct  337  FKSPTGYS  344



>ref|XP_002625151.1| vacuolar sorting receptor [Blastomyces dermatitidis SLH14081]
 gb|EEQ78362.1| vacuolar sorting receptor [Blastomyces dermatitidis SLH14081]
Length=409

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 9/128 (7%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT D  T   E+R  + CGGV   +G GLG  G   +I
Sbjct  218  STLMSFLCDRDLVSPAASVTFVGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVI  276

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPS  310
             L     Y+LGG  Y+   +H RG    PN   W+     V+      F S+++ FR  +
Sbjct  277  ALIAIAVYILGGCAYQRTVMHQRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSN  336

Query  309  QHHRSTYS  286
                + YS
Sbjct  337  FKSPTGYS  344



>gb|EGE80100.1| vacuolar sorting receptor [Blastomyces dermatitidis ATCC 18188]
Length=410

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 9/128 (7%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT D  T   E+R  + CGGV   +G GLG  G   +I
Sbjct  218  STLMSFLCDRDLVSPAASVTFVGTLDSCTYFFEVRSAAACGGVARTEG-GLGPAGVFGVI  276

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS----WFQSIAQRFRGPS  310
             L     Y+LGG  Y+   +H RG    PN   W+     V+      F S+++ FR  +
Sbjct  277  ALIAIAVYILGGCAYQRTVMHQRGWRQCPNYSMWAGAGSFVRDLFIILFTSLSRCFRSSN  336

Query  309  QHHRSTYS  286
                + YS
Sbjct  337  FKSPTGYS  344



>gb|KIL71248.1| hypothetical protein M378DRAFT_154764 [Amanita muscaria Koide 
BX008]
Length=385

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 38/76 (50%), Gaps = 2/76 (3%)
 Frame = -3

Query  525  SAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS-  349
            ++    LG+F  L II L L  AY + G +Y  + L +RG D IP   F S   H  Q+ 
Sbjct  176  TSGNSALGFFAVLAIIALVLVVAYTVLGTLYNRYVLQLRGFDQIPQFSFESMRYHAHQAI  235

Query  348  -WFQSIAQRFRGPSQH  304
             WF+ I   F   SQH
Sbjct  236  DWFRDIMSNFYEQSQH  251



>emb|CEI91741.1| hypothetical protein RMCBS344292_06022 [Rhizopus microsporus]
Length=393

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 4/78 (5%)
 Frame = -3

Query  537  GGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHK  358
            GG    K +G+        II  L   Y +GG  Y Y   + RG+D+IP+ EFW  LP+ 
Sbjct  309  GGNEEPKKEGMSGIRIFFTIIFVLLAVYFIGGAFYNYRVYNARGLDLIPHREFWLDLPYL  368

Query  357  VQSW----FQSIAQRFRG  316
            ++        SI  R RG
Sbjct  369  IRDLIAHIIDSIMSRRRG  386



>emb|CEG71777.1| hypothetical protein RMATCC62417_07449 [Rhizopus microsporus]
Length=287

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 4/78 (5%)
 Frame = -3

Query  537  GGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHK  358
            GG    K +G+        II  L   Y +GG  Y Y   + RG+D+IP+ EFW  LP+ 
Sbjct  203  GGNEEPKKEGMSGIRIFFTIIFVLLAVYFIGGAFYNYRVYNARGLDLIPHREFWLDLPYL  262

Query  357  VQSW----FQSIAQRFRG  316
            ++        SI  R RG
Sbjct  263  IRDLIAHIIDSIMSRRRG  280



>emb|CEI92604.1| hypothetical protein RMCBS344292_06858 [Rhizopus microsporus]
Length=287

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 4/78 (5%)
 Frame = -3

Query  537  GGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHK  358
            GG    K +G+        II  L   Y +GG  Y Y   + RG+D+IP+ EFW  LP+ 
Sbjct  203  GGNEEPKKEGMSGIRIFFTIIFVLLAVYFIGGAFYNYRVYNARGLDLIPHREFWLDLPYL  262

Query  357  VQSW----FQSIAQRFRG  316
            ++        SI  R RG
Sbjct  263  IRDLIAHIIDSIMSRRRG  280



>gb|EPB85865.1| hypothetical protein HMPREF1544_07364 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=292

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = -3

Query  513  KGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF---  343
            KG+   G    I+  L   Y +GG  Y +   + RG+D+IP+ EFW  LP+ ++  F   
Sbjct  216  KGMSGIGIFFTIVFVLAAVYFVGGAFYNFKMYNARGLDLIPHREFWFDLPYLIRDLFAHV  275

Query  342  -QSIAQRFRG  316
              S+  R RG
Sbjct  276  VDSVMSRRRG  285



>gb|KIV88104.1| hypothetical protein PV10_09031 [Exophiala mesophila]
Length=324

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = -3

Query  657  NTNCSLAVSVVCDDAA--TGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKGLGWFG  493
            N   S  +S VCD A   +G   +  +G+ D  T   E+R  + CGG   ++ KG    G
Sbjct  158  NRRKSTLLSFVCDTAPNLSGRPAISFIGSLDHCTYVFEVRSRNACGGTTQSEEKGTLGPG  217

Query  492  TLLIIILCL-FGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF  343
             +  +IL +    YL+GG++Y+   +H RG   +PN   W+ L   V   F
Sbjct  218  AVFAVILGIALLVYLIGGIVYQRNVMHQRGWRQLPNYAVWAGLVSFVSDMF  268



>ref|XP_001792289.1| hypothetical protein SNOG_01653 [Phaeosphaeria nodorum SN15]
 gb|EAT91302.2| hypothetical protein SNOG_01653 [Phaeosphaeria nodorum SN15]
Length=294

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 4/93 (4%)
 Frame = -3

Query  636  VSVVCDD---AATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCL  466
            +S++CD    A T    +  V  C +  E R P  CGGV  AK + LG  G   +II+  
Sbjct  191  ISLLCDSDPLAKTSVSFVAAVDECTYFFEGRSPFACGGVHQAK-QALGPGGVFSVIIIIA  249

Query  465  FGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
               Y +GG +Y+   +H RG   +PN   W+ +
Sbjct  250  ILVYFVGGCVYQRTVMHQRGWRQLPNYAMWAGI  282



>gb|KDQ57471.1| hypothetical protein JAAARDRAFT_177653 [Jaapia argillacea MUCL 
33604]
Length=289

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 58/135 (43%), Gaps = 23/135 (17%)
 Frame = -3

Query  645  SLAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGC------------------GGVISA  520
            S  ++++C   A+ P+ +   G      E   P+GC                  G    +
Sbjct  154  SFNLTLLCSQEASEPKFISYDGV-QLKVEWSAPAGCSESQQPPKDDESKGPGDGGKEEES  212

Query  519  KGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQ  340
             G G+GWF    +++L  FGAY   G  Y Y     RG+D+IP+ +FW  +P+ ++    
Sbjct  213  VGSGIGWF---FLVLLIAFGAYFGLGAYYNYSTYGARGLDLIPHRDFWREVPYMLRDVVS  269

Query  339  SIAQRFRGPSQHHRS  295
             +    R P +  RS
Sbjct  270  HLCSTVR-PRRSSRS  283



>ref|XP_661699.1| hypothetical protein AN4095.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59356.1| hypothetical protein AN4095.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF74717.1| TPA: vacuolar sorting receptor (Mrl1), putative (AFU_orthologue; 
AFUA_1G05730) [Aspergillus nidulans FGSC A4]
Length=315

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 47/100 (47%), Gaps = 5/100 (5%)
 Frame = -3

Query  651  NCSLAVSVVCD-DAATGPQTLEKVGTCDFAT---ELRHPSGCGGV-ISAKGKGLGWFGTL  487
            N S  +S +CD D  T       VGT D  T   E+R  + CGG   +  G+GL   G  
Sbjct  151  NKSTIISFLCDRDVTTSTPIFSFVGTMDQCTYFFEVRSSAACGGYGHNPAGQGLSPGGVF  210

Query  486  LIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
             II L    AYL+GG  Y+   +H RG    PN   W+ +
Sbjct  211  GIIALIAVAAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGI  250



>ref|XP_007328525.1| hypothetical protein AGABI1DRAFT_112688 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM80983.1| hypothetical protein AGABI1DRAFT_112688 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=291

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 46/113 (41%), Gaps = 19/113 (17%)
 Frame = -3

Query  642  LAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGCGGVISAK----------------GK  511
            L V+V CD  +              A E R P GC    S +                G 
Sbjct  159  LNVTVHCDPNSKSDPIFLSYDDSLLALEWRAPGGCPSEQSPEPPKDHDDKDDPKEENVGS  218

Query  510  GLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ  352
            GLGWF    ++IL  F AY   G  Y Y     RG D+IP+ +FW  +P+ ++
Sbjct  219  GLGWF---FLVILLAFAAYFGLGAYYNYSTYGARGKDLIPHRDFWQEVPYMLK  268



>gb|EHJ65657.1| hypothetical protein KGM_06525 [Danaus plexippus]
Length=275

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = -3

Query  543  GCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLP  364
             C   I   G  LG   TLLII+      YL  G+  + F +   GI++IPNL FWS LP
Sbjct  183  ACLKQIEELGPSLG--TTLLIILFSFVALYLALGICTKIFLMGATGIEVIPNLSFWSDLP  240

Query  363  HKVQSWFQSIAQRFRGPSQHHRSTYSP  283
            + V+  +      F+ P++      SP
Sbjct  241  NLVRDGWAFALNGFKLPNRSQGPVTSP  267



>ref|XP_009067010.1| hypothetical protein LOTGIDRAFT_134805 [Lottia gigantea]
 gb|ESO82350.1| hypothetical protein LOTGIDRAFT_134805 [Lottia gigantea]
Length=180

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 45/91 (49%), Gaps = 2/91 (2%)
 Frame = -3

Query  639  AVSVVCD-DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLF  463
             + ++C+ +A    +   K   C +  E+ H   CG  I  K K L     +LI++  + 
Sbjct  45   VIIIICNPNADDVKENNLKYTDCYYLFEISHKDACGVPIDIK-KSLSVGSIVLIVMASVI  103

Query  462  GAYLLGGMIYRYFFLHIRGIDIIPNLEFWSS  370
              YLL G +Y+ F LH +G++ IPN  FW  
Sbjct  104  ALYLLLGFLYQRFVLHAKGMEQIPNYAFWQD  134



>gb|ELU12794.1| hypothetical protein CAPTEDRAFT_127669 [Capitella teleta]
Length=187

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 9/96 (9%)
 Frame = -3

Query  636  VSVVCDDAATGP------QTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIII  475
            + ++C +  T        +   K   C +  EL H + C   +++  +GL     + I+ 
Sbjct  48   IMIICKEGETQGIFRLVGENNNKTQDCFYLFELEHKAAC---MTSASEGLSIGSIVCIVF  104

Query  474  LCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
              L   YLLGG IY+ F +  +G++ IPN  FW   
Sbjct  105  FSLLACYLLGGFIYQRFVVGAKGMEQIPNYSFWQDF  140



>ref|XP_005109119.1| PREDICTED: cation-dependent mannose-6-phosphate receptor-like 
[Aplysia californica]
Length=286

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = -3

Query  621  DDAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCLFGAYLLGG  442
            DD+      +E+   C +  E++H + C    ++ G  +G    LLI+   +   YLL G
Sbjct  158  DDSNAEMVYMEESKLCYYLFEMKHQALCPAETASSGLSVG--SILLIVFFTIVSVYLLVG  215

Query  441  MIYRYFFLHIRGIDIIPNLEFWSSL  367
             +Y  F L  +G++ IPN EFW   
Sbjct  216  FLYSRFVLGSKGMEQIPNYEFWKDF  240



>ref|XP_010755848.1| hypothetical protein PADG_00481 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH44192.2| hypothetical protein PADG_00481 [Paracoccidioides brasiliensis 
Pb18]
Length=371

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 5/95 (5%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVG---TCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   T+  VG   +C +  E+R  + C GV  ++G GLG  G   +I
Sbjct  194  STLMSFLCDRDLVSPAATVSFVGALDSCSYFFEVRSAAACDGVARSEG-GLGPAGVFGVI  252

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWS  373
             L    AY LGG  Y+   +H RG    PN   W+
Sbjct  253  ALIAVAAYFLGGCAYQRTVMHQRGWRQCPNYSLWA  287



>gb|EEH19822.1| hypothetical protein PABG_02081 [Paracoccidioides brasiliensis 
Pb03]
Length=371

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 5/95 (5%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVG---TCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   T+  VG   +C +  E+R  + C GV  ++G GLG  G   +I
Sbjct  194  STLMSFLCDRDLVSPAATVSFVGALDSCSYFFEVRSAAACDGVARSEG-GLGPAGVFGVI  252

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWS  373
             L    AY LGG  Y+   +H RG    PN   W+
Sbjct  253  ALIAVAAYFLGGCAYQRTVMHQRGWRQCPNYSLWA  287



>gb|KFH62810.1| hypothetical protein MVEG_11336 [Mortierella verticillata NRRL 
6337]
Length=267

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 46/102 (45%), Gaps = 10/102 (10%)
 Frame = -3

Query  660  LNTNCSLAVSV----VCDDAATG---PQTLEKVGTCDFATELRHPSGCGGVISAKGKGLG  502
            LNT+ S+  S     VCD + +G   P  +     C+F  E R PS C           G
Sbjct  120  LNTDGSIKRSTLIHFVCDTSVSGQGKPVLVADNNECNFWFEWRTPSACATDKPKSDNSGG  179

Query  501  WFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFW  376
             FGT+L + L +   YL GG+ Y     H RG+  IPN   W
Sbjct  180  VFGTILGVALFV---YLAGGIAYNRIVHHARGLKQIPNYHSW  218



>emb|CDS08563.1| hypothetical protein LRAMOSA09924 [Absidia idahoensis var. thermophila]
Length=298

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = -3

Query  513  KGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQS  349
            +G+   G    I+  L G Y +GG  Y Y   + RG+D+IP+ +FW  LP+ ++ 
Sbjct  222  EGMSGLGIFFTIVFVLLGVYFVGGAFYNYKVYNARGLDLIPHRDFWLDLPYLIKD  276



>gb|EKG17326.1| Mannose-6-phosphate receptor binding protein [Macrophomina phaseolina 
MS6]
Length=344

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 46/97 (47%), Gaps = 8/97 (8%)
 Frame = -3

Query  636  VSVVCD-------DAATGPQTLEKVGTCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            +S++C+       D AT          C +  E R  + CGG I  + + LG  G   +I
Sbjct  191  ISLLCETDALSASDEATVAFVAASPDECTYFFEARSKAACGG-IEKERQQLGPGGVFGVI  249

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
            ++  F  Y +GG +Y+   +H RG   IPN  FW S+
Sbjct  250  VMIAFLVYFVGGCVYQRTVMHQRGWRQIPNFSFWESI  286



>ref|XP_002795908.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH39607.1| hypothetical protein PAAG_01796 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=371

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 5/95 (5%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVG---TCDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   T+  VG   +C +  E+R  + C GV  ++G GLG  G   +I
Sbjct  194  STLMSFLCDRDLVSPAATVSFVGALDSCAYFFEVRSAAACDGVARSEG-GLGPAGVFGVI  252

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWS  373
             L    AY LGG  Y+   +H RG    PN   W+
Sbjct  253  ALIAVAAYFLGGCAYQRTVMHQRGWRQCPNYSLWA  287



>ref|XP_003176966.1| hypothetical protein MGYG_08915 [Microsporum gypseum CBS 118893]
 gb|EFQ98014.1| hypothetical protein MGYG_08915 [Microsporum gypseum CBS 118893]
Length=387

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 58/127 (46%), Gaps = 10/127 (8%)
 Frame = -3

Query  636  VSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILC  469
            +S +CD D  T   T   VG+   C +  E+R  + CGGV ++   G+G  G   II   
Sbjct  208  MSFLCDRDLVTPAATFSFVGSPDSCSYFFEVRTAAACGGVAASTDGGVGPAGVFGIIAGI  267

Query  468  LFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWF----QSIAQRFRGPSQHH  301
               AYL+GG  Y+   +H RG    PN   WS     V   F     SIA  FR   +  
Sbjct  268  AIAAYLIGGCAYQRTVMHQRGWRQCPNYGMWSGAASFVGDMFIILWSSIANCFR--FRKS  325

Query  300  RSTYSPV  280
            RS YS +
Sbjct  326  RSAYSQL  332



>gb|KIY50344.1| hypothetical protein FISHEDRAFT_39344, partial [Fistulina hepatica 
ATCC 64428]
Length=250

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 57/144 (40%), Gaps = 17/144 (12%)
 Frame = -3

Query  681  GKTYHTALNTNCSLAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGCG-----------  535
            G TY ++  T  SL++++ C      P  +   G+ +   +   P+ C            
Sbjct  108  GATYPSSGGTEQSLSIALTCSTETHDPTFVSYDGS-EMRVDWSVPAACATQDDDTPSDDE  166

Query  534  --GVISAKGKGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPH  361
                 +  G GLG F  LL+I + L   Y  GG  Y Y     RG D+IP+ +FW  +P+
Sbjct  167  APPAKTKVGNGLGVFFLLLVIAVVL---YFTGGAYYNYSTYGARGADLIPHRDFWREVPY  223

Query  360  KVQSWFQSIAQRFRGPSQHHRSTY  289
              Q     +    R      R  Y
Sbjct  224  MFQDLISHLCSSARPRHSSSRGGY  247



>ref|XP_006461115.1| hypothetical protein AGABI2DRAFT_192652 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV47465.1| hypothetical protein AGABI2DRAFT_192652 [Agaricus bisporus var. 
bisporus H97]
Length=291

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 46/113 (41%), Gaps = 19/113 (17%)
 Frame = -3

Query  642  LAVSVVCDDAATGPQTLEKVGTCDFATELRHPSGCGGVISAK----------------GK  511
            L V+V CD  +              A E R P GC    S +                G 
Sbjct  159  LNVTVHCDPNSKSDPIFLSYDDSLLALEWRAPGGCPSEQSPEPPKDHDDKDDPKEENVGS  218

Query  510  GLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQ  352
            GLGWF    ++IL  F AY   G  Y Y     RG D+IP+ +FW  +P+ ++
Sbjct  219  GLGWF---FLVILLAFVAYFGLGAYYNYSTYGARGKDLIPHRDFWQEVPYMLK  268



>gb|EGC41025.1| vacuolar sorting receptor [Histoplasma capsulatum H88]
Length=313

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (49%), Gaps = 5/96 (5%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT   C ++ ++R  + CGG     G GLG  G   +I
Sbjct  106  STILSFLCDRDLVSPAASVTFVGTLDSCTYSFQVRSAAACGGFARTDG-GLGPAGVFGVI  164

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSS  370
             L     Y+LGG  Y+   +H RG    PN   W+S
Sbjct  165  ALIAIAVYVLGGCAYQRTVMHQRGWRQCPNYSMWAS  200



>ref|XP_011451964.1| PREDICTED: cation-dependent mannose-6-phosphate receptor-like 
[Crassostrea gigas]
 gb|EKC18449.1| Cation-dependent mannose-6-phosphate receptor [Crassostrea gigas]
Length=242

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = -3

Query  639  AVSVVC-DDAATGPQTLEKV-GTCDFATELRHPSGCGGVISAKGKGLGWFGTLLIIILCL  466
            ++S++C  D+ +   T++++ G  D+   LR P  C         GL     LLI+    
Sbjct  130  SISLICVSDSLSNDFTVQELKGDVDYVFTLRSPHAC----LVPNPGLSAGSILLILFFVA  185

Query  465  FGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSLPHKVQSWFQSIAQRFRGPSQHHRSTYS  286
               Y++GG+++  F+    G+++IPN EFW   P  V+     +   FRG      +TYS
Sbjct  186  VVVYIVGGILFLRFYRGASGVEMIPNYEFWKGFPLLVK---DGMVFTFRGCKSD--TTYS  240

Query  285  PV  280
             +
Sbjct  241  QI  242



>ref|XP_007720149.1| cation-dependent mannose-6-phosphate receptor [Capronia coronata 
CBS 617.96]
 gb|EXJ95920.1| cation-dependent mannose-6-phosphate receptor [Capronia coronata 
CBS 617.96]
Length=293

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = -3

Query  645  SLAVSVVCDDA---ATGPQTLEKVGTCDFAT---ELRHPSGCGGVISAKGKG-LGWFGTL  487
            S  +S +CD +   +T P  +  +GT D  T   E+R    CGG  SA  KG LG  G  
Sbjct  165  STMLSFICDTSPLLSTRP-AISFLGTPDHCTYIFEVRSRYACGGTTSAGEKGTLGPGGVF  223

Query  486  LIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
             +I+      YL+GG++Y+   +H RG   +PN   W+ L
Sbjct  224  AVILGIALLVYLIGGVVYQRNVMHQRGWKQLPNYAVWAGL  263



>ref|XP_003856449.1| hypothetical protein MYCGRDRAFT_66596 [Zymoseptoria tritici IPO323]
 gb|EGP91425.1| hypothetical protein MYCGRDRAFT_66596 [Zymoseptoria tritici IPO323]
Length=315

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 54/115 (47%), Gaps = 11/115 (10%)
 Frame = -3

Query  693  QRYXGKTYHTALNTNCSLAVSVVCDDAATGPQ-TLEKVGTCDFAT---ELRHPSGCGGVI  526
            +R  G T  TA     S  +S++CD     PQ TL  VG+ D  T   E R  + C  + 
Sbjct  145  KRSLGATELTA--REISTMISMLCDRDPLAPQLTLSFVGSLDECTYFFEGRSAAACATLN  202

Query  525  SAKG--KGLGWFGTLLIIILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSSL  367
              KG     G FG ++II L +   YL GG +Y    L  RG   +PN   W+S+
Sbjct  203  KTKGSLNPGGVFGVIVIIALLV---YLAGGCVYNRTVLQQRGWSQVPNYHLWASI  254



>gb|EEH04996.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
Length=423

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (49%), Gaps = 5/96 (5%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT   C ++ ++R  + CGG     G GLG  G   +I
Sbjct  216  STILSFLCDRDLVSPAASVTFVGTLDSCTYSFQVRSAAACGGFARTDG-GLGPAGVFGVI  274

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSS  370
             L     Y+LGG  Y+   +H RG    PN   W+S
Sbjct  275  ALIAIAVYVLGGCAYQRTVMHQRGWRQCPNYSMWAS  310



>gb|EER45071.1| vacuolar sorting receptor [Histoplasma capsulatum H143]
Length=423

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (49%), Gaps = 5/96 (5%)
 Frame = -3

Query  645  SLAVSVVCD-DAATGPQTLEKVGT---CDFATELRHPSGCGGVISAKGKGLGWFGTLLII  478
            S  +S +CD D  +   ++  VGT   C ++ ++R  + CGG     G GLG  G   +I
Sbjct  216  STILSFLCDRDLVSPAASVTFVGTLDSCTYSFQVRSAAACGGFARTDG-GLGPAGVFGVI  274

Query  477  ILCLFGAYLLGGMIYRYFFLHIRGIDIIPNLEFWSS  370
             L     Y+LGG  Y+   +H RG    PN   W+S
Sbjct  275  ALIAIAVYVLGGCAYQRTVMHQRGWRQCPNYSMWAS  310



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410