BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035A12

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611099.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    304   1e-98   Nicotiana tomentosiformis
ref|XP_009762623.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    296   1e-95   Nicotiana sylvestris
emb|CDP13685.1|  unnamed protein product                                296   2e-95   Coffea canephora [robusta coffee]
ref|XP_010245027.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    285   3e-91   Nelumbo nucifera [Indian lotus]
emb|CAN74282.1|  hypothetical protein VITISV_016708                     284   8e-91   Vitis vinifera
ref|XP_002267586.3|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    284   9e-91   Vitis vinifera
ref|XP_004294914.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    281   8e-90   Fragaria vesca subsp. vesca
ref|XP_009347513.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    281   9e-90   Pyrus x bretschneideri [bai li]
ref|XP_009367256.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    279   4e-89   Pyrus x bretschneideri [bai li]
ref|XP_008384599.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    279   5e-89   
ref|XP_008218667.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    278   2e-88   Prunus mume [ume]
ref|XP_007205484.1|  hypothetical protein PRUPE_ppa008150mg             278   2e-88   Prunus persica
ref|XP_008353104.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    277   3e-88   
ref|XP_006346113.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    275   1e-87   Solanum tuberosum [potatoes]
ref|XP_008384601.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    275   2e-87   
ref|XP_006344901.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    274   9e-87   Solanum tuberosum [potatoes]
ref|XP_008218676.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    273   9e-87   Prunus mume [ume]
ref|XP_010313952.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    268   1e-85   
ref|XP_011095581.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    270   1e-85   Sesamum indicum [beniseed]
ref|XP_004244025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    268   5e-85   Solanum lycopersicum
ref|XP_010922953.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    265   1e-83   Elaeis guineensis
ref|XP_009120112.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    264   3e-83   Brassica rapa
gb|KHN23825.1|  E3 ubiquitin-protein ligase                             268   3e-83   Glycine soja [wild soybean]
emb|CDY17377.1|  BnaA10g10110D                                          264   3e-83   Brassica napus [oilseed rape]
ref|XP_010061429.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    264   3e-83   Eucalyptus grandis [rose gum]
ref|XP_010061428.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    263   8e-83   Eucalyptus grandis [rose gum]
ref|XP_009120113.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    263   1e-82   Brassica rapa
emb|CDY61181.1|  BnaCnng37430D                                          262   2e-82   Brassica napus [oilseed rape]
ref|XP_008791159.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    261   3e-82   Phoenix dactylifera
gb|KHN43912.1|  E3 ubiquitin-protein ligase                             261   3e-82   Glycine soja [wild soybean]
ref|XP_009791010.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    259   2e-81   Nicotiana sylvestris
gb|KHG22760.1|  hypothetical protein F383_06014                         258   1e-80   Gossypium arboreum [tree cotton]
gb|KJB13895.1|  hypothetical protein B456_002G102600                    257   2e-80   Gossypium raimondii
gb|KHG25819.1|  hypothetical protein F383_09207                         254   5e-79   Gossypium arboreum [tree cotton]
ref|XP_007020422.1|  RING/U-box domain-containing protein isoform 2     254   5e-79   Theobroma cacao [chocolate]
ref|XP_007020421.1|  RING/U-box domain-containing protein isoform 1     253   8e-79   
ref|XP_010443237.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    253   9e-79   Camelina sativa [gold-of-pleasure]
ref|XP_002522801.1|  ring finger protein, putative                      252   9e-79   Ricinus communis
gb|KJB81576.1|  hypothetical protein B456_013G150600                    252   2e-78   Gossypium raimondii
ref|XP_010539334.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    251   6e-78   Tarenaya hassleriana [spider flower]
ref|XP_009132344.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    250   7e-78   Brassica rapa
gb|KJB81575.1|  hypothetical protein B456_013G150600                    251   7e-78   Gossypium raimondii
gb|KJB81577.1|  hypothetical protein B456_013G150600                    251   8e-78   Gossypium raimondii
ref|XP_006280769.1|  hypothetical protein CARUB_v10026740mg             250   9e-78   Capsella rubella
emb|CDY36773.1|  BnaA03g11130D                                          249   1e-77   Brassica napus [oilseed rape]
ref|XP_006401395.1|  hypothetical protein EUTSA_v10014037mg             250   1e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010450483.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    250   1e-77   Camelina sativa [gold-of-pleasure]
gb|KDP39322.1|  hypothetical protein JCGZ_01079                         250   2e-77   Jatropha curcas
gb|KCW68372.1|  hypothetical protein EUGRSUZ_F02028                     244   2e-77   Eucalyptus grandis [rose gum]
ref|XP_009620909.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    249   2e-77   Nicotiana tomentosiformis
ref|XP_010545287.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    249   3e-77   Tarenaya hassleriana [spider flower]
gb|KDO59202.1|  hypothetical protein CISIN_1g019720mg                   247   5e-77   Citrus sinensis [apfelsine]
ref|XP_008463026.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    247   6e-77   Cucumis melo [Oriental melon]
ref|XP_008463025.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    248   6e-77   Cucumis melo [Oriental melon]
ref|XP_009620902.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    249   1e-76   
ref|XP_010675979.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    247   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008463028.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    247   1e-76   
ref|XP_006474826.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    247   1e-76   Citrus sinensis [apfelsine]
gb|KDO59201.1|  hypothetical protein CISIN_1g019720mg                   247   2e-76   Citrus sinensis [apfelsine]
ref|XP_006452654.1|  hypothetical protein CICLE_v10008862mg             247   2e-76   Citrus clementina [clementine]
emb|CDY11965.1|  BnaC03g13910D                                          246   2e-76   Brassica napus [oilseed rape]
ref|XP_010483065.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    247   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_004498153.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    247   3e-76   
ref|NP_194388.2|  RING/U-box domain-containing protein                  246   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149419.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    246   4e-76   Cucumis sativus [cucumbers]
ref|XP_004160245.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    244   6e-76   
ref|XP_002298883.1|  hypothetical protein POPTR_0001s38010g             245   7e-76   Populus trichocarpa [western balsam poplar]
gb|KGN44388.1|  hypothetical protein Csa_7G278230                       246   7e-76   
ref|XP_004149408.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    244   8e-76   Cucumis sativus [cucumbers]
ref|XP_002864420.1|  zinc finger family protein                         244   2e-75   
emb|CAB43854.1|  putative protein                                       248   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038869.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    243   4e-75   Populus euphratica
ref|XP_006857729.1|  hypothetical protein AMTR_s00061p00183390          243   6e-75   
ref|NP_568834.1|  RING/U-box domain-containing protein                  243   7e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433472.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    242   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_011038870.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    241   2e-74   Populus euphratica
ref|XP_010438729.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    241   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009142488.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    241   5e-74   Brassica rapa
emb|CDX94309.1|  BnaC01g18750D                                          241   5e-74   
emb|CDX89323.1|  BnaA01g15700D                                          240   8e-74   
ref|XP_006413164.1|  hypothetical protein EUTSA_v10025652mg             239   3e-73   Eutrema salsugineum [saltwater cress]
ref|XP_004491529.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    237   8e-73   
ref|XP_006284075.1|  hypothetical protein CARUB_v10005205mg             237   9e-73   Capsella rubella
ref|XP_006602119.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    236   3e-72   Glycine max [soybeans]
ref|XP_002867557.1|  protein binding protein                            234   1e-71   
ref|XP_006586152.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    234   1e-71   
ref|XP_007140118.1|  hypothetical protein PHAVU_008G085400g             231   1e-70   Phaseolus vulgaris [French bean]
ref|XP_003617871.1|  RING finger protein                                231   2e-70   
ref|XP_003617870.1|  RING finger protein                                231   2e-70   
ref|XP_009418470.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    228   2e-69   
ref|XP_002316784.2|  hypothetical protein POPTR_0011s09710g             228   4e-69   Populus trichocarpa [western balsam poplar]
gb|KEH28464.1|  E3 ubiquitin protein ligase RIE1-like protein, pu...    221   1e-66   Medicago truncatula
ref|XP_009418469.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    221   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044922.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    221   2e-66   Populus euphratica
ref|XP_009418468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    220   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044923.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    219   1e-65   Populus euphratica
ref|XP_010232201.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    217   2e-65   Brachypodium distachyon [annual false brome]
gb|EAY75518.1|  hypothetical protein OsI_03422                          217   3e-65   Oryza sativa Indica Group [Indian rice]
dbj|BAB92290.1|  RING zinc finger protein-like                          216   4e-65   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02980.1|  predicted protein                                      216   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT31277.1|  E3 ubiquitin-protein ligase                             215   5e-65   
emb|CDM83669.1|  unnamed protein product                                216   5e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644577.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    214   4e-64   Oryza brachyantha
ref|XP_008675134.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    217   6e-64   
gb|ACU18237.1|  unknown                                                 211   3e-62   Glycine max [soybeans]
dbj|BAJ91193.1|  predicted protein                                      218   4e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS57981.1|  hypothetical protein M569_16836                         207   1e-61   Genlisea aurea
ref|XP_010443238.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    204   4e-60   Camelina sativa [gold-of-pleasure]
gb|KHN24407.1|  E3 ubiquitin-protein ligase                             198   2e-58   Glycine soja [wild soybean]
ref|XP_007205483.1|  hypothetical protein PRUPE_ppa008150mg             194   5e-56   
ref|XP_006575716.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    187   6e-54   Glycine max [soybeans]
gb|AGE09582.1|  C3HC4Z1-like protein                                    182   1e-53   Eucalyptus cladocalyx
ref|XP_010103951.1|  hypothetical protein L484_020203                   177   3e-48   
gb|EYU27461.1|  hypothetical protein MIMGU_mgv1a011482mg                169   4e-47   Erythranthe guttata [common monkey flower]
gb|KJB13894.1|  hypothetical protein B456_002G102600                    168   1e-46   Gossypium raimondii
ref|XP_006452653.1|  hypothetical protein CICLE_v10008862mg             165   3e-45   
dbj|BAB09279.1|  unnamed protein product                                162   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EMS46348.1|  hypothetical protein TRIUR3_26831                       162   2e-43   Triticum urartu
ref|XP_010417710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010925109.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   3e-40   Elaeis guineensis
ref|XP_010925106.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   4e-40   Elaeis guineensis
gb|KDP37180.1|  hypothetical protein JCGZ_06236                         154   4e-40   Jatropha curcas
ref|XP_004498626.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    153   5e-40   
gb|KJB70539.1|  hypothetical protein B456_011G078300                    153   7e-40   Gossypium raimondii
gb|KJB35097.1|  hypothetical protein B456_006G100000                    152   8e-40   Gossypium raimondii
ref|XP_003522643.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   9e-40   Glycine max [soybeans]
gb|KHG11759.1|  hypothetical protein F383_13582                         153   1e-39   Gossypium arboreum [tree cotton]
ref|XP_010429960.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    153   1e-39   
gb|KJB35096.1|  hypothetical protein B456_006G100000                    153   1e-39   Gossypium raimondii
ref|XP_010472936.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    153   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008809197.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    153   1e-39   Phoenix dactylifera
emb|CDY37594.1|  BnaA02g19760D                                          152   1e-39   Brassica napus [oilseed rape]
ref|XP_009128425.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   1e-39   Brassica rapa
ref|XP_009760536.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   2e-39   Nicotiana sylvestris
ref|NP_178156.1|  putative zinc ion binding protein                     152   2e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38666.1|  BnaC02g23130D                                          151   3e-39   Brassica napus [oilseed rape]
ref|XP_006389789.1|  hypothetical protein EUTSA_v10018651mg             151   3e-39   Eutrema salsugineum [saltwater cress]
ref|XP_006601119.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   5e-39   
ref|XP_006301574.1|  hypothetical protein CARUB_v10022012mg             150   6e-39   
ref|XP_006601116.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   8e-39   Glycine max [soybeans]
ref|XP_003549235.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    151   9e-39   Glycine max [soybeans]
ref|XP_002971210.1|  hypothetical protein SELMODRAFT_171829             149   1e-38   
ref|XP_002516614.1|  ring finger protein, putative                      150   1e-38   
ref|XP_002889294.1|  zinc finger family protein                         149   2e-38   Arabidopsis lyrata subsp. lyrata
dbj|BAD19217.1|  RING zinc finger protein-like                          144   2e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KHF98391.1|  hypothetical protein F383_13476                         149   2e-38   Gossypium arboreum [tree cotton]
gb|KDP32286.1|  hypothetical protein JCGZ_13211                         149   2e-38   Jatropha curcas
ref|XP_002517522.1|  ring finger protein, putative                      149   3e-38   Ricinus communis
gb|KHN12061.1|  E3 ubiquitin-protein ligase                             149   3e-38   Glycine soja [wild soybean]
ref|XP_004291419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   3e-38   Fragaria vesca subsp. vesca
gb|EYU29255.1|  hypothetical protein MIMGU_mgv1a007086mg                149   3e-38   Erythranthe guttata [common monkey flower]
ref|XP_006366871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   3e-38   Solanum tuberosum [potatoes]
ref|XP_009358216.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_006596122.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   4e-38   Glycine max [soybeans]
ref|XP_008337111.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   4e-38   
ref|XP_008373479.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   4e-38   
ref|XP_009595010.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    148   5e-38   Nicotiana tomentosiformis
ref|XP_010109041.1|  E3 ubiquitin-protein ligase                        149   5e-38   
ref|XP_003545507.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   5e-38   Glycine max [soybeans]
gb|KHN25509.1|  E3 ubiquitin-protein ligase                             149   6e-38   Glycine soja [wild soybean]
ref|XP_004251592.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    148   6e-38   
ref|XP_004138872.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   6e-38   Cucumis sativus [cucumbers]
ref|XP_009358214.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    148   6e-38   Pyrus x bretschneideri [bai li]
emb|CDY51672.1|  BnaC03g67110D                                          147   8e-38   Brassica napus [oilseed rape]
ref|XP_002961593.1|  hypothetical protein SELMODRAFT_76977              147   8e-38   
ref|XP_008228607.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    148   9e-38   Prunus mume [ume]
emb|CAN81037.1|  hypothetical protein VITISV_017962                     149   1e-37   Vitis vinifera
ref|XP_007024038.1|  RING/U-box superfamily protein                     147   1e-37   
ref|XP_008445126.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-37   Cucumis melo [Oriental melon]
ref|XP_010249880.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008809167.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-37   Phoenix dactylifera
ref|XP_010537938.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_002309588.2|  zinc finger family protein                         147   1e-37   Populus trichocarpa [western balsam poplar]
emb|CBI36189.3|  unnamed protein product                                147   2e-37   Vitis vinifera
emb|CBI20932.3|  unnamed protein product                                146   2e-37   Vitis vinifera
ref|XP_007215429.1|  hypothetical protein PRUPE_ppa006140mg             147   2e-37   Prunus persica
ref|XP_008342734.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   3e-37   Malus domestica [apple tree]
ref|XP_002284536.2|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   3e-37   Vitis vinifera
ref|XP_008809011.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   3e-37   Phoenix dactylifera
ref|XP_009413619.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23333.1|  BnaA08g12130D                                          146   3e-37   Brassica napus [oilseed rape]
ref|XP_010654710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   3e-37   Vitis vinifera
ref|XP_008352040.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   4e-37   
ref|XP_011026527.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   4e-37   Populus euphratica
ref|XP_006465443.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   4e-37   
ref|XP_008342732.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    146   4e-37   Malus domestica [apple tree]
ref|XP_009108867.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    146   4e-37   Brassica rapa
ref|XP_010254223.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   4e-37   
ref|XP_006427098.1|  hypothetical protein CICLE_v10025899mg             145   5e-37   
ref|XP_010254222.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   5e-37   
gb|KJB68139.1|  hypothetical protein B456_010G227900                    145   5e-37   Gossypium raimondii
ref|XP_006465441.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   5e-37   Citrus sinensis [apfelsine]
ref|XP_010254214.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   5e-37   
ref|XP_010915017.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   6e-37   
ref|XP_007161262.1|  hypothetical protein PHAVU_001G055600g             145   6e-37   Phaseolus vulgaris [French bean]
gb|KEH35942.1|  zinc finger, C3HC4 type (RING finger) protein, pu...    145   6e-37   Medicago truncatula
ref|XP_006427099.1|  hypothetical protein CICLE_v10025899mg             145   6e-37   
ref|XP_009377510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_010670760.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   6e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006465440.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   6e-37   
ref|XP_011019728.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   7e-37   Populus euphratica
ref|XP_011081882.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   7e-37   Sesamum indicum [beniseed]
ref|XP_002324833.1|  zinc finger family protein                         145   8e-37   
ref|XP_009339006.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   8e-37   Pyrus x bretschneideri [bai li]
ref|XP_006465439.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    145   8e-37   Citrus sinensis [apfelsine]
ref|NP_001048342.1|  Os02g0787500                                       144   8e-37   
gb|KJB83263.1|  hypothetical protein B456_013G238400                    145   9e-37   Gossypium raimondii
ref|XP_006412451.1|  hypothetical protein EUTSA_v10025242mg             145   1e-36   Eutrema salsugineum [saltwater cress]
ref|XP_009339004.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_007225629.1|  hypothetical protein PRUPE_ppa005884mg             145   1e-36   Prunus persica
gb|KJB83264.1|  hypothetical protein B456_013G238400                    145   1e-36   Gossypium raimondii
ref|XP_006356611.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   1e-36   Solanum tuberosum [potatoes]
ref|XP_006648026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   1e-36   Oryza brachyantha
gb|KHG19351.1|  E3 ubiquitin ligase RIE1 -like protein                  145   1e-36   Gossypium arboreum [tree cotton]
ref|XP_008219854.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   1e-36   Prunus mume [ume]
gb|EAY87799.1|  hypothetical protein OsI_09219                          144   1e-36   Oryza sativa Indica Group [Indian rice]
gb|KHG22085.1|  hypothetical protein F383_26605                         144   1e-36   Gossypium arboreum [tree cotton]
ref|XP_010048264.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   2e-36   Eucalyptus grandis [rose gum]
ref|XP_010062440.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    143   2e-36   Eucalyptus grandis [rose gum]
ref|NP_194986.2|  C3H4 type zinc finger protein                         145   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHN44137.1|  E3 ubiquitin-protein ligase                             144   2e-36   Glycine soja [wild soybean]
ref|XP_003543658.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   2e-36   Glycine max [soybeans]
ref|XP_004245237.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   2e-36   Solanum lycopersicum
ref|XP_010437885.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   2e-36   Camelina sativa [gold-of-pleasure]
gb|KJB53919.1|  hypothetical protein B456_009G011400                    144   2e-36   Gossypium raimondii
ref|XP_009775580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   2e-36   Nicotiana sylvestris
ref|XP_006283708.1|  hypothetical protein CARUB_v10004779mg             144   2e-36   Capsella rubella
emb|CDX75258.1|  BnaA01g04440D                                          144   2e-36   
ref|XP_004302944.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   2e-36   Fragaria vesca subsp. vesca
ref|XP_004954169.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   3e-36   Setaria italica
ref|XP_010432691.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010447366.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002869261.1|  hypothetical protein ARALYDRAFT_328473             144   3e-36   
emb|CDX68865.1|  BnaC01g05880D                                          144   3e-36   
ref|XP_009586726.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   3e-36   
emb|CAA18601.1|  putative protein                                       144   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150683.1|  hypothetical protein PHAVU_005G172800g             144   3e-36   Phaseolus vulgaris [French bean]
ref|XP_003588675.1|  RING finger protein                                143   3e-36   
ref|XP_010062439.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    143   4e-36   Eucalyptus grandis [rose gum]
ref|XP_001765270.1|  predicted protein                                  141   4e-36   
ref|XP_004501279.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    142   4e-36   Cicer arietinum [garbanzo]
ref|XP_010238065.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    142   9e-36   
emb|CBI28122.3|  unnamed protein product                                142   1e-35   Vitis vinifera
ref|XP_002281595.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    142   1e-35   Vitis vinifera
ref|NP_001169753.1|  uncharacterized LOC100383634                       142   1e-35   Zea mays [maize]
ref|XP_006450563.1|  hypothetical protein CICLE_v10008289mg             142   1e-35   Citrus clementina [clementine]
ref|XP_007013746.1|  RING/U-box superfamily protein                     142   1e-35   
ref|XP_006844405.1|  hypothetical protein AMTR_s00142p00106560          142   1e-35   
ref|XP_010656378.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    141   1e-35   Vitis vinifera
ref|XP_010238063.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    142   1e-35   
ref|XP_009125802.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    142   1e-35   
ref|XP_006476189.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    142   1e-35   Citrus sinensis [apfelsine]
ref|XP_010913034.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    142   1e-35   Elaeis guineensis
ref|XP_001765272.1|  predicted protein                                  139   2e-35   
ref|XP_004959371.1|  PREDICTED: uncharacterized protein LOC101782496    140   2e-35   
gb|EMT29820.1|  E3 ubiquitin-protein ligase                             142   2e-35   
ref|XP_010526128.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    141   2e-35   
dbj|BAK03789.1|  predicted protein                                      141   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006643827.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    140   3e-35   Oryza brachyantha
ref|NP_001042194.1|  Os01g0178700                                       140   3e-35   
ref|XP_009388538.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT07924.1|  E3 ubiquitin-protein ligase                             140   3e-35   
ref|XP_011087227.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    141   3e-35   
ref|XP_010688136.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   3e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|AIZ68179.1|  E3 ubiquitin-protein ligase At1g63170-like isofor...    141   3e-35   Ornithogalum longebracteatum [sea-onion]
gb|KCW59672.1|  hypothetical protein EUGRSUZ_H02426                     140   3e-35   Eucalyptus grandis [rose gum]
gb|KHM98780.1|  E3 ubiquitin-protein ligase                             140   3e-35   Glycine soja [wild soybean]
ref|XP_003546278.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   4e-35   Glycine max [soybeans]
ref|XP_006660535.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   5e-35   Oryza brachyantha
ref|XP_003558525.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   6e-35   Brachypodium distachyon [annual false brome]
ref|XP_002462211.1|  hypothetical protein SORBIDRAFT_02g021790          139   9e-35   Sorghum bicolor [broomcorn]
ref|XP_010230534.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    139   1e-34   Brachypodium distachyon [annual false brome]
gb|KCW44260.1|  hypothetical protein EUGRSUZ_L02308                     139   1e-34   Eucalyptus grandis [rose gum]
gb|KHN16489.1|  E3 ubiquitin-protein ligase                             139   1e-34   Glycine soja [wild soybean]
ref|NP_001062870.1|  Os09g0323100                                       139   1e-34   
ref|XP_004960840.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    139   2e-34   
ref|XP_004968418.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    139   2e-34   Setaria italica
ref|XP_010526187.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    139   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_008651352.1|  PREDICTED: uncharacterized protein LOC100279...    138   2e-34   
ref|XP_008651350.1|  PREDICTED: uncharacterized protein LOC100279...    139   2e-34   
ref|XP_003527801.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   2e-34   
ref|NP_001146330.1|  uncharacterized protein LOC100279906               138   3e-34   
ref|XP_010691252.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    138   3e-34   
ref|XP_006654104.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    137   3e-34   
ref|XP_002457241.1|  hypothetical protein SORBIDRAFT_03g003920          137   4e-34   
emb|CDP18420.1|  unnamed protein product                                137   4e-34   
gb|EYU21913.1|  hypothetical protein MIMGU_mgv1a007146mg                137   5e-34   
ref|NP_001054802.1|  Os05g0179000                                       137   6e-34   
ref|XP_008373485.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    137   7e-34   
emb|CDM81802.1|  unnamed protein product                                141   8e-34   
ref|XP_009358215.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    137   1e-33   
ref|NP_001170128.1|  uncharacterized LOC100384053                       135   2e-33   
gb|EEE69458.1|  hypothetical protein OsJ_28860                          137   2e-33   
emb|CDP20805.1|  unnamed protein product                                135   3e-33   
ref|XP_002439378.1|  hypothetical protein SORBIDRAFT_09g005450          135   3e-33   
ref|XP_010039941.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    135   4e-33   
ref|XP_010040893.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    135   4e-33   
tpg|DAA57962.1|  TPA: putative RING zinc finger domain superfamil...    135   6e-33   
ref|XP_009402903.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    134   7e-33   
dbj|BAJ95361.1|  predicted protein                                      134   8e-33   
gb|EPS59843.1|  hypothetical protein M569_14963                         134   1e-32   
ref|XP_009775577.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    134   1e-32   
ref|NP_001132232.1|  uncharacterized LOC100193667                       133   2e-32   
ref|XP_010025225.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    130   2e-32   
ref|XP_003568812.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    133   2e-32   
ref|XP_009381141.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    133   2e-32   
gb|KCW44815.1|  hypothetical protein EUGRSUZ_L01620                     132   3e-32   
gb|KCW84811.1|  hypothetical protein EUGRSUZ_B01618                     132   3e-32   
ref|XP_009408952.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    132   5e-32   
ref|XP_009408951.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    132   5e-32   
gb|KCW61832.1|  hypothetical protein EUGRSUZ_H04526                     131   7e-32   
gb|KCW44722.1|  hypothetical protein EUGRSUZ_L01731                     129   4e-31   
dbj|BAJ07983.1|  RING finger family protein                             127   2e-30   
gb|KJB84336.1|  hypothetical protein B456_N019000                       116   6e-27   
ref|XP_010913106.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    116   2e-26   
ref|XP_008373490.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    114   8e-26   
ref|XP_007013275.1|  RING/U-box superfamily protein, putative           113   8e-26   
gb|KHG13325.1|  hypothetical protein F383_09628                         112   1e-25   
emb|CAN70532.1|  hypothetical protein VITISV_010220                     111   1e-25   
tpg|DAA61038.1|  TPA: putative RING zinc finger domain superfamil...    111   7e-25   
gb|ACF83816.1|  unknown                                                 107   1e-24   
ref|XP_002511805.1|  cleavage and polyadenylation specificity fac...    109   3e-24   
ref|XP_010654919.1|  PREDICTED: uncharacterized protein LOC100246284    112   3e-24   
emb|CBI36190.3|  unnamed protein product                                111   6e-24   
emb|CAN70531.1|  hypothetical protein VITISV_010219                     107   9e-24   
ref|XP_009393489.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    108   1e-23   
ref|XP_010934467.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    107   2e-23   
ref|XP_010278588.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    107   2e-23   
ref|XP_010251798.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    107   2e-23   
gb|EMT22105.1|  E3 ubiquitin-protein ligase                             107   2e-23   
ref|XP_010278590.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    106   5e-23   
ref|XP_010278589.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    105   6e-23   
ref|XP_010053666.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    105   7e-23   
ref|XP_009369025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    105   7e-23   
ref|XP_008392390.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    105   8e-23   
gb|KHF98416.1|  hypothetical protein F383_13016                         105   9e-23   
ref|XP_010278591.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   1e-22   
gb|KDP28678.1|  hypothetical protein JCGZ_14449                         104   1e-22   
ref|XP_008392388.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_010111279.1|  E3 ubiquitin protein ligase RIE1                   102   2e-22   
ref|XP_009369023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_009369026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_008800795.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_008392391.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_008355582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_010940871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_010934468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   2e-22   
ref|XP_007155554.1|  hypothetical protein PHAVU_003G211600g             103   3e-22   
ref|XP_009369024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   4e-22   
gb|KJB41239.1|  hypothetical protein B456_007G096300                    103   4e-22   
ref|XP_008799543.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   4e-22   
ref|XP_008392389.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   4e-22   
ref|XP_008355580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   5e-22   
gb|KHN34425.1|  E3 ubiquitin-protein ligase                             101   5e-22   
ref|XP_010940872.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   6e-22   
ref|XP_008355584.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   7e-22   
ref|XP_009345445.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   8e-22   
ref|XP_009382298.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   1e-21   
ref|XP_008238810.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   1e-21   
ref|XP_008799545.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   1e-21   
ref|XP_008355581.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   1e-21   
ref|XP_011023403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    102   1e-21   
ref|XP_006345510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   1e-21   
ref|XP_003623820.1|  E3 ubiquitin-protein ligase                        101   2e-21   
ref|XP_008803037.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    101   2e-21   
ref|XP_009345446.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    101   2e-21   
ref|XP_009345443.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    101   2e-21   
ref|XP_004240042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    101   2e-21   
ref|XP_007211433.1|  hypothetical protein PRUPE_ppa007140mg             101   2e-21   
ref|XP_008225188.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    101   2e-21   
ref|XP_004493023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    101   2e-21   
ref|XP_007051906.1|  RING/U-box superfamily protein, putative           101   3e-21   
ref|XP_008238809.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    101   3e-21   
gb|EWM25539.1|  e3 ubiquitin-protein ligase                             103   3e-21   
ref|XP_003552356.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    100   3e-21   
gb|KHN24279.1|  E3 ubiquitin-protein ligase                           97.8    4e-21   
ref|XP_009345444.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   4e-21   
ref|XP_003525718.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   4e-21   
ref|XP_010255490.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   5e-21   
ref|XP_003550874.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   5e-21   
ref|XP_008803038.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   5e-21   
ref|XP_009034871.1|  hypothetical protein AURANDRAFT_36689              100   5e-21   
ref|XP_010255491.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   5e-21   
ref|XP_003533627.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    100   6e-21   
ref|XP_008438087.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  99.4    1e-20   
ref|XP_008443208.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  99.0    1e-20   
ref|XP_002969635.1|  hypothetical protein SELMODRAFT_66385            99.0    1e-20   
ref|XP_008670056.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  99.4    1e-20   
gb|KEH31714.1|  zinc finger, C3HC4 type (RING finger) protein         99.4    1e-20   
ref|XP_009399941.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  99.0    1e-20   
ref|XP_007209235.1|  hypothetical protein PRUPE_ppa007012mg           99.0    1e-20   
emb|CBI38762.3|  unnamed protein product                              98.6    1e-20   
ref|XP_010271358.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  98.6    2e-20   
ref|XP_009112972.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  98.6    2e-20   
gb|KHN29414.1|  E3 ubiquitin-protein ligase                           98.2    2e-20   
ref|XP_002301335.1|  zinc finger family protein                       98.6    2e-20   
ref|XP_009419123.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  98.2    2e-20   
ref|XP_002271651.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  98.6    2e-20   
ref|XP_011463818.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  98.2    3e-20   
gb|KDO63537.1|  hypothetical protein CISIN_1g020491mg                 97.8    3e-20   
ref|XP_010932732.1|  PREDICTED: uncharacterized protein LOC105053331    101   3e-20   
ref|XP_002970900.1|  hypothetical protein SELMODRAFT_66382            97.8    3e-20   
gb|KDO63535.1|  hypothetical protein CISIN_1g020491mg                 97.8    3e-20   
ref|XP_008672239.1|  PREDICTED: uncharacterized protein LOC100216...  95.5    3e-20   
ref|XP_009617349.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  98.2    3e-20   
ref|XP_004136763.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  97.4    4e-20   
ref|XP_006440560.1|  hypothetical protein CICLE_v10020554mg           97.8    4e-20   
ref|XP_006440563.1|  hypothetical protein CICLE_v10020554mg           97.8    4e-20   
gb|EYU35067.1|  hypothetical protein MIMGU_mgv1a008119mg              97.4    5e-20   
ref|XP_010553508.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  97.8    5e-20   
ref|XP_009124794.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  97.4    5e-20   
ref|XP_006287901.1|  hypothetical protein CARUB_v10001135mg           97.4    5e-20   
ref|XP_007139958.1|  hypothetical protein PHAVU_008G073000g           97.4    5e-20   
ref|XP_006477420.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  97.4    5e-20   
gb|KHG16467.1|  hypothetical protein F383_05962                       97.8    5e-20   
ref|XP_007040145.1|  Zinc finger, C3HC4 type (RING finger) family...  97.4    5e-20   
ref|XP_008232745.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  97.1    6e-20   
tpg|DAA39681.1|  TPA: putative RING zinc finger domain superfamil...  95.1    6e-20   
gb|KFK31927.1|  hypothetical protein AALP_AA6G177200                  97.4    6e-20   
ref|XP_004165340.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  96.3    6e-20   
ref|XP_006477422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  97.1    6e-20   
emb|CDY57781.1|  BnaCnng32440D                                        97.1    6e-20   
ref|XP_011463819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  97.1    7e-20   
ref|XP_010919264.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  97.1    7e-20   
ref|XP_010092737.1|  E3 ubiquitin-protein ligase                      97.1    7e-20   
gb|KDO63536.1|  hypothetical protein CISIN_1g020491mg                 96.7    8e-20   
ref|NP_001147541.1|  protein binding protein                          96.7    8e-20   
ref|XP_004133878.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  96.7    8e-20   
dbj|BAK00653.1|  predicted protein                                    96.7    8e-20   
dbj|BAK01729.1|  predicted protein                                    96.7    9e-20   
ref|XP_010553504.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  97.1    9e-20   
gb|KJB39631.1|  hypothetical protein B456_007G022500                  96.7    9e-20   
emb|CBI34726.3|  unnamed protein product                              95.9    9e-20   
gb|KHG14407.1|  hypothetical protein F383_04260                       96.7    9e-20   
ref|XP_008438088.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  96.7    9e-20   
ref|XP_007220471.1|  hypothetical protein PRUPE_ppa007521mg           96.3    1e-19   
ref|XP_008813538.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    1e-19   
ref|XP_010553507.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  96.7    1e-19   
ref|XP_009413624.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  96.3    1e-19   
ref|XP_008672240.1|  PREDICTED: uncharacterized protein LOC100216...  94.0    1e-19   
ref|XP_006440561.1|  hypothetical protein CICLE_v10020554mg           96.3    1e-19   
ref|XP_009143169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  96.3    1e-19   
gb|ADK63393.1|  C3HC4 type zinc finger protein                        95.9    1e-19   
ref|NP_849924.1|  E3 ubiquitin protein ligase RIE1                    96.3    1e-19   
ref|XP_007040144.1|  Zinc finger, C3HC4 type (RING finger) family...  96.3    1e-19   
ref|XP_003630948.1|  E3 ubiquitin-protein ligase                      95.9    1e-19   
ref|XP_010661149.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  96.3    1e-19   
ref|XP_006477421.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  96.3    1e-19   
ref|XP_010055479.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  94.4    1e-19   
ref|XP_010553509.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  96.3    1e-19   
ref|XP_010919263.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.9    2e-19   
ref|XP_010676528.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  95.5    2e-19   
emb|CDX74763.1|  BnaA05g05090D                                        95.9    2e-19   
ref|XP_003631422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.9    2e-19   
ref|XP_003570086.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  95.9    2e-19   
ref|XP_009408396.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      95.5    2e-19   
gb|KCW77596.1|  hypothetical protein EUGRSUZ_D01910                   95.5    2e-19   
ref|XP_010434567.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  95.9    2e-19   
ref|XP_006482012.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  95.1    2e-19   
ref|XP_009112973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  95.1    2e-19   
emb|CDY47347.1|  BnaCnng14840D                                        95.1    2e-19   
emb|CDY49194.1|  BnaA09g10840D                                        95.1    2e-19   
emb|CDX86759.1|  BnaA09g21490D                                        95.9    2e-19   
ref|XP_010112554.1|  E3 ubiquitin-protein ligase                      95.1    3e-19   
gb|EPS63490.1|  hypothetical protein M569_11294                       95.1    3e-19   
gb|EMT20198.1|  E3 ubiquitin-protein ligase                           94.4    3e-19   
ref|XP_008662009.1|  PREDICTED: LOC100284185 isoform X1               95.1    3e-19   
ref|XP_010553505.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.5    3e-19   
ref|NP_001130198.1|  uncharacterized LOC100191292                     95.1    3e-19   
ref|NP_001150553.1|  LOC100284185                                     95.1    3e-19   
ref|XP_006477418.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.1    3e-19   
ref|XP_009401774.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  95.9    3e-19   
ref|XP_009626445.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  95.1    3e-19   
ref|XP_003517458.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.1    4e-19   
ref|XP_007158469.1|  hypothetical protein PHAVU_002G155000g           95.1    4e-19   
gb|EYU32071.1|  hypothetical protein MIMGU_mgv1a008136mg              94.7    4e-19   
ref|XP_008467019.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      94.7    4e-19   
ref|XP_009778598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.7    4e-19   
emb|CDY37062.1|  BnaA04g26400D                                        94.7    4e-19   
ref|XP_010533709.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  94.7    5e-19   
gb|KDP25486.1|  hypothetical protein JCGZ_20642                       94.7    5e-19   
ref|XP_010540671.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  94.7    5e-19   
ref|XP_009351549.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    5e-19   
gb|KCW77597.1|  hypothetical protein EUGRSUZ_D01910                   94.0    5e-19   
ref|XP_010272924.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    5e-19   
ref|XP_011035066.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  94.4    5e-19   
ref|XP_011091747.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.0    5e-19   
ref|XP_011070566.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    5e-19   
ref|XP_002509740.1|  cleavage and polyadenylation specificity fac...  94.4    5e-19   
ref|XP_003570691.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    6e-19   
gb|ADK63418.1|  C3HC4 type zinc finger protein                        94.0    6e-19   
gb|ACN40787.1|  unknown                                               94.4    6e-19   
ref|XP_006430473.1|  hypothetical protein CICLE_v10012313mg           93.6    6e-19   
ref|XP_010430653.1|  PREDICTED: cleavage and polyadenylation spec...  97.1    6e-19   
ref|XP_006294289.1|  hypothetical protein CARUB_v10023298mg           94.7    6e-19   
ref|XP_004976528.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  94.4    6e-19   
ref|XP_005706452.1|  zinc finger (C3HC4-type RING finger) family ...  94.0    7e-19   
ref|XP_008358659.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.4    7e-19   
ref|XP_002320753.2|  hypothetical protein POPTR_0014s07110g           94.0    7e-19   
ref|XP_009762973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.4    7e-19   



>ref|XP_009611099.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Nicotiana tomentosiformis]
Length=349

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 167/188 (89%), Gaps = 3/188 (2%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGSSV--QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQRD+ SA  DIEQQ + +       ++E+CRTC+ELFFAIWFVMGNVWVFD+RFGSF R
Sbjct  163  RQRDD-SATSDIEQQINHDELRALPPLLERCRTCIELFFAIWFVMGNVWVFDSRFGSFHR  221

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLCISLLAWNAVTYSFPFILFV+LCCCVP++SS LGYNMNMGSV+RGAS+EQLS+
Sbjct  222  APKLHVLCISLLAWNAVTYSFPFILFVLLCCCVPLLSSLLGYNMNMGSVDRGASDEQLSN  281

Query  419  LPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCP  240
            LP+WKYK++ N  + ++EN ECCICLA+YRDKEE+RQLPCSH+FHL CVDQWLRIISCCP
Sbjct  282  LPSWKYKEIRNKEEFQSENAECCICLAKYRDKEEIRQLPCSHIFHLKCVDQWLRIISCCP  341

Query  239  LCKKDLAR  216
            LCK++L R
Sbjct  342  LCKQELER  349



>ref|XP_009762623.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=337

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 14/194 (7%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGSSVQM---VEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            RQRD      DIEQQ + +  S  +   +E+CRTC+ELFFAIWFVMGNVWVFD+RFGSF 
Sbjct  150  RQRD------DIEQQINHDDESRALPPLLERCRTCIELFFAIWFVMGNVWVFDSRFGSFH  203

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLHVLCISLLAWNA+TYSFPFILFV+LCCCVP++SS LGYNMNMGS++RGAS+EQLS
Sbjct  204  RAPKLHVLCISLLAWNAITYSFPFILFVLLCCCVPILSSLLGYNMNMGSLDRGASDEQLS  263

Query  422  SLPTWKYKQVCNNPD-----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            +LP+WKYK++ N  +     ++NEN ECCICLA+YRDKEEMR+LPCSH+FHL CVDQWLR
Sbjct  264  NLPSWKYKEIGNKQEFQTSAIDNENAECCICLAKYRDKEEMRELPCSHIFHLKCVDQWLR  323

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK++L R
Sbjct  324  IISCCPLCKQELER  337



>emb|CDP13685.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 165/192 (86%), Gaps = 6/192 (3%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRA  597
            + + E S + D+EQQRS + S S+  + K RT +ELFFAIWFVMGNVWVFD+RFGSFR A
Sbjct  151  QNQGEGSNISDVEQQRSHDDSRSLHCMNKYRTFLELFFAIWFVMGNVWVFDSRFGSFRHA  210

Query  596  PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL  417
            PKLHVLCISLLAWNA++YSFPFILFV+LCCCVP++S+ LGYNMNMGS++RGA++EQLS L
Sbjct  211  PKLHVLCISLLAWNAISYSFPFILFVLLCCCVPLLSTLLGYNMNMGSIDRGATDEQLSKL  270

Query  416  PTWKYKQVCNNPD-----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRII  252
            P+WKYK+V NN +     L NENPECCICLA+YRD+EEMRQLPCSHVFHL CVD WLRII
Sbjct  271  PSWKYKEVGNNLELGNSALNNENPECCICLAKYRDREEMRQLPCSHVFHLKCVDHWLRII  330

Query  251  SCCPLCKKDLAR  216
            SCCPLCK++L R
Sbjct  331  SCCPLCKQELER  342



>ref|XP_010245027.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nelumbo 
nucifera]
Length=346

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 158/191 (83%), Gaps = 11/191 (6%)
 Frame = -2

Query  755  SAVXDIEQQRSX-EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVL  579
            S + D+EQQRS  E     ++ + RT +ELFFAIWFVMGNVWVFD+RFGSF RAPKLHVL
Sbjct  155  SGLSDVEQQRSSDEPRRSHLMNRARTLLELFFAIWFVMGNVWVFDSRFGSFNRAPKLHVL  214

Query  578  CISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK  399
            CISLLAWNAVTYSFPF+LFV+LCCCVP++S+ LGYNMNMGSVERGAS++QLS LP+W+YK
Sbjct  215  CISLLAWNAVTYSFPFLLFVLLCCCVPLISNLLGYNMNMGSVERGASDDQLSRLPSWRYK  274

Query  398  QVCNN----------PDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            +V  N           +L NEN ECCICLA+Y+D+EE+RQL CSHVFHL CVDQWLRIIS
Sbjct  275  EVEANIELGDDAQSSSELANENSECCICLAKYKDREEVRQLQCSHVFHLKCVDQWLRIIS  334

Query  248  CCPLCKKDLAR  216
            CCPLCK++L R
Sbjct  335  CCPLCKQELER  345



>emb|CAN74282.1| hypothetical protein VITISV_016708 [Vitis vinifera]
Length=343

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 164/196 (84%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + DIEQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF RAP
Sbjct  149  QGDGFS-LPDIEQQRNNEESRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI+LLAWNA++YSFPF+LFV+LCCCVP+VS+ LGYNMNMGSV++GAS++Q+S LP
Sbjct  208  KLHVLCITLLAWNAISYSFPFLLFVLLCCCVPLVSNLLGYNMNMGSVDKGASDDQISRLP  267

Query  413  TWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W++K+   N DL N          E PECCICLA+YR+KEE+RQLPCSH+FHL CVDQW
Sbjct  268  SWRFKEANANLDLPNGADSNSPLSSEYPECCICLAKYREKEEVRQLPCSHMFHLKCVDQW  327

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK+++ R
Sbjct  328  LRIISCCPLCKQEIER  343



>ref|XP_002267586.3| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Vitis vinifera]
 emb|CBI39785.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 164/196 (84%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + DIEQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF RAP
Sbjct  149  QGDGFS-LPDIEQQRNNEESRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI+LLAWNA++YSFPF+LFV+LCCCVP+VS+ LGYNMNMGSV++GAS++Q+S LP
Sbjct  208  KLHVLCITLLAWNAISYSFPFLLFVLLCCCVPLVSNLLGYNMNMGSVDKGASDDQISRLP  267

Query  413  TWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W++K+   N DL N          E PECCICLA+YR+KEE+RQLPCSH+FHL CVDQW
Sbjct  268  SWRFKEANANLDLPNGADSNSPLSSEYPECCICLAKYREKEEVRQLPCSHMFHLKCVDQW  327

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK+++ R
Sbjct  328  LRIISCCPLCKQEIER  343



>ref|XP_004294914.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   281 bits (718),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 161/194 (83%), Gaps = 10/194 (5%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQR  E S +  ++ KCRT +ELFFAIWFVMGNVWVFD+RF SF  AP
Sbjct  137  QGDGFN-ISDLEQQRGVEESRTTHLMTKCRTSLELFFAIWFVMGNVWVFDSRFNSFPGAP  195

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI LLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++ AS++Q+S LP
Sbjct  196  KLHVLCIVLLAWNAISYSFPFLLFVLLCCCVPLISSMLGYNMNMGSIDKAASDDQISQLP  255

Query  413  TWKYKQVC--------NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            +W+YK+V          N DL NE+P+CCICLA+YRDKEE+RQLPCSH+FHL CVDQWLR
Sbjct  256  SWRYKEVNTTVDFRSDGNSDLVNEDPDCCICLAKYRDKEEVRQLPCSHMFHLKCVDQWLR  315

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK++L R
Sbjct  316  IISCCPLCKQELQR  329



>ref|XP_009347513.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
 ref|XP_009347523.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
Length=342

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 163/195 (84%), Gaps = 12/195 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT +ELFFAIWFVMGNVWVFD+RF S   AP
Sbjct  150  QSDGFN-ISDLEQQRSTEESRTTHLMNRCRTSLELFFAIWFVMGNVWVFDSRFSSLPGAP  208

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++GAS++Q+S LP
Sbjct  209  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLISSLLGYNMNMGSIDKGASDDQISQLP  268

Query  413  TWKYKQV---------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            +W+YK+V         CN+  L NE+P+CCICLA+YRDKEE+RQLPCSH FHL CVDQWL
Sbjct  269  SWRYKEVNAKVELGNDCNSGSL-NEDPDCCICLAKYRDKEEVRQLPCSHTFHLKCVDQWL  327

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK++L R
Sbjct  328  RIISCCPLCKQELQR  342



>ref|XP_009367256.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Pyrus x bretschneideri]
Length=341

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 165/195 (85%), Gaps = 12/195 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT +ELFFA+WFVMGNVWVFD+RF SF  AP
Sbjct  149  QSDGFN-LSDVEQQRSTEDSRTTHLMNRCRTSLELFFAVWFVMGNVWVFDSRFSSFTGAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++GAS++Q+S LP
Sbjct  208  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLISSLLGYNMNMGSIDKGASDDQISQLP  267

Query  413  TWKYKQV---------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            +W+YK+V         C++  L N++P+CCICLA+YRDKEE+RQLPCSH+FHL+CVD WL
Sbjct  268  SWRYKEVNAKIELGNDCDSGSL-NDDPDCCICLAKYRDKEEVRQLPCSHMFHLSCVDHWL  326

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK++L R
Sbjct  327  RIISCCPLCKQELQR  341



>ref|XP_008384599.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Malus 
domestica]
 ref|XP_008384600.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Malus 
domestica]
Length=341

 Score =   279 bits (714),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 162/194 (84%), Gaps = 10/194 (5%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT +ELFFA+WFVMGNVWVFD+RF SF  AP
Sbjct  149  QSDGFN-LSDLEQQRSTEDSRTTHLMNRCRTSLELFFAVWFVMGNVWVFDSRFSSFTVAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGSV++GAS++Q+S LP
Sbjct  208  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLISSLLGYNMNMGSVDKGASDDQISQLP  267

Query  413  TWKYKQVCNNPDLE--------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            +W+Y+ V    +L         NE+P+CCICLA+YRDKEE+R+LPCSH+FHLNCVD WLR
Sbjct  268  SWRYEXVNTKIELRNDCDSGSLNEDPDCCICLAKYRDKEEVRRLPCSHMFHLNCVDHWLR  327

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK++L R
Sbjct  328  IISCCPLCKQELQR  341



>ref|XP_008218667.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Prunus 
mume]
Length=343

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 163/195 (84%), Gaps = 11/195 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT +ELFFAIWFVMGNVWVFD+RF SF  AP
Sbjct  150  QGDGFN-LSDMEQQRSTEESRTTHLMNRCRTSLELFFAIWFVMGNVWVFDSRFSSFPGAP  208

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++ AS++Q+S LP
Sbjct  209  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLMSSLLGYNMNMGSIDKAASDDQISQLP  268

Query  413  TWKYKQV---------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            +W+YK+V         C++  L NE+P+CCICLA+Y+D EE+RQLPCSH+FHL CVDQWL
Sbjct  269  SWRYKEVNTKVELGNDCDSGCLANEDPDCCICLAKYKDTEEVRQLPCSHMFHLKCVDQWL  328

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK++L R
Sbjct  329  RIISCCPLCKQELQR  343



>ref|XP_007205484.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
 gb|EMJ06683.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
Length=343

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 163/195 (84%), Gaps = 11/195 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT +ELFFAIWFVMGNVWVFD+RF SF  AP
Sbjct  150  QGDGFN-LSDMEQQRSTEESRTTHLMNRCRTSLELFFAIWFVMGNVWVFDSRFSSFPGAP  208

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++ AS++Q+S LP
Sbjct  209  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLMSSLLGYNMNMGSIDKAASDDQISQLP  268

Query  413  TWKYKQV---------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            +W+YK+V         C++  L NE+P+CCICLA+Y+D EE+RQLPCSH+FHL CVDQWL
Sbjct  269  SWRYKEVNTKVELGNDCDSGCLANEDPDCCICLAKYKDTEEVRQLPCSHMFHLKCVDQWL  328

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK++L R
Sbjct  329  RIISCCPLCKQELQR  343



>ref|XP_008353104.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Malus 
domestica]
Length=342

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 162/195 (83%), Gaps = 12/195 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT + LFFAIWFVMGNVWVFD+RF S   AP
Sbjct  150  QSDGFN-LSDLEQQRSTEESRTTHLMNRCRTSLXLFFAIWFVMGNVWVFDSRFSSLPGAP  208

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGSV++GAS++Q+S LP
Sbjct  209  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLISSLLGYNMNMGSVDKGASDDQISQLP  268

Query  413  TWKYKQV---------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            +W+YK+V         CN   L NE+P+CCICLA+YRDKEE+RQLPCSH+FHL CVDQWL
Sbjct  269  SWRYKEVNAKVELGNDCNXGSL-NEDPDCCICLAKYRDKEEVRQLPCSHMFHLKCVDQWL  327

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK++L R
Sbjct  328  RIISCCPLCKQELQR  342



>ref|XP_006346113.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
tuberosum]
Length=325

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  743  DIEQQRSXEGSS--VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            D+EQQ S + S      +E+CRT +E FFAIWFVMGNVWVFD+RFGSF  APKLHVLCIS
Sbjct  149  DLEQQISHDESRELPSRMERCRTWIEFFFAIWFVMGNVWVFDSRFGSFHNAPKLHVLCIS  208

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNAVTYSFPFILFV+LCCCVP++S+FLGYNMNMGSV+RGA++EQLS+LP+WKYK++ 
Sbjct  209  LLAWNAVTYSFPFILFVLLCCCVPILSNFLGYNMNMGSVDRGATDEQLSNLPSWKYKEIG  268

Query  389  NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            N  ++ + + ECCICLA+Y++KEE+R+LPCSH+FHLNCVDQWL+IISCCPLCK++L R
Sbjct  269  NKEEITSCD-ECCICLAKYKEKEEIRELPCSHIFHLNCVDQWLKIISCCPLCKQELER  325



>ref|XP_008384601.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Malus 
domestica]
Length=334

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 15/193 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPK  591
            Q D F+ + D+EQQRS E S      +CRT +ELFFA+WFVMGNVWVFD+RF SF  APK
Sbjct  149  QSDGFN-LSDLEQQRSTEDS------RCRTSLELFFAVWFVMGNVWVFDSRFSSFTVAPK  201

Query  590  LHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPT  411
            LHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGSV++GAS++Q+S LP+
Sbjct  202  LHVLCISLLAWNAISYSFPFLLFVLLCCCVPLISSLLGYNMNMGSVDKGASDDQISQLPS  261

Query  410  WKYKQVCNNPDLE--------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRI  255
            W+Y+ V    +L         NE+P+CCICLA+YRDKEE+R+LPCSH+FHLNCVD WLRI
Sbjct  262  WRYEXVNTKIELRNDCDSGSLNEDPDCCICLAKYRDKEEVRRLPCSHMFHLNCVDHWLRI  321

Query  254  ISCCPLCKKDLAR  216
            ISCCPLCK++L R
Sbjct  322  ISCCPLCKQELQR  334



>ref|XP_006344901.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Solanum 
tuberosum]
Length=354

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 153/189 (81%), Gaps = 13/189 (7%)
 Frame = -2

Query  743  DIEQQRSXE-----GSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRF-GSFRRAPKLHV  582
            D EQQRS        SS+ M+EK +T +ELFFAIWFVMGNVWVF++R   S+ RAPKLH+
Sbjct  166  DTEQQRSSHDDQSRASSLHMMEKFKTSMELFFAIWFVMGNVWVFESRLLMSYHRAPKLHL  225

Query  581  LCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKY  402
            LCISLL WNAVTYSFPFILF++LCCCVPM+S+FLGYNMNM SV+RGAS EQLS+LP+WKY
Sbjct  226  LCISLLTWNAVTYSFPFILFLLLCCCVPMLSTFLGYNMNMASVDRGASEEQLSTLPSWKY  285

Query  401  KQVCNNPD-------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCC  243
            K    N +       L+NEN ECCICLA+Y DKE++RQLPCSH+FHL CVDQWLRIISCC
Sbjct  286  KSEIGNKEEDLTNSALQNENSECCICLAKYGDKEDIRQLPCSHIFHLKCVDQWLRIISCC  345

Query  242  PLCKKDLAR  216
            PLCK+ L R
Sbjct  346  PLCKQQLER  354



>ref|XP_008218676.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Prunus 
mume]
Length=336

 Score =   273 bits (699),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 160/194 (82%), Gaps = 16/194 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPK  591
            Q D F+ + D+EQQRS E S      +CRT +ELFFAIWFVMGNVWVFD+RF SF  APK
Sbjct  150  QGDGFN-LSDMEQQRSTEES------RCRTSLELFFAIWFVMGNVWVFDSRFSSFPGAPK  202

Query  590  LHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPT  411
            LHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++ AS++Q+S LP+
Sbjct  203  LHVLCISLLAWNAISYSFPFLLFVLLCCCVPLMSSLLGYNMNMGSIDKAASDDQISQLPS  262

Query  410  WKYKQV---------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            W+YK+V         C++  L NE+P+CCICLA+Y+D EE+RQLPCSH+FHL CVDQWLR
Sbjct  263  WRYKEVNTKVELGNDCDSGCLANEDPDCCICLAKYKDTEEVRQLPCSHMFHLKCVDQWLR  322

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK++L R
Sbjct  323  IISCCPLCKQELQR  336



>ref|XP_010313952.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin protein ligase RIE1 
[Solanum lycopersicum]
Length=276

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 153/190 (81%), Gaps = 14/190 (7%)
 Frame = -2

Query  743  DIEQQRSXE------GSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRF-GSFRRAPKLH  585
            DIEQQRS         SS+ M+E+ +T +ELFFAIWFVMGNVWVF++R   S+ RAPKLH
Sbjct  87   DIEQQRSSHDDQSRRASSLHMMERFKTSMELFFAIWFVMGNVWVFESRLLMSYHRAPKLH  146

Query  584  VLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWK  405
            +LCISLL WNAV YSFPFILF++LCCCVPM+S+FLGYNMNM SV+RGAS+EQLS+LPTWK
Sbjct  147  LLCISLLTWNAVAYSFPFILFLLLCCCVPMLSTFLGYNMNMASVDRGASDEQLSTLPTWK  206

Query  404  YKQVCNNP--DLEN-----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
            YK    N   DL N     EN ECCICLA+Y DKE++RQLPCSH+FHL CVDQWL+IISC
Sbjct  207  YKSEIGNKEEDLTNSAPQDENSECCICLAKYGDKEDIRQLPCSHIFHLKCVDQWLKIISC  266

Query  245  CPLCKKDLAR  216
            CPLCK+ L R
Sbjct  267  CPLCKQQLER  276



>ref|XP_011095581.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Sesamum 
indicum]
Length=339

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  743  DIEQQRSX-EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISL  567
            DIEQQRS  E   +Q ++KC+T +EL FAIWFVMGNVWVFD+RF S+ RAPKLHVLCISL
Sbjct  158  DIEQQRSHRESRDLQYMQKCKTSLELLFAIWFVMGNVWVFDSRFASYHRAPKLHVLCISL  217

Query  566  LAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN  387
            LAWNAV+YSFPFILFV+LCCCVPM+SS LGYNMN  S++RGA+ EQL+SLP+WKYK   +
Sbjct  218  LAWNAVSYSFPFILFVLLCCCVPMLSSLLGYNMNTASLQRGATEEQLASLPSWKYKDAGS  277

Query  386  NPDLEN-----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
              +L N     E  ECCICLA+YR+KEE+RQLPC+H+FH+ CVDQWL+IISCCPLCK+ +
Sbjct  278  ISELGNSTKNHEVQECCICLAKYREKEEIRQLPCTHIFHMKCVDQWLKIISCCPLCKQGI  337

Query  221  AR  216
             +
Sbjct  338  EK  339



>ref|XP_004244025.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=329

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 156/178 (88%), Gaps = 3/178 (2%)
 Frame = -2

Query  743  DIEQQRSXEGSSV--QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            D+EQQ S + S      +E+CRT +E FFAIWFVMGNVWVFD+RFGSF  APKLH +CIS
Sbjct  153  DLEQQISHDESRALPSRMERCRTWIEFFFAIWFVMGNVWVFDSRFGSFHNAPKLHDVCIS  212

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LL WNA+TYSFPFILFV+LCCCVP++S+FLGYNMNMGS++RGA++EQLS+LP+WKYK++ 
Sbjct  213  LLVWNAITYSFPFILFVLLCCCVPILSNFLGYNMNMGSIDRGATDEQLSNLPSWKYKEIG  272

Query  389  NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            N  ++ + + ECCICLA+Y++KEE+R+LPCSH+FHLNCVDQWL+IISCCPLCK++L R
Sbjct  273  NIEEITSCD-ECCICLAKYKEKEEIRELPCSHIFHLNCVDQWLKIISCCPLCKQELER  329



>ref|XP_010922953.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Elaeis 
guineensis]
Length=318

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  755  SAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVL  579
            S V D+EQQ + E S S  ++ K RT +ELFFAIWFVMGNVW+FD+R GSF RAPKLHVL
Sbjct  138  SHVSDLEQQMNTEESRSSNLMNKSRTLLELFFAIWFVMGNVWMFDSRNGSFDRAPKLHVL  197

Query  578  CISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK  399
            C++LLAWNA+ YSFPF+LFV+LCCCVP +S+ LGYNMN+ S +RGAS++Q+S LP W++K
Sbjct  198  CLTLLAWNAIVYSFPFLLFVLLCCCVPFISNTLGYNMNLASADRGASDDQISRLPHWQFK  257

Query  398  QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            +V    D  +EN ECCICLA+YRD+EE+RQLPCSH+FHL CVDQWLRIIS CPLCK++L 
Sbjct  258  KVEPMSDTASENTECCICLAKYRDREEVRQLPCSHLFHLRCVDQWLRIISSCPLCKQELE  317

Query  218  R  216
            +
Sbjct  318  K  318



>ref|XP_009120112.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Brassica 
rapa]
Length=329

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -2

Query  743  DIEQQR--SXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ   + E  S  ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLC+S
Sbjct  151  DIEQQHRGTEENRSSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFNHAPTLHVLCVS  210

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNA+ YSFPF+LF+ LCC VP+ SS LGYNMNMGS +RGAS++++SSLP+WKYK++ 
Sbjct  211  LLAWNALCYSFPFLLFMFLCCIVPLASSLLGYNMNMGSSDRGASDDEISSLPSWKYKRID  270

Query  389  NNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            +N      ++P+CCICL +Y+DK+E+R+LPCSH FHL CVDQWLRIISCCPLCK+DL R
Sbjct  271  DNASAPATDDPQCCICLGKYKDKDEVRELPCSHKFHLKCVDQWLRIISCCPLCKQDLPR  329



>gb|KHN23825.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=464

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 157/200 (79%), Gaps = 12/200 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D  S + D+EQQR+ E + +  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF  AP
Sbjct  145  QGDSLS-LSDMEQQRNNEETRMSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHHAP  203

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI LLAWNA+ YSFPF+LFV+LCCCVP++S+ LGYNMNM S  +GAS++Q+S LP
Sbjct  204  KLHVLCIILLAWNAMCYSFPFLLFVLLCCCVPLISTLLGYNMNMASSNKGASDDQISQLP  263

Query  413  TWKYKQVC----------NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W++K+             +  L NE+PECCICLA+Y+DKEE+RQLPCSH+FHL CVDQW
Sbjct  264  SWRHKEAGVKLELGNGSEGSKKLINEDPECCICLAKYKDKEEVRQLPCSHMFHLKCVDQW  323

Query  263  LRIISCCPLCKKDLAR*MKS  204
            L+I SCCPLCK+ L R  K+
Sbjct  324  LKITSCCPLCKQGLEREYKA  343



>emb|CDY17377.1| BnaA10g10110D [Brassica napus]
Length=329

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -2

Query  743  DIEQQR--SXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ   + +  S  ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLC+S
Sbjct  151  DIEQQHRGTEDNRSSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFNHAPTLHVLCVS  210

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNA+ YSFPF+LF+ LCC VP+ SS LGYNMNMGS +RGAS++Q+SSLP+WKYK++ 
Sbjct  211  LLAWNALCYSFPFLLFMFLCCIVPLASSLLGYNMNMGSSDRGASDDQISSLPSWKYKRID  270

Query  389  NNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            +N      ++P+CCICL +Y+DK+E+R+LPCSH FHL CVDQWLRIISCCPLCK+DL R
Sbjct  271  DNASAPATDDPQCCICLGKYKDKDEVRELPCSHKFHLKCVDQWLRIISCCPLCKQDLPR  329



>ref|XP_010061429.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Eucalyptus 
grandis]
 gb|KCW68370.1| hypothetical protein EUGRSUZ_F02028 [Eucalyptus grandis]
 gb|KCW68371.1| hypothetical protein EUGRSUZ_F02028 [Eucalyptus grandis]
Length=335

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 162/196 (83%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR  E S SV ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  141  QGDGF-GISDLEQQRGGEDSRSVHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  199

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLH+LCISLLAWNAV+YSFPF+LF++LCC VP++S+FLGYNMN+ SVERGAS++Q+S LP
Sbjct  200  KLHMLCISLLAWNAVSYSFPFLLFLLLCCFVPLMSTFLGYNMNVASVERGASDDQISRLP  259

Query  413  TWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +WKYKQV NN  L           NE+ ECCICL++Y+++EE+RQLPCSH+FH  CVDQW
Sbjct  260  SWKYKQVDNNLGLSDDSNHNLVPANEDKECCICLSKYKEREEVRQLPCSHMFHQKCVDQW  319

Query  263  LRIISCCPLCKKDLAR  216
            LRI SCCPLCKK+L R
Sbjct  320  LRITSCCPLCKKELER  335



>ref|XP_010061428.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Eucalyptus 
grandis]
Length=342

 Score =   263 bits (673),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 162/196 (83%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR  E S SV ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  148  QGDGF-GISDLEQQRGGEDSRSVHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  206

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLH+LCISLLAWNAV+YSFPF+LF++LCC VP++S+FLGYNMN+ SVERGAS++Q+S LP
Sbjct  207  KLHMLCISLLAWNAVSYSFPFLLFLLLCCFVPLMSTFLGYNMNVASVERGASDDQISRLP  266

Query  413  TWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +WKYKQV NN  L           NE+ ECCICL++Y+++EE+RQLPCSH+FH  CVDQW
Sbjct  267  SWKYKQVDNNLGLSDDSNHNLVPANEDKECCICLSKYKEREEVRQLPCSHMFHQKCVDQW  326

Query  263  LRIISCCPLCKKDLAR  216
            LRI SCCPLCKK+L R
Sbjct  327  LRITSCCPLCKKELER  342



>ref|XP_009120113.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Brassica 
rapa]
Length=328

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  743  DIEQQR--SXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ   + E  S  ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLC+S
Sbjct  151  DIEQQHRGTEENRSSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFNHAPTLHVLCVS  210

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNA+ YSFPF+LF+ LCC VP+ SS LGYNMNMGS +RGAS++++SSLP+WKYK++ 
Sbjct  211  LLAWNALCYSFPFLLFMFLCCIVPLASSLLGYNMNMGSSDRGASDDEISSLPSWKYKRID  270

Query  389  NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            +N      +  CCICL +Y+DK+E+R+LPCSH FHL CVDQWLRIISCCPLCK+DL R
Sbjct  271  DNASAPATDDPCCICLGKYKDKDEVRELPCSHKFHLKCVDQWLRIISCCPLCKQDLPR  328



>emb|CDY61181.1| BnaCnng37430D [Brassica napus]
Length=329

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = -2

Query  743  DIEQQR--SXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ   + +  S +++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLC+S
Sbjct  151  DIEQQHRGTEDNRSSRLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFNHAPTLHVLCVS  210

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNA+ YSFPF+LF+ LCC VP+ SS LGYNMNMGS +RGAS++++SSLP+WKYK++ 
Sbjct  211  LLAWNALCYSFPFLLFMFLCCIVPLASSLLGYNMNMGSSDRGASDDEISSLPSWKYKRID  270

Query  389  NNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            +N      ++P+CCICLA+Y+DK+E+ +LPCSH FHL CVDQWLRIISCCPLCK+DL R
Sbjct  271  DNASAPATDDPQCCICLAKYKDKDEVTELPCSHKFHLKCVDQWLRIISCCPLCKQDLPR  329



>ref|XP_008791159.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Phoenix 
dactylifera]
Length=320

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRA  597
            R  +  + V D+EQQ S E S S  ++ K RT +ELFFAIWFVMGNVW+FD+R GSF RA
Sbjct  133  RHSNISNVVTDLEQQMSAEESRSSHLMNKSRTLLELFFAIWFVMGNVWIFDSRHGSFDRA  192

Query  596  PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL  417
            PKLHVLC++LLAWNA+ YSFPF+LFV+LCCCVP +SS LGYNMN+ S +RGAS++Q+S L
Sbjct  193  PKLHVLCLTLLAWNAIVYSFPFLLFVLLCCCVPFISSTLGYNMNLASADRGASDDQISRL  252

Query  416  PTWKYKQVCNNPDLENENPE-CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCP  240
            P W++K+V       +ENPE CCICLA+Y D+EE+RQLPCSH+FHL CVDQWLRIIS CP
Sbjct  253  PHWQFKKVEPMTGTASENPECCCICLAKYGDREEVRQLPCSHLFHLRCVDQWLRIISSCP  312

Query  239  LCKKDLAR  216
            LCK++L +
Sbjct  313  LCKQELEK  320



>gb|KHN43912.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=322

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 154/194 (79%), Gaps = 12/194 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D  S + DIEQQR+ E + +  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF  AP
Sbjct  130  QGDSLS-LSDIEQQRNNEETRMSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHHAP  188

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI LLAWNA+ YSFPF+LFV+LCCCVP++S+ LGYNMNM S  +GAS++Q+S LP
Sbjct  189  KLHVLCIILLAWNAMCYSFPFLLFVLLCCCVPLISTLLGYNMNMASSNKGASDDQISQLP  248

Query  413  TWKYKQVC----------NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W++K+             +  L NE+PECCICLA+Y+D+EE+RQLPCSH+FHL CVDQW
Sbjct  249  SWRHKEAGAKLELGNASEGSEKLINEDPECCICLAKYKDEEEVRQLPCSHMFHLKCVDQW  308

Query  263  LRIISCCPLCKKDL  222
            L+I SCCP+CK+ L
Sbjct  309  LKITSCCPICKQGL  322



>ref|XP_009791010.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
sylvestris]
 ref|XP_009791011.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
sylvestris]
Length=336

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 5/186 (3%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSX-EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            QRD+     D+EQQRS  E  ++ ++EK RT VELFFAIWFVMGNVWVF++RF S+ RAP
Sbjct  155  QRDD----SDMEQQRSHDESRALHVMEKFRTGVELFFAIWFVMGNVWVFESRFLSYHRAP  210

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLH+LCISLLAWNAVTYSFPF+LF++LCCCVP++SSFLGYNMNMGSV+RGAS+EQLSSLP
Sbjct  211  KLHLLCISLLAWNAVTYSFPFLLFLLLCCCVPILSSFLGYNMNMGSVDRGASDEQLSSLP  270

Query  413  TWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
            +WKYK+  N     +EN ECCICLA+Y DKEE+RQLPCSH+FHL CVDQWLRIISCCPLC
Sbjct  271  SWKYKECGNKEQPTSENVECCICLAKYGDKEEIRQLPCSHIFHLKCVDQWLRIISCCPLC  330

Query  233  KKDLAR  216
            K++L R
Sbjct  331  KQELER  336



>gb|KHG22760.1| hypothetical protein F383_06014 [Gossypium arboreum]
Length=339

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 164/192 (85%), Gaps = 8/192 (4%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  149  QGDGF-GLADVEQQRTNEESRSTHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA+ YSFPF+LF++LCCCVP++SS LGYNMNMGS +RGAS++Q+S LP
Sbjct  208  NLHVLCISLLAWNALCYSFPFLLFLLLCCCVPLISSLLGYNMNMGSTDRGASDDQISGLP  267

Query  413  TWKYKQVCNNPDLE------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRII  252
            +W+YK++  N +L+      NE+PECCICLA+Y+DKEE+RQLPCSH+FHL CVDQWLRII
Sbjct  268  SWRYKEISTNSELDHNSDHTNEDPECCICLAKYKDKEEVRQLPCSHMFHLKCVDQWLRII  327

Query  251  SCCPLCKKDLAR  216
            SCCPLCK++L R
Sbjct  328  SCCPLCKQELER  339



>gb|KJB13895.1| hypothetical protein B456_002G102600 [Gossypium raimondii]
Length=339

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 163/192 (85%), Gaps = 8/192 (4%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF RAP
Sbjct  149  QGDGF-GLADVEQQRTNEESRSTHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA+ YSFPF+LF++LCCCVP++SS LGYNMNMGS +RGAS++Q+S LP
Sbjct  208  NLHVLCISLLAWNALCYSFPFLLFLLLCCCVPLISSLLGYNMNMGSTDRGASDDQISRLP  267

Query  413  TWKYKQVCNNPDLE------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRII  252
            +W+YK++  N +L+      NE+PECCICLA+Y+DKEE+RQLPCSH+FHL CVDQWLRII
Sbjct  268  SWRYKEISTNSELDHNSDHTNEDPECCICLAKYKDKEEVRQLPCSHMFHLKCVDQWLRII  327

Query  251  SCCPLCKKDLAR  216
            SCCPLCK++L R
Sbjct  328  SCCPLCKQELER  339



>gb|KHG25819.1| hypothetical protein F383_09207 [Gossypium arboreum]
Length=342

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 160/190 (84%), Gaps = 11/190 (6%)
 Frame = -2

Query  752  AVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
             + DIEQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RF SF RAP LHVLC
Sbjct  153  GLSDIEQQRTSEESRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFRSFHRAPNLHVLC  212

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ  396
            ISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMGS+ERGAS++Q+S LP+W+YK+
Sbjct  213  ISLLAWNALSYSFPFLLFLLLCCCVPLISSLLGYNMNMGSIERGASDDQISRLPSWRYKE  272

Query  395  VCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
            +  N DL+          NE+PECCICLA Y+DKEE+RQLPCSH+FHL CVDQWLRIISC
Sbjct  273  INTNLDLDHDLNCDTSQANEDPECCICLANYKDKEEVRQLPCSHIFHLRCVDQWLRIISC  332

Query  245  CPLCKKDLAR  216
            CPLCK++L R
Sbjct  333  CPLCKQELDR  342



>ref|XP_007020422.1| RING/U-box domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY11947.1| RING/U-box domain-containing protein isoform 2 [Theobroma cacao]
Length=343

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 164/196 (84%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF RAP
Sbjct  149  QGDGF-GLSDVEQQRANEESRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMGS +RGAS++Q+S LP
Sbjct  208  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSLLGYNMNMGSNDRGASDDQISRLP  267

Query  413  TWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W+YK++  N +L+          NE+PECCICLA+Y+DKEE+RQLPCSH+FHL CVDQW
Sbjct  268  SWRYKEINTNLELDHDSDCNASLANEDPECCICLAKYKDKEEVRQLPCSHIFHLKCVDQW  327

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK++L R
Sbjct  328  LRIISCCPLCKQELER  343



>ref|XP_007020421.1| RING/U-box domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY11946.1| RING/U-box domain-containing protein isoform 1 [Theobroma cacao]
Length=346

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 165/199 (83%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + D+EQQR+ E SS+     ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF 
Sbjct  149  QGDGF-GLSDVEQQRANEESSMFRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFH  207

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAP LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMGS +RGAS++Q+S
Sbjct  208  RAPNLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSLLGYNMNMGSNDRGASDDQIS  267

Query  422  SLPTWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             LP+W+YK++  N +L+          NE+PECCICLA+Y+DKEE+RQLPCSH+FHL CV
Sbjct  268  RLPSWRYKEINTNLELDHDSDCNASLANEDPECCICLAKYKDKEEVRQLPCSHIFHLKCV  327

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK++L R
Sbjct  328  DQWLRIISCCPLCKQELER  346



>ref|XP_010443237.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Camelina sativa]
Length=343

 Score =   253 bits (646),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 155/195 (79%), Gaps = 9/195 (5%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQ-RSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQ D    + D+EQQ R  E + S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  149  RQLDVGFVLGDVEQQQRGREDTRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHH  208

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLC+ LLAWNAV YSFPF+LF+ LCC VP+VSS LGYNMNMGS ERGAS++Q+SS
Sbjct  209  APKLHVLCVCLLAWNAVCYSFPFLLFLFLCCLVPLVSSILGYNMNMGSSERGASDDQISS  268

Query  419  LPTWKYKQVCNNPD-------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            LP+WKYK++  N            ++PECCICLA+Y+DKEE+R+LPCSH FH  CVDQWL
Sbjct  269  LPSWKYKRIGENASDSDSDSATTTDDPECCICLAKYKDKEEVRKLPCSHKFHSKCVDQWL  328

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK+DL+R
Sbjct  329  RIISCCPLCKQDLSR  343



>ref|XP_002522801.1| ring finger protein, putative [Ricinus communis]
 gb|EEF39652.1| ring finger protein, putative [Ricinus communis]
Length=323

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 160/196 (82%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR  E S    ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF RAP
Sbjct  129  QGDSF-GLSDLEQQRGSEDSRCTHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFNRAP  187

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNM MGS ERGAS++Q+S LP
Sbjct  188  KLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSVLGYNMQMGSAERGASDDQISRLP  247

Query  413  TWKYKQVCNNPD----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +WKYK V  N +          L N++PECCICLA+Y+DKEE+RQLPCSH+FHL CVDQW
Sbjct  248  SWKYKAVDTNSEVASNIDCTSTLANDDPECCICLAKYKDKEEVRQLPCSHMFHLKCVDQW  307

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK++L R
Sbjct  308  LRIISCCPLCKQELER  323



>gb|KJB81576.1| hypothetical protein B456_013G150600 [Gossypium raimondii]
Length=342

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + DIEQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RF SF RAP
Sbjct  148  QGDRF-GLSDIEQQRTNEESRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFRSFHRAP  206

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP+ SS LGYNMNMGS++RGAS++Q+S LP
Sbjct  207  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLTSSLLGYNMNMGSIDRGASDDQISRLP  266

Query  413  TWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W+YK++  N DL+          NE+PECCICLA Y+DKEE+RQLPCSH+FHL CVDQW
Sbjct  267  SWRYKEINTNLDLDHDLNCGTSQANEDPECCICLANYKDKEEVRQLPCSHIFHLKCVDQW  326

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK+ L R
Sbjct  327  LRIISCCPLCKQALDR  342



>ref|XP_010539334.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
 ref|XP_010539335.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
 ref|XP_010539336.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
 ref|XP_010539339.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
Length=342

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 154/183 (84%), Gaps = 6/183 (3%)
 Frame = -2

Query  752  AVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
             + D+EQQR  E +    ++ +CRT +ELFFAIWFV+GNVWVFD+R GSF+RAPKLHVLC
Sbjct  158  GLGDVEQQRGREETRCWHLMNRCRTSLELFFAIWFVIGNVWVFDSRLGSFQRAPKLHVLC  217

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ  396
            ISLLAWNA+ YSFPF+LF++LCC VP+VSS LGYNMNMGS +RGAS++Q+SSLP+W+YK 
Sbjct  218  ISLLAWNALCYSFPFLLFLLLCCVVPLVSSLLGYNMNMGSSDRGASDDQISSLPSWRYKL  277

Query  395  VCNNPDLEN-----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
            + N  D ++     ++PECCICLA+YRDKEE+RQLPCSH FHL CVDQWLRIISCCPLCK
Sbjct  278  IENVSDSDSAHPPAQDPECCICLAKYRDKEEVRQLPCSHTFHLKCVDQWLRIISCCPLCK  337

Query  230  KDL  222
            + L
Sbjct  338  QHL  340



>ref|XP_009132344.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Brassica 
rapa]
Length=325

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 156/190 (82%), Gaps = 5/190 (3%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQ ++ +   DIEQQ     E  S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  135  RQLNQGNWFVDIEQQHRGRDETRSSHLMNKCRTSLELFFAIWFVVGNVWVFDSRFGSFNH  194

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLC+SLL+WNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS +RGAS++Q+SS
Sbjct  195  APKLHVLCVSLLSWNALCYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSDRGASDDQISS  254

Query  419  LPTWKYKQVCNNPD---LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            LP+WK+K+  +N      + ++PECCICLA+Y+DKEE+R+LPCSH FHL CVDQWLRIIS
Sbjct  255  LPSWKHKRADDNASDSAPKTDDPECCICLAKYKDKEEVRKLPCSHKFHLKCVDQWLRIIS  314

Query  248  CCPLCKKDLA  219
            CCPLCK+DL+
Sbjct  315  CCPLCKQDLS  324



>gb|KJB81575.1| hypothetical protein B456_013G150600 [Gossypium raimondii]
Length=345

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 161/199 (81%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS----SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + DIEQQR+ E S    S  ++ KCRT +ELFFAIWFVMGNVWVFD+RF SF 
Sbjct  148  QGDRF-GLSDIEQQRTNEESRMFRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFRSFH  206

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAP LHVLCISLLAWNA++YSFPF+LF++LCCCVP+ SS LGYNMNMGS++RGAS++Q+S
Sbjct  207  RAPNLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLTSSLLGYNMNMGSIDRGASDDQIS  266

Query  422  SLPTWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             LP+W+YK++  N DL+          NE+PECCICLA Y+DKEE+RQLPCSH+FHL CV
Sbjct  267  RLPSWRYKEINTNLDLDHDLNCGTSQANEDPECCICLANYKDKEEVRQLPCSHIFHLKCV  326

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ L R
Sbjct  327  DQWLRIISCCPLCKQALDR  345



>gb|KJB81577.1| hypothetical protein B456_013G150600, partial [Gossypium raimondii]
Length=366

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + DIEQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RF SF RAP
Sbjct  172  QGDRF-GLSDIEQQRTNEESRSSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFRSFHRAP  230

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP+ SS LGYNMNMGS++RGAS++Q+S LP
Sbjct  231  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLTSSLLGYNMNMGSIDRGASDDQISRLP  290

Query  413  TWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W+YK++  N DL+          NE+PECCICLA Y+DKEE+RQLPCSH+FHL CVDQW
Sbjct  291  SWRYKEINTNLDLDHDLNCGTSQANEDPECCICLANYKDKEEVRQLPCSHIFHLKCVDQW  350

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK+ L R
Sbjct  351  LRIISCCPLCKQALDR  366



>ref|XP_006280769.1| hypothetical protein CARUB_v10026740mg [Capsella rubella]
 gb|EOA13667.1| hypothetical protein CARUB_v10026740mg [Capsella rubella]
Length=338

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 153/195 (78%), Gaps = 9/195 (5%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            R R   + + D+EQQ+    E  S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  144  RYRQLDAVLGDVEQQQRGREETRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHH  203

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLC+SLL WNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS ERGAS++Q+SS
Sbjct  204  APKLHVLCVSLLGWNAICYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSERGASDDQISS  263

Query  419  LPTWKYKQVCNNPDLEN-------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            LP WKYK++  N    +       ++PECCICLA+Y+DKEE+R+LPCSH FH  CVDQWL
Sbjct  264  LPCWKYKRIDKNASDSDSDSATVTDDPECCICLAKYKDKEEVRKLPCSHKFHSKCVDQWL  323

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK+DL R
Sbjct  324  RIISCCPLCKQDLPR  338



>emb|CDY36773.1| BnaA03g11130D [Brassica napus]
Length=325

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 155/190 (82%), Gaps = 5/190 (3%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQ ++ +   DIEQQ     E  S  ++ KCRT +ELFFAIWFV+GNVWVFD RFGSF  
Sbjct  135  RQLNQGNWFVDIEQQHRGRDETRSSHLMNKCRTSLELFFAIWFVVGNVWVFDARFGSFNH  194

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLC+SLL+WNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS +RGAS++Q+SS
Sbjct  195  APKLHVLCVSLLSWNALCYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSDRGASDDQISS  254

Query  419  LPTWKYKQVCNNPD---LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            LP+WK+K+  +N      + ++PECCICLA+Y+DKEE+R+LPCSH FHL CVDQWLRIIS
Sbjct  255  LPSWKHKRADDNASDSAPKTDDPECCICLAKYKDKEEVRKLPCSHKFHLKCVDQWLRIIS  314

Query  248  CCPLCKKDLA  219
            CCPLCK+DL+
Sbjct  315  CCPLCKQDLS  324



>ref|XP_006401395.1| hypothetical protein EUTSA_v10014037mg [Eutrema salsugineum]
 gb|ESQ42848.1| hypothetical protein EUTSA_v10014037mg [Eutrema salsugineum]
Length=338

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 155/187 (83%), Gaps = 9/187 (5%)
 Frame = -2

Query  749  VXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
            + DIEQQ+    E  S +++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  APKLH+LC
Sbjct  152  LGDIEQQQRGREENRSSRLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHHAPKLHILC  211

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ  396
            +SLLAWNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS +RGAS++Q+SSLP+WKYK+
Sbjct  212  VSLLAWNALCYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSDRGASDDQISSLPSWKYKR  271

Query  395  VCNNP-DLEN------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
            + +   D E+      ++PECCICL +Y+DKEE+R+LPCSH FHL CVDQWLRIISCCPL
Sbjct  272  INDKASDSESDSAPATDDPECCICLTKYKDKEEVRKLPCSHKFHLKCVDQWLRIISCCPL  331

Query  236  CKKDLAR  216
            CK+DL R
Sbjct  332  CKQDLPR  338



>ref|XP_010450483.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=343

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 153/195 (78%), Gaps = 9/195 (5%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQ-RSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQ D    + D+EQQ R  E + S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  149  RQLDVGFVLGDVEQQQRGREDTRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHH  208

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLC+ LLAWNAV YSFPF+LF+ LCC VP+VSS LGYNMNMGS ERGAS++Q+SS
Sbjct  209  APKLHVLCVCLLAWNAVCYSFPFLLFLFLCCLVPLVSSILGYNMNMGSSERGASDDQISS  268

Query  419  LPTWKYKQVCNNPD-------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL  261
            LP+WKYK++  N            ++PECCICL +Y+DKEE+R+LPCSH FH  CVDQWL
Sbjct  269  LPSWKYKRIDENASDSDSDSATTTDDPECCICLTKYKDKEEVRKLPCSHKFHSKCVDQWL  328

Query  260  RIISCCPLCKKDLAR  216
            RIISCCPLCK+DL R
Sbjct  329  RIISCCPLCKQDLPR  343



>gb|KDP39322.1| hypothetical protein JCGZ_01079 [Jatropha curcas]
Length=346

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 161/199 (81%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + D+EQQR  E SS+     ++ KCRT +EL FAIWFVMGNVWVFD+RFGSF 
Sbjct  149  QGDGF-GLSDLEQQRGSEDSSLYRYPHLINKCRTSLELLFAIWFVMGNVWVFDSRFGSFH  207

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLHVLCISLLAWNA++YSFPF+LF++LCCCVP++S+ LGYNM MGS ERGAS++Q+S
Sbjct  208  RAPKLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISTVLGYNMQMGSAERGASDDQIS  267

Query  422  SLPTWKYKQVCNNPD----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            SLP+WKYK +  N +          L +E+PECCICLA+Y+DKEE+RQLPCSH+FHL CV
Sbjct  268  SLPSWKYKAIETNSERSNSVDCNSTLASEDPECCICLAKYKDKEEVRQLPCSHMFHLKCV  327

Query  272  DQWLRIISCCPLCKKDLAR  216
            D WL+IISCCPLCK++L R
Sbjct  328  DHWLKIISCCPLCKQELER  346



>gb|KCW68372.1| hypothetical protein EUGRSUZ_F02028 [Eucalyptus grandis]
Length=171

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 147/171 (86%), Gaps = 10/171 (6%)
 Frame = -2

Query  698  VEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFV  519
            + KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAPKLH+LCISLLAWNAV+YSFPF+LF+
Sbjct  1    MNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAPKLHMLCISLLAWNAVSYSFPFLLFL  60

Query  518  VLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------N  369
            +LCC VP++S+FLGYNMN+ SVERGAS++Q+S LP+WKYKQV NN  L           N
Sbjct  61   LLCCFVPLMSTFLGYNMNVASVERGASDDQISRLPSWKYKQVDNNLGLSDDSNHNLVPAN  120

Query  368  ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            E+ ECCICL++Y+++EE+RQLPCSH+FH  CVDQWLRI SCCPLCKK+L R
Sbjct  121  EDKECCICLSKYKEREEVRQLPCSHMFHQKCVDQWLRITSCCPLCKKELER  171



>ref|XP_009620909.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Nicotiana tomentosiformis]
Length=341

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 159/194 (82%), Gaps = 13/194 (7%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSS--VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRA  597
            QRD+     D+EQQRS +  S  + ++E  RT VELFFAIWFVMGNVWVF++RF S+ RA
Sbjct  152  QRDD----SDMEQQRSHDEYSRALHVMEILRTGVELFFAIWFVMGNVWVFESRFLSYHRA  207

Query  596  PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL  417
            PKLH+LCISLL WNAV YSFPF+LF++LCCCVP++SSFLGYNMNMGSV+RGAS+EQLSSL
Sbjct  208  PKLHLLCISLLTWNAVAYSFPFLLFLLLCCCVPILSSFLGYNMNMGSVDRGASDEQLSSL  267

Query  416  PTWKYKQVCNNP-------DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            P+WKYK+            + ENEN ECCICLA+Y DKEE+RQLPCSH+FHL CVDQWLR
Sbjct  268  PSWKYKESGKKEQPKYSGVENENENVECCICLAKYGDKEEIRQLPCSHIFHLKCVDQWLR  327

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK++L R
Sbjct  328  IISCCPLCKQELER  341



>ref|XP_010545287.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Tarenaya hassleriana]
 ref|XP_010545288.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Tarenaya hassleriana]
Length=335

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 8/192 (4%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRS--XEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQR  F  V D+EQQR    E     ++ KC+  +ELFFAIWFV GNVWVFD+RFGSF R
Sbjct  141  RQRAGF-GVGDVEQQRRDREETRCSHLMNKCQKSLELFFAIWFVTGNVWVFDSRFGSFHR  199

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            AP+LHVLCISLLAWNA+ YSFPF+LF++LCC VP+VSS LGYNMNMGS ++GAS+EQ+S 
Sbjct  200  APRLHVLCISLLAWNALCYSFPFLLFLLLCCVVPLVSSLLGYNMNMGSADKGASDEQISI  259

Query  419  LPTWKYKQVCN----NPDLE-NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRI  255
            LP+WKYK++ N    +P ++  E+PECCICLA+Y+DKEE+R+LPCSH FHL CVDQWLRI
Sbjct  260  LPSWKYKRMDNGFASDPSVDATEDPECCICLAKYKDKEEVRELPCSHRFHLKCVDQWLRI  319

Query  254  ISCCPLCKKDLA  219
            ISCCPLCK+DL 
Sbjct  320  ISCCPLCKQDLT  331



>gb|KDO59202.1| hypothetical protein CISIN_1g019720mg [Citrus sinensis]
Length=309

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 162/191 (85%), Gaps = 7/191 (4%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + D+EQQRS E S    ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  120  QVDGFS-LPDVEQQRSSEDSRFSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  178

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMG+ ++GAS++Q+S LP
Sbjct  179  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSVLGYNMNMGAADKGASDDQISRLP  238

Query  413  TWKYKQV-----CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            +W+YK+V       N    NE+PECCICLA+Y++KEE+R+LPCSH+FHL CVDQWLRI+S
Sbjct  239  SWRYKRVDSNLEAGNSAPANEDPECCICLAKYKEKEEVRKLPCSHMFHLKCVDQWLRILS  298

Query  248  CCPLCKKDLAR  216
            CCPLCK++L R
Sbjct  299  CCPLCKQELER  309



>ref|XP_008463026.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Cucumis 
melo]
 ref|XP_008463027.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Cucumis 
melo]
Length=315

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 12/186 (6%)
 Frame = -2

Query  737  EQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLA  561
            EQQRS E S    ++ +CRT ++LFFAIWFVMGN+WVFD+R  SF+RAPKLH+LC  LL 
Sbjct  130  EQQRSNESSRYSHLMNRCRTSLDLFFAIWFVMGNLWVFDSRLASFQRAPKLHLLCSFLLV  189

Query  560  WNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNN-  384
            WNA+ YSFPFILF++LCCCVP++SS  GYN+NMGS E+GAS++Q+S LP W+YK V  N 
Sbjct  190  WNAICYSFPFILFLLLCCCVPLISSLTGYNINMGSSEKGASDDQISQLPCWRYKAVEANI  249

Query  383  -----PDLEN-----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                 PD  N     E+PECCICLA+Y DKEE+RQLPCSHVFHL CVD+WL I S CPLC
Sbjct  250  NPRSQPDNSNTGLLKEDPECCICLAKYIDKEEVRQLPCSHVFHLKCVDKWLAITSSCPLC  309

Query  233  KKDLAR  216
            K+ L R
Sbjct  310  KQQLQR  315



>ref|XP_008463025.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Cucumis 
melo]
Length=347

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 144/186 (77%), Gaps = 12/186 (6%)
 Frame = -2

Query  737  EQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLA  561
            EQQRS E S    ++ +CRT ++LFFAIWFVMGN+WVFD+R  SF+RAPKLH+LC  LL 
Sbjct  162  EQQRSNESSRYSHLMNRCRTSLDLFFAIWFVMGNLWVFDSRLASFQRAPKLHLLCSFLLV  221

Query  560  WNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNN-  384
            WNA+ YSFPFILF++LCCCVP++SS  GYN+NMGS E+GAS++Q+S LP W+YK V  N 
Sbjct  222  WNAICYSFPFILFLLLCCCVPLISSLTGYNINMGSSEKGASDDQISQLPCWRYKAVEANI  281

Query  383  -----PDLEN-----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                 PD  N     E+PECCICLA+Y DKEE+RQLPCSHVFHL CVD+WL I S CPLC
Sbjct  282  NPRSQPDNSNTGLLKEDPECCICLAKYIDKEEVRQLPCSHVFHLKCVDKWLAITSSCPLC  341

Query  233  KKDLAR  216
            K+ L R
Sbjct  342  KQQLQR  347



>ref|XP_009620902.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nicotiana tomentosiformis]
Length=402

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 159/194 (82%), Gaps = 13/194 (7%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSS--VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRA  597
            QRD+     D+EQQRS +  S  + ++E  RT VELFFAIWFVMGNVWVF++RF S+ RA
Sbjct  213  QRDD----SDMEQQRSHDEYSRALHVMEILRTGVELFFAIWFVMGNVWVFESRFLSYHRA  268

Query  596  PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL  417
            PKLH+LCISLL WNAV YSFPF+LF++LCCCVP++SSFLGYNMNMGSV+RGAS+EQLSSL
Sbjct  269  PKLHLLCISLLTWNAVAYSFPFLLFLLLCCCVPILSSFLGYNMNMGSVDRGASDEQLSSL  328

Query  416  PTWKYKQVCNNP-------DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            P+WKYK+            + ENEN ECCICLA+Y DKEE+RQLPCSH+FHL CVDQWLR
Sbjct  329  PSWKYKESGKKEQPKYSGVENENENVECCICLAKYGDKEEIRQLPCSHIFHLKCVDQWLR  388

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK++L R
Sbjct  389  IISCCPLCKQELER  402



>ref|XP_010675979.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 152/189 (80%), Gaps = 6/189 (3%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D+      +EQQR+ E S V  +V KCR  ++LFFA+WFVMGNVW+FD+RFGSF RAP
Sbjct  147  QGDDGLNFSYLEQQRNNEESRVLHLVNKCRASLDLFFAMWFVMGNVWIFDSRFGSFNRAP  206

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLH+LCI +L WNA+TYSFPF+LF++LC CVP+VSSF+GYNM++GS E+GAS++Q+S L 
Sbjct  207  KLHILCIIILTWNAITYSFPFLLFLLLCICVPLVSSFIGYNMSLGSAEKGASDDQISQLL  266

Query  413  TWKYKQVCNNPDLE-----NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
             W YK V ++ D E      +NP+CCICLA+Y+DKEE+RQLPCSH+FH  CVDQWLRIIS
Sbjct  267  CWTYKPVDSSVDTEKPSPTKDNPDCCICLAKYKDKEEIRQLPCSHIFHKKCVDQWLRIIS  326

Query  248  CCPLCKKDL  222
            CCPLCK+ L
Sbjct  327  CCPLCKQGL  335



>ref|XP_008463028.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
melo]
 ref|XP_008463029.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
melo]
Length=338

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = -2

Query  761  EFSAVXDIEQQRSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLH  585
            E   + D EQQRS + S  ++++ KCRT +ELFFAIWFVMGNVW+ D+RF SF+RAPKLH
Sbjct  152  ERVGLSDTEQQRSSQASRCLRLMNKCRTSLELFFAIWFVMGNVWIVDSRFSSFQRAPKLH  211

Query  584  VLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWK  405
            +LC+ LL WNA  YSFPFILF++LCCCVP+VS  LGYN++M S ++GA ++Q+S LP W+
Sbjct  212  LLCVFLLVWNATCYSFPFILFLLLCCCVPLVSRLLGYNISMASTDKGALDDQISQLPCWR  271

Query  404  YKQVCNNPD----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
            YK     PD    L  E+PECCICL +YRD+EE+RQLPCSH FHL CVD+WL I S CPL
Sbjct  272  YKVSSMQPDSNKRLPKEDPECCICLVKYRDEEEVRQLPCSHFFHLKCVDKWLSITSSCPL  331

Query  236  CKKDLAR  216
            CK+ L +
Sbjct  332  CKQQLQK  338



>ref|XP_006474826.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Citrus 
sinensis]
Length=336

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 162/191 (85%), Gaps = 7/191 (4%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + D+EQQRS E S    ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  147  QVDGFS-LPDVEQQRSSEDSRFSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  205

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMG+ ++GAS++Q+S LP
Sbjct  206  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSVLGYNMNMGAADKGASDDQISRLP  265

Query  413  TWKYKQV-----CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            +W+YK+V       N    NE+PECCICLA+Y++KEE+R+LPCSH+FHL CVDQWLRI+S
Sbjct  266  SWRYKRVDSNLEAGNSAPANEDPECCICLAKYKEKEEVRKLPCSHMFHLKCVDQWLRILS  325

Query  248  CCPLCKKDLAR  216
            CCPLCK++L R
Sbjct  326  CCPLCKQELER  336



>gb|KDO59201.1| hypothetical protein CISIN_1g019720mg [Citrus sinensis]
Length=336

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 162/191 (85%), Gaps = 7/191 (4%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + D+EQQRS E S    ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  147  QVDGFS-LPDVEQQRSSEDSRFSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  205

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMG+ ++GAS++Q+S LP
Sbjct  206  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSVLGYNMNMGAADKGASDDQISRLP  265

Query  413  TWKYKQV-----CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            +W+YK+V       N    NE+PECCICLA+Y++KEE+R+LPCSH+FHL CVDQWLRI+S
Sbjct  266  SWRYKRVDSNLEAGNSAPANEDPECCICLAKYKEKEEVRKLPCSHMFHLKCVDQWLRILS  325

Query  248  CCPLCKKDLAR  216
            CCPLCK++L R
Sbjct  326  CCPLCKQELER  336



>ref|XP_006452654.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
 gb|ESR65894.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
Length=336

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 162/191 (85%), Gaps = 7/191 (4%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + D+EQQRS E S    ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  147  QVDGFS-LPDVEQQRSSEDSRFSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  205

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMG+ ++GAS++Q+S LP
Sbjct  206  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSVLGYNMNMGAADKGASDDQISRLP  265

Query  413  TWKYKQV-----CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            +W+YK+V       N    NE+PECCICLA+Y++KEE+R+LPCSH+FHL CVDQWLRI+S
Sbjct  266  SWRYKRVDSNLEAGNSAPANEDPECCICLAKYKEKEEVRKLPCSHMFHLKCVDQWLRILS  325

Query  248  CCPLCKKDLAR  216
            CCPLCK++L R
Sbjct  326  CCPLCKQELER  336



>emb|CDY11965.1| BnaC03g13910D [Brassica napus]
Length=325

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 154/190 (81%), Gaps = 5/190 (3%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQ ++ +   DIEQQ     E  S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  135  RQLNQGNWFVDIEQQHRGRDETRSSHLMNKCRTSLELFFAIWFVVGNVWVFDSRFGSFNH  194

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            AP LHVLC+SLL+WNA+ YSFPF+LF+ LCC VP+ SS LGYNMNMGS +RGAS++Q+SS
Sbjct  195  APNLHVLCVSLLSWNALCYSFPFLLFLFLCCLVPLFSSLLGYNMNMGSSDRGASDDQISS  254

Query  419  LPTWKYKQVCNNPD---LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
            LP+WK+K+  +N      + ++PECCICLA+Y+DKEE+R+LPCSH FHL CVDQWLRIIS
Sbjct  255  LPSWKHKRADDNASGSPPKTDDPECCICLAKYKDKEEVRKLPCSHKFHLKCVDQWLRIIS  314

Query  248  CCPLCKKDLA  219
            CCPLCK+DL+
Sbjct  315  CCPLCKQDLS  324



>ref|XP_010483065.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=345

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 155/197 (79%), Gaps = 11/197 (6%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQ-RSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            RQ D    + D+EQQ R  E + S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  149  RQLDVGFVLGDVEQQQRDREDTRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHH  208

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLHVLC+ LLAWNAV YSFPF+LF+ LCC VP+VSS LGYNMNMGS ERGAS++Q+SS
Sbjct  209  APKLHVLCVCLLAWNAVCYSFPFLLFLFLCCLVPLVSSILGYNMNMGSSERGASDDQISS  268

Query  419  LPTWKYKQVCNN---------PDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQ  267
            LP+WKYK++  N              ++PECCICLA+Y+DKEE+R+LPCSH FH  CVDQ
Sbjct  269  LPSWKYKRIDENASDSDSDSDSATTTDDPECCICLAKYKDKEEVRKLPCSHKFHSKCVDQ  328

Query  266  WLRIISCCPLCKKDLAR  216
            WLRIISCCPLCK+DL+R
Sbjct  329  WLRIISCCPLCKQDLSR  345



>ref|XP_004498153.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cicer 
arietinum]
Length=345

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 147/199 (74%), Gaps = 21/199 (11%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D+   + D+EQQ + E +SV     ++ KCR+ +ELFFAIWFVMGNVW FD+RFG+ +
Sbjct  154  QGDDALGISDVEQQTNNEENSVYRSTHLMSKCRSSLELFFAIWFVMGNVWSFDSRFGTLQ  213

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
             APKL VLCI LL WNA+ YS       +LCCCVP++S+ LGYNMNMGS  +GAS++Q+S
Sbjct  214  EAPKLQVLCIILLVWNAICYS-------LLCCCVPLISTLLGYNMNMGSSSKGASDDQIS  266

Query  422  SLPTWKYKQVCNNPD----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             +P+W+YK   N  D          L NE PECCICLA+Y+DKEE+RQLPCSH+FHLNCV
Sbjct  267  QIPSWRYKVAHNKLDRNDDSQCSERLINEEPECCICLAKYKDKEEVRQLPCSHMFHLNCV  326

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ L R
Sbjct  327  DQWLRIISCCPLCKQGLQR  345



>ref|NP_194388.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_001190848.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAE99787.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85222.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE85223.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=335

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 152/179 (85%), Gaps = 5/179 (3%)
 Frame = -2

Query  743  DIEQQ-RSXEGSS--VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            DIEQQ RS E ++    ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCI
Sbjct  155  DIEQQQRSREETTRCSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHVLCI  214

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            SLLAWNA+ YSFPF+LF++LCC VP+VSSFLGYNMN+GS E+GAS++Q+SSLP+WKYK +
Sbjct  215  SLLAWNALCYSFPFLLFLLLCCVVPLVSSFLGYNMNVGSSEKGASDDQISSLPSWKYKLI  274

Query  392  CNNPDLE--NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
                D    N +PECCICLA+Y++KEE+R+LPCSH FHL CVDQWLRIISCCPLCK+DL
Sbjct  275  DETSDSSQANNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISCCPLCKQDL  333



>ref|XP_004149419.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN44387.1| hypothetical protein Csa_7G278220 [Cucumis sativus]
Length=336

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -2

Query  761  EFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLH  585
            E   + D EQ+R+ + S S+ ++ KCRT +ELFFAIWFVMGNVW+ D+RF SF+RAPKLH
Sbjct  152  ERVGLSDTEQRRTSQASRSLHLMNKCRTSLELFFAIWFVMGNVWIVDSRFSSFQRAPKLH  211

Query  584  VLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWK  405
            +LC+ LL WNA+ YSFPFILF++LCCCVP+VSS LGYN++M S ++ A ++Q+S LP W+
Sbjct  212  LLCVFLLVWNAICYSFPFILFLLLCCCVPLVSSLLGYNISMASTDKAALDDQISQLPCWR  271

Query  404  YKQVCNNPD----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
            YK     PD    L  E+PECCICL +YRD+EE+RQLPCSH FHL CVD+WL I S CPL
Sbjct  272  YKVSSMQPDSNEGLPKEDPECCICLVKYRDEEEVRQLPCSHFFHLRCVDKWLSITSSCPL  331

Query  236  CKKDL  222
            CK+ L
Sbjct  332  CKQQL  336



>ref|XP_004160245.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like, partial [Cucumis 
sativus]
Length=299

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIE--QQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            QRD  +++ DIE  QQR+ E S    ++ +CRT ++LFFAIWFVMGN+W FD+R  SF+R
Sbjct  102  QRDG-NSLSDIEHEQQRTNESSRYSHLMNRCRTSLDLFFAIWFVMGNLWAFDSRLASFQR  160

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLH+LC  LL WNA+ YSFPFILF++LCCCVP++SS  GYN+N GS E+GAS++Q+S 
Sbjct  161  APKLHLLCSFLLVWNAICYSFPFILFLLLCCCVPLISSLTGYNINTGSTEKGASDDQISQ  220

Query  419  LPTWKYKQV-----------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            LP W+YK V            +N  L  E+PECCICLA+Y DKEE+RQLPCSHVFHL CV
Sbjct  221  LPCWRYKAVEANINPRSQLDNSNTGLLKEDPECCICLAKYIDKEEVRQLPCSHVFHLRCV  280

Query  272  DQWLRIISCCPLCKKDLAR  216
            D+WL I S CPLCK+ L R
Sbjct  281  DKWLAITSSCPLCKQQLQR  299



>ref|XP_002298883.1| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
 ref|XP_002298884.2| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
 gb|EEE83688.1| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
 gb|EEE83689.2| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
Length=341

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 160/199 (80%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + D+EQQR  E SSV     ++ KCRT +ELFFAIWFVMGNVWVFD+RFGS+ 
Sbjct  144  QADGF-GLPDLEQQRGSEESSVCRCSILMHKCRTSLELFFAIWFVMGNVWVFDSRFGSYH  202

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLHVLCISLLAWNA++YSFPF+LF++LCCCVP++S+ LGYNMNMGS ERGAS++Q+S
Sbjct  203  RAPKLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISTVLGYNMNMGSAERGASDDQIS  262

Query  422  SLPTWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            SLP+W+YK    N +  N          E+ ECCICLA+Y+DKEE+R+LPCSH+FHL CV
Sbjct  263  SLPSWRYKAADTNSEFRNNADCNSTIASEDLECCICLAKYKDKEEVRKLPCSHMFHLKCV  322

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ L R
Sbjct  323  DQWLRIISCCPLCKQGLER  341



>gb|KGN44388.1| hypothetical protein Csa_7G278230 [Cucumis sativus]
Length=347

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIE--QQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            QRD  +++ DIE  QQR+ E S    ++ +CRT ++LFFAIWFVMGN+W FD+R  SF+R
Sbjct  150  QRDG-NSLSDIEHEQQRTNESSRYSHLMNRCRTSLDLFFAIWFVMGNLWAFDSRLASFQR  208

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLH+LC  LL WNA+ YSFPFILF++LCCCVP++SS  GYN+N GS E+GAS++Q+S 
Sbjct  209  APKLHLLCSFLLVWNAICYSFPFILFLLLCCCVPLISSLTGYNINTGSTEKGASDDQISQ  268

Query  419  LPTWKYKQV-----------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            LP W+YK V            +N  L  E+PECCICLA+Y DKEE+RQLPCSHVFHL CV
Sbjct  269  LPCWRYKAVEANINPRSQLDNSNTGLLKEDPECCICLAKYIDKEEVRQLPCSHVFHLRCV  328

Query  272  DQWLRIISCCPLCKKDLAR  216
            D+WL I S CPLCK+ L R
Sbjct  329  DKWLAITSSCPLCKQQLQR  347



>ref|XP_004149408.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Cucumis sativus]
Length=315

 Score =   244 bits (624),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIE--QQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            QRD  +++ DIE  QQR+ E S    ++ +CRT ++LFFAIWFVMGN+W FD+R  SF+R
Sbjct  118  QRDG-NSLSDIEHEQQRTNESSRYSHLMNRCRTSLDLFFAIWFVMGNLWAFDSRLASFQR  176

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKLH+LC  LL WNA+ YSFPFILF++LCCCVP++SS  GYN+N GS E+GAS++Q+S 
Sbjct  177  APKLHLLCSFLLVWNAICYSFPFILFLLLCCCVPLISSLTGYNINTGSTEKGASDDQISQ  236

Query  419  LPTWKYKQV-----------CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            LP W+YK V            +N  L  E+PECCICLA+Y DKEE+RQLPCSHVFHL CV
Sbjct  237  LPCWRYKAVEANINPRSQLDNSNTGLLKEDPECCICLAKYIDKEEVRQLPCSHVFHLRCV  296

Query  272  DQWLRIISCCPLCKKDLAR  216
            D+WL I S CPLCK+ L R
Sbjct  297  DKWLAITSSCPLCKQQLQR  315



>ref|XP_002864420.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40679.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 153/199 (77%), Gaps = 13/199 (7%)
 Frame = -2

Query  773  RQRDEFSA----VXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFG  612
            RQ D +      + D+EQQ+    E  S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFG
Sbjct  145  RQLDVYQGNGFVLGDVEQQQRGREETRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFG  204

Query  611  SFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNE  432
            SF  APKLHVLC+SLL+WNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS +R AS++
Sbjct  205  SFHHAPKLHVLCVSLLSWNAICYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSDRAASDD  264

Query  431  QLSSLPTWKYKQVCNNPD-------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            Q+SSLP+WK+K++  N            ++PECCICLA+Y+DKEE+R+LPC H FH  CV
Sbjct  265  QISSLPSWKFKRIDENASDSDSDSATATDDPECCICLAKYKDKEEVRKLPCQHKFHSKCV  324

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+DL R
Sbjct  325  DQWLRIISCCPLCKQDLPR  343



>emb|CAB43854.1| putative protein [Arabidopsis thaliana]
 emb|CAB79513.1| putative protein [Arabidopsis thaliana]
Length=464

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 152/179 (85%), Gaps = 5/179 (3%)
 Frame = -2

Query  743  DIEQQ-RSXEGSS--VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            DIEQQ RS E ++    ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCI
Sbjct  284  DIEQQQRSREETTRCSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHVLCI  343

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            SLLAWNA+ YSFPF+LF++LCC VP+VSSFLGYNMN+GS E+GAS++Q+SSLP+WKYK +
Sbjct  344  SLLAWNALCYSFPFLLFLLLCCVVPLVSSFLGYNMNVGSSEKGASDDQISSLPSWKYKLI  403

Query  392  CNNPDLE--NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
                D    N +PECCICLA+Y++KEE+R+LPCSH FHL CVDQWLRIISCCPLCK+DL
Sbjct  404  DETSDSSQANNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISCCPLCKQDL  462



>ref|XP_011038869.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Populus 
euphratica]
Length=341

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 159/199 (80%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + D+E QR  E SSV     ++ KC+T +ELFFAIWFVMGNVWVFD+RFGS+ 
Sbjct  144  QGDGF-GLPDLEHQRGSEESSVCRCSILMHKCQTSLELFFAIWFVMGNVWVFDSRFGSYH  202

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLHVLCISLLAWNA++YSFPF+LF++LCCCVP++S+ LGYNMNMGS ERGAS++Q+S
Sbjct  203  RAPKLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISTVLGYNMNMGSAERGASDDQIS  262

Query  422  SLPTWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            SLP+W YK    N +L N          E+ ECCICLA+Y+DKEE+R+LPCSH+FHL CV
Sbjct  263  SLPSWTYKAADTNSELRNNADRNSTIASEDLECCICLAKYKDKEEVRKLPCSHMFHLKCV  322

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ L R
Sbjct  323  DQWLRIISCCPLCKQGLER  341



>ref|XP_006857729.1| hypothetical protein AMTR_s00061p00183390 [Amborella trichopoda]
 gb|ERN19196.1| hypothetical protein AMTR_s00061p00183390 [Amborella trichopoda]
Length=331

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 145/196 (74%), Gaps = 16/196 (8%)
 Frame = -2

Query  755  SAVXDIEQQR-SXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVL  579
            +   D+E QR + E  +  ++ KCR C+ELFFAIWFVMGNVWVFD R GS  RAP L+ L
Sbjct  136  TGSSDLEMQRENGESRASYIMNKCRVCLELFFAIWFVMGNVWVFDNRLGSSSRAPTLYGL  195

Query  578  CISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK  399
            C  LLAWNA++YSFPFILFVVLCCCVP++S+ +GYNMN+GS+ RGAS +Q+S LP+W++K
Sbjct  196  CFGLLAWNALSYSFPFILFVVLCCCVPLISNAIGYNMNLGSLNRGASEDQISKLPSWRFK  255

Query  398  Q---------------VCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
                            V +N  L   + ECCICLA+Y DKEE+R+LPCSH FHL C+DQW
Sbjct  256  AGDEFMKANNSDKLGVVKSNRPLAPVDLECCICLAKYMDKEELRELPCSHFFHLRCIDQW  315

Query  263  LRIISCCPLCKKDLAR  216
            L+IISCCPLCK++L R
Sbjct  316  LKIISCCPLCKQELDR  331



>ref|NP_568834.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_851197.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAM62485.1| unknown [Arabidopsis thaliana]
 gb|AED96704.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED96705.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=343

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 151/187 (81%), Gaps = 9/187 (5%)
 Frame = -2

Query  749  VXDIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
            + D+EQQ+    E  S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  APKLHVLC
Sbjct  157  LGDVEQQQRGREETRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHHAPKLHVLC  216

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ  396
            +SLLAWNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS +R AS++Q+SSLP+WK+K+
Sbjct  217  VSLLAWNAICYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSDRAASDDQISSLPSWKFKR  276

Query  395  VCNNPDLE-------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
            + ++            ++PECCICLA+Y+DKEE+R+LPCSH FH  CVDQWLRIISCCPL
Sbjct  277  IDDSASDSDSDSATVTDDPECCICLAKYKDKEEVRKLPCSHKFHSKCVDQWLRIISCCPL  336

Query  236  CKKDLAR  216
            CK+DL R
Sbjct  337  CKQDLPR  343



>ref|XP_010433472.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=336

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 150/178 (84%), Gaps = 4/178 (2%)
 Frame = -2

Query  743  DIEQQ-RSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ RS E +    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCIS
Sbjct  157  DIEQQQRSREETRCSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHVLCIS  216

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+ S ++GAS++Q+SSLP+WKYK + 
Sbjct  217  LLAWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIASSDKGASDDQISSLPSWKYKLID  276

Query  389  NNPD--LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
               D    N +PECCICLA+Y+D+EE+R+LPCSH FHL CVDQWLRIISCCPLCK+DL
Sbjct  277  ETSDSTQANNDPECCICLAKYKDREEVRKLPCSHRFHLKCVDQWLRIISCCPLCKQDL  334



>ref|XP_011038870.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Populus 
euphratica]
Length=338

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 157/196 (80%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSVQ-MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+E QR  E S    ++ KC+T +ELFFAIWFVMGNVWVFD+RFGS+ RAP
Sbjct  144  QGDGF-GLPDLEHQRGSEESRCSILMHKCQTSLELFFAIWFVMGNVWVFDSRFGSYHRAP  202

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LF++LCCCVP++S+ LGYNMNMGS ERGAS++Q+SSLP
Sbjct  203  KLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISTVLGYNMNMGSAERGASDDQISSLP  262

Query  413  TWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            +W YK    N +L N          E+ ECCICLA+Y+DKEE+R+LPCSH+FHL CVDQW
Sbjct  263  SWTYKAADTNSELRNNADRNSTIASEDLECCICLAKYKDKEEVRKLPCSHMFHLKCVDQW  322

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK+ L R
Sbjct  323  LRIISCCPLCKQGLER  338



>ref|XP_010438729.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=335

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 150/178 (84%), Gaps = 4/178 (2%)
 Frame = -2

Query  743  DIEQQ-RSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ RS E +    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCIS
Sbjct  156  DIEQQHRSREETRCSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHVLCIS  215

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+ S ++GAS++Q+SSLP+WKYK + 
Sbjct  216  LLAWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIASSDKGASDDQISSLPSWKYKLID  275

Query  389  NNPD--LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
               D    N +PECCICLA+Y+D+EE+R+LPC+H FHL CVDQWLRIISCCPLCK+DL
Sbjct  276  ETSDSTQANNDPECCICLAKYKDREEVRKLPCAHRFHLKCVDQWLRIISCCPLCKQDL  333



>ref|XP_009142488.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
 ref|XP_009142496.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
 ref|XP_009142504.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=343

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 151/181 (83%), Gaps = 7/181 (4%)
 Frame = -2

Query  743  DIEQQ--RSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            DIEQQ  RS E +    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCI
Sbjct  161  DIEQQQQRSREETRCSHLMNRCRTLLELFFAIWFVIGNVWVFDSRFGSFHYAPTLHVLCI  220

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            SLLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+GS E+GAS++Q+SSLP+WKYK +
Sbjct  221  SLLAWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIGSSEKGASDDQISSLPSWKYKLI  280

Query  392  CNNPDLENE----NPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                D ++     +PECCICLA+Y+DKEE+R+LPCSH FH+ CVDQWLRIIS CPLCK+D
Sbjct  281  DETSDSDSSHASNDPECCICLAKYKDKEEVRKLPCSHRFHVKCVDQWLRIISSCPLCKQD  340

Query  224  L  222
            L
Sbjct  341  L  341



>emb|CDX94309.1| BnaC01g18750D [Brassica napus]
Length=342

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 151/181 (83%), Gaps = 7/181 (4%)
 Frame = -2

Query  743  DIEQQ--RSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            DIEQQ  RS E +    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCI
Sbjct  160  DIEQQQQRSREETRCSHLMNRCRTLLELFFAIWFVIGNVWVFDSRFGSFHYAPSLHVLCI  219

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            SLLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+GS E+GAS++Q+SSLP+WKYK +
Sbjct  220  SLLAWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIGSSEKGASDDQISSLPSWKYKLI  279

Query  392  CNNPDLENE----NPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                D ++     +PECCICLA+Y+DKEE+R+LPCSH FH+ CVDQWLRIIS CPLCK+D
Sbjct  280  DETSDSDSSHASNDPECCICLAKYKDKEEVRKLPCSHRFHVKCVDQWLRIISSCPLCKQD  339

Query  224  L  222
            L
Sbjct  340  L  340



>emb|CDX89323.1| BnaA01g15700D [Brassica napus]
Length=343

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 149/181 (82%), Gaps = 7/181 (4%)
 Frame = -2

Query  743  DIEQQRSX---EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            DIEQQ+     E     ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCI
Sbjct  161  DIEQQQQRGREETRCSHLMNRCRTLLELFFAIWFVIGNVWVFDSRFGSFHYAPTLHVLCI  220

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            SLLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+GS E+GAS++Q+SSLP+WKYK +
Sbjct  221  SLLAWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIGSSEKGASDDQISSLPSWKYKLI  280

Query  392  CNNPDLENE----NPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                D ++     +PECCICLA+Y+DKEE+R+LPCSH FH+ CVDQWLRIIS CPLCK+D
Sbjct  281  DETSDSDSSHASNDPECCICLAKYKDKEEVRKLPCSHRFHVKCVDQWLRIISSCPLCKQD  340

Query  224  L  222
            L
Sbjct  341  L  341



>ref|XP_006413164.1| hypothetical protein EUTSA_v10025652mg [Eutrema salsugineum]
 gb|ESQ54617.1| hypothetical protein EUTSA_v10025652mg [Eutrema salsugineum]
Length=338

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
             R+ FS     +QQRS E +    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP
Sbjct  149  HRNGFSFGDIEQQQRSREETRCSHLMNRCRTSLELFFAIWFVVGNVWVFDSRFGSFHYAP  208

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+GS E+GAS++Q+SSLP
Sbjct  209  NLHVLCISLLAWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIGSSEKGASDDQISSLP  268

Query  413  TWKYKQV----CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
            +WKYK +     ++    + +PECCICLA+Y++KEE+R+LPCSH FHL CVDQWLRIIS 
Sbjct  269  SWKYKLIDETSGSDSAQASNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISS  328

Query  245  CPLCKKDL  222
            CPLCK+DL
Sbjct  329  CPLCKQDL  336



>ref|XP_004491529.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase At1g63170-like 
[Cicer arietinum]
Length=333

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 159/199 (80%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            QRD  S + D+EQQR+ + + +  ++ KC+T +E FFAIWFVMGNVW+FD+RFGSF+++P
Sbjct  136  QRDSLS-LSDLEQQRNNQETRMSHLMNKCKTSLEFFFAIWFVMGNVWIFDSRFGSFQQSP  194

Query  593  KLHVLCISLLAWNAVTYSF---PFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            KLHVLCI+LLAWNA+ YSF   PF+LF++LCCCVP++S+ LGYNMNM S  +GAS+EQ+S
Sbjct  195  KLHVLCITLLAWNAICYSFXXXPFLLFLLLCCCVPLISNLLGYNMNMASSNKGASDEQIS  254

Query  422  SLPTWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             L  W++K+V +  +L N          E+PECCICLA+Y+DKEE+RQLPCSHVFHL CV
Sbjct  255  QLLCWRHKEVHSKLELGNDSESSENLIHEDPECCICLAKYKDKEEVRQLPCSHVFHLKCV  314

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWL+IISCCPLCK+ L R
Sbjct  315  DQWLKIISCCPLCKQGLER  333



>ref|XP_006284075.1| hypothetical protein CARUB_v10005205mg [Capsella rubella]
 gb|EOA16973.1| hypothetical protein CARUB_v10005205mg [Capsella rubella]
Length=334

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 149/178 (84%), Gaps = 4/178 (2%)
 Frame = -2

Query  743  DIEQQ-RSXEGSS-VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            DIEQQ RS E +    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  AP LHVLCIS
Sbjct  155  DIEQQERSREETRCSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHVLCIS  214

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LL WNA+ YSFPF+LF++LCC VP++SSFLGYNMN+ S ++GAS++Q+SSLP+WKYK + 
Sbjct  215  LLTWNALCYSFPFLLFLLLCCVVPLISSFLGYNMNIASSDKGASDDQISSLPSWKYKLID  274

Query  389  NNPD--LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
               D    N +PECCICLA+Y+++EE+R+LPCSH FHL CVDQWLRIISCCPLCK+DL
Sbjct  275  ETSDSAQANNDPECCICLAKYKEREEVRKLPCSHRFHLKCVDQWLRIISCCPLCKQDL  332



>ref|XP_006602119.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Glycine 
max]
Length=328

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 157/199 (79%), Gaps = 14/199 (7%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q +    + ++EQQR+ E SSV     +++KCR+ +ELFFAIWFVMGNVW FD+RFGSF 
Sbjct  130  QGNNALTLSELEQQRNNEESSVYRSSHLIDKCRSSLELFFAIWFVMGNVWAFDSRFGSFP  189

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            +APKL VLCI LL+WNA+ YSFPF+LF++LCCCVP++S+ LGYNM+MGS  RGAS +Q+S
Sbjct  190  QAPKLQVLCIILLSWNAICYSFPFLLFLLLCCCVPLMSTLLGYNMSMGSSARGASEDQIS  249

Query  422  SLPTWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             LP+W+YK V  N DL           NE+PECCICLA+Y+DKEE+RQLPCSH+FHL CV
Sbjct  250  QLPSWRYKGVHTNLDLGNDSQSSERLINEDPECCICLAKYKDKEEVRQLPCSHLFHLKCV  309

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ L R
Sbjct  310  DQWLRIISCCPLCKQGLQR  328



>ref|XP_002867557.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43816.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = -2

Query  770  QRDEFSAVXDIE-QQRSXEGSS--VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            Q + FS   DIE QQRS E ++    ++ +CRT +ELFFAIWFV+GNVWVFD+RFGSF  
Sbjct  147  QGNAFS-FGDIELQQRSREETTRCSHLMNRCRTSLELFFAIWFVIGNVWVFDSRFGSFHY  205

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            AP LHVLCISLLAWNA+ YSFPF+LF++LCC VP++SSFLGYNMN+GS E+GAS++Q+SS
Sbjct  206  APILHVLCISLLAWNALCYSFPFLLFLLLCCVVPLLSSFLGYNMNVGSSEKGASDDQISS  265

Query  419  LPTWKYKQVCNNPD--LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
            LP+WKYK +    D    + +PECCICLA+Y++KEE+R+LPCSH FHL CVDQWLRIISC
Sbjct  266  LPSWKYKLIDEASDSAQASNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISC  325

Query  245  CPLCKKDL  222
            CPLCK++L
Sbjct  326  CPLCKQNL  333



>ref|XP_006586152.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Glycine 
max]
 gb|KHN11170.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=329

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 14/199 (7%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q +   ++ ++EQQR+ E SSV     +++KCR+ +ELFFAIWFVMGNVW FD+RFGSF 
Sbjct  131  QGNNALSLSELEQQRNNEESSVYRTSHLIDKCRSSLELFFAIWFVMGNVWAFDSRFGSFP  190

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            +APKL VLCI LL+WNA+ YSFPF+LF++LCCCVP++S+ LGYNM+MGS  RGAS++Q+S
Sbjct  191  QAPKLQVLCIILLSWNAICYSFPFLLFLLLCCCVPLMSTLLGYNMSMGSSARGASDDQIS  250

Query  422  SLPTWKYKQVCNNPDLE----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             LP+W+YK + +N D+           N++PECCICLA+Y+DKEE+RQLPCSH+FHL CV
Sbjct  251  QLPSWRYKGLHSNLDIANDSQSSERLINQDPECCICLAKYKDKEEVRQLPCSHLFHLKCV  310

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ L R
Sbjct  311  DQWLRIISCCPLCKQGLQR  329



>ref|XP_007140118.1| hypothetical protein PHAVU_008G085400g [Phaseolus vulgaris]
 gb|ESW12112.1| hypothetical protein PHAVU_008G085400g [Phaseolus vulgaris]
Length=327

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 154/192 (80%), Gaps = 14/192 (7%)
 Frame = -2

Query  749  VXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHV  582
            + D+EQQR+ E SSV     +++KCR+ +ELFFAIWFVMGNVW FD+R GSF++APKL V
Sbjct  136  LSDLEQQRNNEESSVLRSSHLMDKCRSSLELFFAIWFVMGNVWAFDSRLGSFQQAPKLQV  195

Query  581  LCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKY  402
            LC+ LL WNA+ YSFPF+LF++LCCCVP++S+ LGYNM+MGS  RGAS++Q+S +P+W+Y
Sbjct  196  LCMILLGWNAICYSFPFLLFLLLCCCVPLMSTLLGYNMSMGSSARGASDDQISEIPSWRY  255

Query  401  KQVCNNPD----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRII  252
            K    N D          L N++PECCICLA+Y+DKEE+RQLPCSH+FHL CVDQWLRII
Sbjct  256  KGAHTNLDFANDSQTTQRLINDDPECCICLAKYKDKEEVRQLPCSHLFHLKCVDQWLRII  315

Query  251  SCCPLCKKDLAR  216
            SCCPLCK+ L R
Sbjct  316  SCCPLCKQGLQR  327



>ref|XP_003617871.1| RING finger protein [Medicago truncatula]
 gb|AET00830.1| E3 ubiquitin protein ligase RIE1-like protein, putative [Medicago 
truncatula]
Length=340

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 157/194 (81%), Gaps = 15/194 (8%)
 Frame = -2

Query  752  AVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLH  585
            ++ DIEQQR+   +SV     ++ KCRT +E FFAIWFVMGNVWVFD+RFGSF++APKLH
Sbjct  147  SLSDIEQQRNSGETSVYRMSHLMNKCRTSLEFFFAIWFVMGNVWVFDSRFGSFQQAPKLH  206

Query  584  VLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWK  405
            VLCI+LL WNA+ YSFPF+LF++LCCCVP++S+ LGYNMN+ S  +GAS+EQ+S LP+W+
Sbjct  207  VLCITLLTWNAICYSFPFLLFLLLCCCVPLISTLLGYNMNIASSNKGASDEQISQLPSWR  266

Query  404  YK-------QVCNNPD----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR  258
            +K       ++ N+ +      NE+PECCICLA+Y+DKEE+RQLPCSHVFHL CVDQWL+
Sbjct  267  HKEPHATKLELGNDSESIEKFINEDPECCICLAKYKDKEEVRQLPCSHVFHLECVDQWLK  326

Query  257  IISCCPLCKKDLAR  216
            IISCCPLCK+ L R
Sbjct  327  IISCCPLCKQGLER  340



>ref|XP_003617870.1| RING finger protein [Medicago truncatula]
 gb|AET00829.1| E3 ubiquitin protein ligase RIE1-like protein, putative [Medicago 
truncatula]
Length=337

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 155/191 (81%), Gaps = 12/191 (6%)
 Frame = -2

Query  752  AVXDIEQQR-SXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
            ++ DIEQQR S E     ++ KCRT +E FFAIWFVMGNVWVFD+RFGSF++APKLHVLC
Sbjct  147  SLSDIEQQRNSGETRMSHLMNKCRTSLEFFFAIWFVMGNVWVFDSRFGSFQQAPKLHVLC  206

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-  399
            I+LL WNA+ YSFPF+LF++LCCCVP++S+ LGYNMN+ S  +GAS+EQ+S LP+W++K 
Sbjct  207  ITLLTWNAICYSFPFLLFLLLCCCVPLISTLLGYNMNIASSNKGASDEQISQLPSWRHKE  266

Query  398  ------QVCNNPD----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
                  ++ N+ +      NE+PECCICLA+Y+DKEE+RQLPCSHVFHL CVDQWL+IIS
Sbjct  267  PHATKLELGNDSESIEKFINEDPECCICLAKYKDKEEVRQLPCSHVFHLECVDQWLKIIS  326

Query  248  CCPLCKKDLAR  216
            CCPLCK+ L R
Sbjct  327  CCPLCKQGLER  337



>ref|XP_009418470.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=313

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = -2

Query  743  DIEQQRSXE-GSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISL  567
            D+EQQRS +  SS  ++ K RT +ELFFA+WFVMGNVW+FD+R GSF RAPKLHVLC+S+
Sbjct  136  DVEQQRSNDDSSSSHLMNKSRTFLELFFAMWFVMGNVWIFDSRHGSFDRAPKLHVLCVSI  195

Query  566  LAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN  387
            LAWNA+ YSFPF+LF++LCCCVP +S+ +GYN+++ S ERGAS +Q++ LP W++K V  
Sbjct  196  LAWNAILYSFPFLLFLLLCCCVPFISNLIGYNISLASTERGASEDQIARLPRWRFKDVKP  255

Query  386  NPD-LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
              D +  EN ECCICLA+Y DKEE+RQLPC HVFHLNCVDQWLRI+S CPLCK+ L
Sbjct  256  TADGVATENQECCICLAKYSDKEEVRQLPCLHVFHLNCVDQWLRIMSACPLCKQGL  311



>ref|XP_002316784.2| hypothetical protein POPTR_0011s09710g [Populus trichocarpa]
 gb|EEE97396.2| hypothetical protein POPTR_0011s09710g [Populus trichocarpa]
Length=346

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + D+EQQ   E SSV     ++ KCRT +ELFFAIWFVMGNVWVFD+RFGS+ 
Sbjct  149  QGDGF-GLPDLEQQGGSEESSVCRYSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSYF  207

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLHVLCI LLAWNA++YSFPF+LF++LCCCVP++S+ +GYNM+MGS ERGAS++Q+S
Sbjct  208  RAPKLHVLCIFLLAWNALSYSFPFLLFLLLCCCVPLISTVIGYNMSMGSAERGASDDQIS  267

Query  422  SLPTWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             LP+ +YK V  + +  N          E+ ECCICLA+Y+D EE+RQLPCSH+FHL CV
Sbjct  268  RLPSRRYKAVDTDSEFRNSVDCDSTVASEDLECCICLAKYKDIEEVRQLPCSHMFHLKCV  327

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK++L +
Sbjct  328  DQWLRIISCCPLCKQELEK  346



>gb|KEH28464.1| E3 ubiquitin protein ligase RIE1-like protein, putative [Medicago 
truncatula]
Length=328

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 19/190 (10%)
 Frame = -2

Query  752  AVXDIEQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            ++ DIEQQR+          + RT +E FFAIWFVMGNVWVFD+RFGSF++APKLHVLCI
Sbjct  147  SLSDIEQQRNSG--------ETRTSLEFFFAIWFVMGNVWVFDSRFGSFQQAPKLHVLCI  198

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--  399
            +LL WNA+ YSFPF+LF++LCCCVP++S+ LGYNMN+ S  +GAS+EQ+S LP+W++K  
Sbjct  199  TLLTWNAICYSFPFLLFLLLCCCVPLISTLLGYNMNIASSNKGASDEQISQLPSWRHKEP  258

Query  398  -----QVCNNPD----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
                 ++ N+ +      NE+PECCICLA+Y+DKEE+RQLPCSHVFHL CVDQWL+IISC
Sbjct  259  HATKLELGNDSESIEKFINEDPECCICLAKYKDKEEVRQLPCSHVFHLECVDQWLKIISC  318

Query  245  CPLCKKDLAR  216
            CPLCK+ L R
Sbjct  319  CPLCKQGLER  328



>ref|XP_009418469.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=314

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 145/177 (82%), Gaps = 3/177 (2%)
 Frame = -2

Query  743  DIEQQRSXEGSSV--QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            D+EQQRS + SS    ++ K RT +ELFFA+WFVMGNVW+FD+R GSF RAPKLHVLC+S
Sbjct  136  DVEQQRSNDDSSSSSHLMNKSRTFLELFFAMWFVMGNVWIFDSRHGSFDRAPKLHVLCVS  195

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            +LAWNA+ YSFPF+LF++LCCCVP +S+ +GYN+++ S ERGAS +Q++ LP W++K V 
Sbjct  196  ILAWNAILYSFPFLLFLLLCCCVPFISNLIGYNISLASTERGASEDQIARLPRWRFKDVK  255

Query  389  NNPD-LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
               D +  EN ECCICLA+Y DKEE+RQLPC HVFHLNCVDQWLRI+S CPLCK+ L
Sbjct  256  PTADGVATENQECCICLAKYSDKEEVRQLPCLHVFHLNCVDQWLRIMSACPLCKQGL  312



>ref|XP_011044922.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Populus euphratica]
Length=346

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 153/199 (77%), Gaps = 15/199 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV----QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            Q D F  + D+EQQ   E SSV     ++ KCR  +ELFFAIWFVMGNVWVFD+RFG+  
Sbjct  149  QGDGF-GLPDLEQQGGSEESSVCRYSHLMNKCRASLELFFAIWFVMGNVWVFDSRFGTSF  207

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLHVLCI LLAWNA++YSFPF+LF++LCCCVP++S+ +GYNM+MGS ERGAS++Q+S
Sbjct  208  RAPKLHVLCIFLLAWNALSYSFPFLLFLLLCCCVPLISTVIGYNMSMGSAERGASDDQIS  267

Query  422  SLPTWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
             LP+ +YK V  + +  N          E+ ECCICL  Y+D EE+RQLPCSH+FHL CV
Sbjct  268  RLPSRRYKAVVTDSEFRNSVDCDSTVASEDLECCICLDNYKDIEEVRQLPCSHMFHLKCV  327

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK++L +
Sbjct  328  DQWLRIISCCPLCKQELEK  346



>ref|XP_009418468.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 145/178 (81%), Gaps = 4/178 (2%)
 Frame = -2

Query  743  DIEQQRSXEGSSV---QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            D+EQQRS + SS     ++ K RT +ELFFA+WFVMGNVW+FD+R GSF RAPKLHVLC+
Sbjct  136  DVEQQRSNDDSSSSSSHLMNKSRTFLELFFAMWFVMGNVWIFDSRHGSFDRAPKLHVLCV  195

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            S+LAWNA+ YSFPF+LF++LCCCVP +S+ +GYN+++ S ERGAS +Q++ LP W++K V
Sbjct  196  SILAWNAILYSFPFLLFLLLCCCVPFISNLIGYNISLASTERGASEDQIARLPRWRFKDV  255

Query  392  CNNPD-LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
                D +  EN ECCICLA+Y DKEE+RQLPC HVFHLNCVDQWLRI+S CPLCK+ L
Sbjct  256  KPTADGVATENQECCICLAKYSDKEEVRQLPCLHVFHLNCVDQWLRIMSACPLCKQGL  313



>ref|XP_011044923.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Populus euphratica]
Length=343

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 151/196 (77%), Gaps = 12/196 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQ   E S    ++ KCR  +ELFFAIWFVMGNVWVFD+RFG+  RAP
Sbjct  149  QGDGF-GLPDLEQQGGSEESRYSHLMNKCRASLELFFAIWFVMGNVWVFDSRFGTSFRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI LLAWNA++YSFPF+LF++LCCCVP++S+ +GYNM+MGS ERGAS++Q+S LP
Sbjct  208  KLHVLCIFLLAWNALSYSFPFLLFLLLCCCVPLISTVIGYNMSMGSAERGASDDQISRLP  267

Query  413  TWKYKQVCNNPDLEN----------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW  264
            + +YK V  + +  N          E+ ECCICL  Y+D EE+RQLPCSH+FHL CVDQW
Sbjct  268  SRRYKAVVTDSEFRNSVDCDSTVASEDLECCICLDNYKDIEEVRQLPCSHMFHLKCVDQW  327

Query  263  LRIISCCPLCKKDLAR  216
            LRIISCCPLCK++L +
Sbjct  328  LRIISCCPLCKQELEK  343



>ref|XP_010232201.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brachypodium 
distachyon]
Length=305

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -2

Query  713  SSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFP  534
            +S  ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LL+WNA+ YS P
Sbjct  141  NSSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLSWNAIVYSLP  200

Query  533  FILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPEC  354
            F+LF++LCC VP+V   LGYNMN  S+ RGAS+EQL++LP W++K+     D E+++ EC
Sbjct  201  FLLFLLLCCFVPVVGYALGYNMNSASIGRGASDEQLAALPRWRFKEPDVPRDREHDDQEC  260

Query  353  CICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            CICLAQYR+KEEMRQLPC+H+FHL CVD+WLRIIS CPLCK++L 
Sbjct  261  CICLAQYREKEEMRQLPCTHMFHLKCVDRWLRIISSCPLCKQELG  305



>gb|EAY75518.1| hypothetical protein OsI_03422 [Oryza sativa Indica Group]
Length=304

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLAWNAV YS PF+LF
Sbjct  143  LMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLAWNAVVYSLPFLLF  202

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP-DLENENPECCIC  345
            ++LCC VP V   LGYNMN  SV RGAS+EQL++LP W++K+  + P D ++++ ECCIC
Sbjct  203  LLLCCFVPAVGYALGYNMNSASVGRGASDEQLAALPQWRFKEPADAPRDRDHDDQECCIC  262

Query  344  LAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            LAQY++KEE+RQLPC+H+FHL CVD+WLRIIS CPLCK++L+
Sbjct  263  LAQYKEKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCKQELS  304



>dbj|BAB92290.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 gb|EAZ13242.1| hypothetical protein OsJ_03165 [Oryza sativa Japonica Group]
 dbj|BAG94351.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLAWNAV YS PF+LF
Sbjct  143  LMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLAWNAVVYSLPFLLF  202

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP-DLENENPECCIC  345
            ++LCC VP V   LGYNMN  SV RGAS+EQL++LP W++K+  + P D ++++ ECCIC
Sbjct  203  LLLCCFVPAVGYALGYNMNSASVGRGASDEQLAALPQWRFKEPADAPRDRDHDDQECCIC  262

Query  344  LAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            LAQY++KEE+RQLPC+H+FHL CVD+WLRIIS CPLCK++L+
Sbjct  263  LAQYKEKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCKQELS  304



>dbj|BAK02980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  710  SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPF  531
            S  ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLAWNAV YS PF
Sbjct  142  SSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLAWNAVVYSLPF  201

Query  530  ILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECC  351
            +LF++LCC VP+V   LGYNMN  SV RGAS+EQL +LP W++K+     D E ++ ECC
Sbjct  202  LLFLLLCCFVPVVGYALGYNMNSASVGRGASDEQLDALPRWRFKEPDVPRDREKDDQECC  261

Query  350  ICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            ICLAQYR+KEE+RQLPC+H+FHL CVD+WLRIIS CPLCK++L+
Sbjct  262  ICLAQYREKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCKQELS  305



>gb|EMT31277.1| E3 ubiquitin-protein ligase [Aegilops tauschii]
Length=274

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 141/189 (75%), Gaps = 4/189 (2%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGSSVQ----MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSF  606
            R R   +A    + +    G +++    ++ K R  +ELFFA+WFVMGNVWVFD R GSF
Sbjct  86   RHRHSSAAGRGDDPEMHGAGDALRNSSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSF  145

Query  605  RRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQL  426
             RAP+L+ LCI LLAWNAV YS PF+LF++LCC VP+V   LGYNMN  SV RGAS+EQL
Sbjct  146  HRAPRLYALCIGLLAWNAVVYSLPFLLFLLLCCFVPVVGYALGYNMNSASVGRGASDEQL  205

Query  425  SSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
             +LP W++K+     D E ++ ECCICLAQYR+KEE+RQLPC+H+FHL CVD+WLRIIS 
Sbjct  206  DALPRWRFKEPDVPRDREKDDEECCICLAQYREKEEVRQLPCTHMFHLKCVDRWLRIISS  265

Query  245  CPLCKKDLA  219
            CPLCK++L+
Sbjct  266  CPLCKQELS  274



>emb|CDM83669.1| unnamed protein product [Triticum aestivum]
Length=305

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 142/189 (75%), Gaps = 4/189 (2%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGSSVQ----MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSF  606
            R R   +A    + +    G +++    ++ K R  +ELFFA+WFVMGNVWVFD+R GSF
Sbjct  117  RHRHSSAAGRGDDPEMHGAGDALRNSSYLMNKARAFLELFFAMWFVMGNVWVFDSRLGSF  176

Query  605  RRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQL  426
             RAP+L+ LCI LLAWNAV YS PF+LF++LCC VP+V   LGYNMN  SV RGAS+EQL
Sbjct  177  HRAPRLYALCIGLLAWNAVVYSLPFLLFLLLCCFVPVVGYALGYNMNSASVGRGASDEQL  236

Query  425  SSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
             +LP W++K+     D E ++ ECCICLAQYR+KEE+RQLPC+H+FHL CVD+WLRIIS 
Sbjct  237  DALPRWRFKEPDVPRDREKDDQECCICLAQYREKEEVRQLPCTHMFHLKCVDRWLRIISS  296

Query  245  CPLCKKDLA  219
            CPLCK++L+
Sbjct  297  CPLCKQELS  305



>ref|XP_006644577.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Oryza 
brachyantha]
Length=308

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -2

Query  713  SSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFP  534
            +S  ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLAWNAV YS P
Sbjct  144  NSSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLAWNAVVYSLP  203

Query  533  FILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPEC  354
            F+LF++LCC VP V   LGYNMN  SV RGAS+EQL++LP W++K+     D ++++ EC
Sbjct  204  FLLFLLLCCFVPAVGYALGYNMNSASVGRGASDEQLAALPQWRFKEPDLPRDRDHDDQEC  263

Query  353  CICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            CICLAQY++KEE+RQLPC+H+FHL CVD+WLRIIS CPLCK++L+
Sbjct  264  CICLAQYKEKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCKQELS  308



>ref|XP_008675134.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Zea mays]
 tpg|DAA57963.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=429

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  743  DIEQQRSXE--GSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            D+E   + +  G+   ++ K R  +ELFFA+WFVMGNVWVFD R GSF+RAP+L+ LC+S
Sbjct  253  DLEMHGANDAPGNRSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFQRAPRLYALCVS  312

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
            LLAWNAV YS PF+LF++LCC VP V   LGYNMN  SV RGAS+EQL++LP W++K+  
Sbjct  313  LLAWNAVVYSLPFLLFLLLCCFVPAVGYALGYNMNSASVGRGASDEQLAALPRWRFKEPD  372

Query  389  NNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
               D E ++ ECCICLAQY +KEE+RQLPC+HVFHL CVD+WLRIIS CPLCK++L
Sbjct  373  VARDRERDDQECCICLAQYGEKEEVRQLPCTHVFHLKCVDRWLRIISSCPLCKQEL  428



>gb|ACU18237.1| unknown [Glycine max]
Length=365

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 127/164 (77%), Gaps = 12/164 (7%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D  S + DIEQQR+ E + +  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF  AP
Sbjct  145  QGDSLS-LSDIEQQRNNEETRMSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHHAP  203

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI LLAWNA+ YSFPF+LFV+LCCCVP++S+ LGYNMNM S  +GASN+Q+S LP
Sbjct  204  KLHVLCIILLAWNAMCYSFPFLLFVLLCCCVPLISTLLGYNMNMASSNKGASNDQISQLP  263

Query  413  TWKYKQVC----------NNPDLENENPECCICLAQYRDKEEMR  312
            +W++K+             +  L NE+PECCICLA+Y+D+EE+R
Sbjct  264  SWRHKEAGAKLELGNASEGSEKLINEDPECCICLAKYKDEEEVR  307



>dbj|BAJ91193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=720

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  710  SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPF  531
            S  ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLAWNAV YS PF
Sbjct  557  SSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLAWNAVVYSLPF  616

Query  530  ILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECC  351
            +LF++LCC VP+V   LGYNMN  SV RGAS+EQL +LP W++K+     D E ++ ECC
Sbjct  617  LLFLLLCCFVPVVGYALGYNMNSASVGRGASDEQLDALPRWRFKEPDVPRDREKDDQECC  676

Query  350  ICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            ICLAQYR+KEE+RQLPC+H+FHL CVD+WLRIIS CPLCK++L+
Sbjct  677  ICLAQYREKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCKQELS  720



>gb|EPS57981.1| hypothetical protein M569_16836, partial [Genlisea aurea]
Length=302

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 150/199 (75%), Gaps = 14/199 (7%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGSSVQ---MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFR  603
            R  +  S   DIEQQ + +    +   +V + +T +EL FA+WFV GNVW+FD+RFGS+ 
Sbjct  105  RTPENDSTDSDIEQQTNGDEQQSRNQPLVNRFKTWLELLFAVWFVTGNVWMFDSRFGSYH  164

Query  602  RAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLS  423
            RAPKLH+LCIS+LAWNAV+YSFPF+LF++LCCCVP++S+ +GYN+N GS  RGAS+E L+
Sbjct  165  RAPKLHLLCISILAWNAVSYSFPFLLFLLLCCCVPLLSTLVGYNINTGSPARGASDEVLA  224

Query  422  SLPTWKYKQVCN----------NPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            +LP+WK   V            NP+L N+  ECCICLA+YR KEE+RQLPC HVFHLNCV
Sbjct  225  ALPSWKLNGVVGGASKNQVSHRNPNL-NDWGECCICLAKYRVKEEIRQLPCLHVFHLNCV  283

Query  272  DQWLRIISCCPLCKKDLAR  216
            DQWLRIISCCPLCK+ + +
Sbjct  284  DQWLRIISCCPLCKQGIQK  302



>ref|XP_010443238.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Camelina sativa]
Length=312

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 126/160 (79%), Gaps = 12/160 (8%)
 Frame = -2

Query  659  IWFVMGNV-----WVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPM  495
            + FV+G+V        DTRFGSF  APKLHVLC+ LLAWNAV YSFPF+LF+ LCC VP+
Sbjct  153  VGFVLGDVEQQQRGREDTRFGSFHHAPKLHVLCVCLLAWNAVCYSFPFLLFLFLCCLVPL  212

Query  494  VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD-------LENENPECCICLAQ  336
            VSS LGYNMNMGS ERGAS++Q+SSLP+WKYK++  N            ++PECCICLA+
Sbjct  213  VSSILGYNMNMGSSERGASDDQISSLPSWKYKRIGENASDSDSDSATTTDDPECCICLAK  272

Query  335  YRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR  216
            Y+DKEE+R+LPCSH FH  CVDQWLRIISCCPLCK+DL+R
Sbjct  273  YKDKEEVRKLPCSHKFHSKCVDQWLRIISCCPLCKQDLSR  312



>gb|KHN24407.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=263

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 140/177 (79%), Gaps = 13/177 (7%)
 Frame = -2

Query  749  VXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            + D+EQQR+ E + +  ++ K R  +ELFFAIWFV+G VWVF++RF SF  APKLHV+CI
Sbjct  98   LSDMEQQRNNEETRMSHLMNKWR--LELFFAIWFVLGIVWVFESRFRSFHEAPKLHVVCI  155

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
             LLAWNA+ YSF  +LFV+LCC VP++S+ LGYNMNM S     S++Q+S LP+W++K+V
Sbjct  156  ILLAWNAMCYSFHLLLFVLLCCFVPLISTLLGYNMNMAS-----SDDQISQLPSWRHKEV  210

Query  392  CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
             +     +E+PECCICLA+Y+DKE++RQLPCSH+FHL CVDQWL+I S CPLCK+ L
Sbjct  211  KS-----SEDPECCICLAKYKDKEQVRQLPCSHMFHLKCVDQWLKITSGCPLCKQGL  262



>ref|XP_007205483.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
 gb|EMJ06682.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
Length=330

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + D+EQQRS E S +  ++ +CRT +ELFFAIWFVMGNVWVFD+RF SF  AP
Sbjct  150  QGDGFN-LSDMEQQRSTEESRTTHLMNRCRTSLELFFAIWFVMGNVWVFDSRFSSFPGAP  208

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCISLLAWNA++YSFPF+LFV+LCCCVP++SS LGYNMNMGS+++ AS++Q+S LP
Sbjct  209  KLHVLCISLLAWNAISYSFPFLLFVLLCCCVPLMSSLLGYNMNMGSIDKAASDDQISQLP  268

Query  413  TWKYKQVCNNPDLENENPECCIC  345
            +W+YK+V    +L N+    C+ 
Sbjct  269  SWRYKEVNTKVELGNDCDSGCLA  291



>ref|XP_006575716.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=303

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 12/152 (8%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D  S + DIEQQR+ E + +  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF  AP
Sbjct  145  QGDSLS-LSDIEQQRNNEETRMSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHHAP  203

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
            KLHVLCI LLAWNA+ YSFPF+LFV+LCCCVP++S+ LGYNMNM S  +GASN+Q+S LP
Sbjct  204  KLHVLCIILLAWNAMCYSFPFLLFVLLCCCVPLISTLLGYNMNMASSNKGASNDQISQLP  263

Query  413  TWKYKQVC----------NNPDLENENPECCI  348
            +W++K+             +  L NE+P CC+
Sbjct  264  SWRHKEAGAKLELGNASEGSEKLINEDPVCCL  295



>gb|AGE09582.1| C3HC4Z1-like protein, partial [Eucalyptus cladocalyx]
Length=137

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 115/137 (84%), Gaps = 10/137 (7%)
 Frame = -2

Query  596  PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL  417
            PKLH+LCISLLAWNAV+YSFPF+LF++LCC VP++S+FLGYNMN+ SVERGAS++Q+S L
Sbjct  1    PKLHMLCISLLAWNAVSYSFPFLLFLLLCCFVPLMSTFLGYNMNVASVERGASDDQISRL  60

Query  416  PTWKYKQVCNNPD----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQ  267
            P+WKYKQV NN            L NE+ ECCICL++Y+++EE+RQLPCSH+FH  CVDQ
Sbjct  61   PSWKYKQVDNNLGLGDDSNHNLVLANEDKECCICLSKYKEREEVRQLPCSHMFHQKCVDQ  120

Query  266  WLRIISCCPLCKKDLAR  216
            WLRI SCCPLCKK+L R
Sbjct  121  WLRITSCCPLCKKELER  137



>ref|XP_010103951.1| hypothetical protein L484_020203 [Morus notabilis]
 gb|EXB97654.1| hypothetical protein L484_020203 [Morus notabilis]
Length=456

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 125/164 (76%), Gaps = 10/164 (6%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F+ + DIEQQR  E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RF SFRRAP
Sbjct  152  QGDGFT-LSDIEQQRGVEESRSTHLMNKCRTSLELFFAIWFVMGNVWVFDSRFSSFRRAP  210

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMGS+++GAS++Q+S LP
Sbjct  211  MLHVLCISLLAWNAISYSFPFLLFLLLCCCVPLISSLLGYNMNMGSIDKGASDDQISELP  270

Query  413  TWKYKQVCNNPDLENENPEC--------CICLAQYRDKEEMRQL  306
            +WKYK V N  +L   N +C         + +A  +D+E  R L
Sbjct  271  SWKYKAVDNKLELGTNNTDCKSDNTHEDPLLIANVKDREATRDL  314



>gb|EYU27461.1| hypothetical protein MIMGU_mgv1a011482mg [Erythranthe guttata]
Length=280

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -2

Query  773  RQRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRA  597
            R R  +    DIEQQR+ E S ++Q + K +T +EL FAIWFVMGNVWVFD RF SFR A
Sbjct  143  RYRLVYLIGTDIEQQRNHEESRNMQCMYKFKTWLELIFAIWFVMGNVWVFDARFDSFRHA  202

Query  596  PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL  417
            PKLH+LCISLLAWN+V+YSFPFILFV+LCCCVP++SS LGYNMN GS ++GA+ EQL+ L
Sbjct  203  PKLHILCISLLAWNSVSYSFPFILFVLLCCCVPLLSSILGYNMNTGSHQKGATEEQLAGL  262

Query  416  PTWK  405
             +W+
Sbjct  263  SSWR  266



>gb|KJB13894.1| hypothetical protein B456_002G102600 [Gossypium raimondii]
Length=295

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 8/148 (5%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D F  + D+EQQR+ E S S  ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF RAP
Sbjct  149  QGDGF-GLADVEQQRTNEESRSTHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFHRAP  207

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA+ YSFPF+LF++LCCCVP++SS LGYNMNMGS +RGAS++Q+S LP
Sbjct  208  NLHVLCISLLAWNALCYSFPFLLFLLLCCCVPLISSLLGYNMNMGSTDRGASDDQISRLP  267

Query  413  TWKYKQVCNNPDLE------NENPECCI  348
            +W+YK++  N +L+      NE+P   I
Sbjct  268  SWRYKEISTNSELDHNSDHTNEDPVSHI  295



>ref|XP_006452653.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
 gb|ESR65893.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
Length=296

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSV-QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            Q D FS + D+EQQRS E S    ++ KCRT +ELFFAIWFVMGNVWVFD+RFGSF+RAP
Sbjct  147  QVDGFS-LPDVEQQRSSEDSRFSHLMNKCRTSLELFFAIWFVMGNVWVFDSRFGSFQRAP  205

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             LHVLCISLLAWNA++YSFPF+LF++LCCCVP++SS LGYNMNMG+ ++GAS++Q+S LP
Sbjct  206  NLHVLCISLLAWNALSYSFPFLLFLLLCCCVPLISSVLGYNMNMGAADKGASDDQISRLP  265

Query  413  TWKYKQVCNNPDLENENP  360
            +W+YK+V +N +  N  P
Sbjct  266  SWRYKRVDSNLEAGNSAP  283



>dbj|BAB09279.1| unnamed protein product [Arabidopsis thaliana]
Length=320

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 2/119 (2%)
 Frame = -2

Query  743  DIEQQRSX--EGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
            D+EQQ+    E  S  ++ KCRT +ELFFAIWFV+GNVWVFD+RFGSF  APKLHVLC+S
Sbjct  159  DVEQQQRGREETRSSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHHAPKLHVLCVS  218

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV  393
            LLAWNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS +R AS++Q+SSLP+WK+K++
Sbjct  219  LLAWNAICYSFPFLLFLFLCCLVPLISSLLGYNMNMGSSDRAASDDQISSLPSWKFKRI  277



>gb|EMS46348.1| hypothetical protein TRIUR3_26831 [Triticum urartu]
Length=379

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  713  SSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFP  534
            +S  ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLAWNAV YS P
Sbjct  110  NSSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLAWNAVVYSLP  169

Query  533  FILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPEC  354
            F+LF++LCC VP+V   LGYNMN  SV RGAS+EQL +LP W++K+     D E ++ EC
Sbjct  170  FLLFLLLCCFVPVVGYALGYNMNSASVGRGASDEQLDALPRWRFKEPDVPRDREKDDQEC  229

Query  353  CICLAQYRDKEEMR  312
            CICLAQYR+KEE R
Sbjct  230  CICLAQYREKEEDR  243



>ref|XP_010417710.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010417711.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010417712.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=421

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 113/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  236  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  294

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +++K  C N DLE          
Sbjct  295  ATICCCLPCLISVLGFRENF-SQTRGATAEAINTLPVYRFKSKCRN-DLEFSEEGEGGFL  352

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICL +Y D E++R+LPCSHVFH++CVD+WL+I + CPLCK +
Sbjct  353  LLGSQKKRLISGEDASCCICLTRYGDDEDVRELPCSHVFHVDCVDKWLKINATCPLCKNE  412

Query  224  LA  219
            + 
Sbjct  413  VG  414



>ref|XP_010925109.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Elaeis guineensis]
Length=444

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            MV+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L ++ + Y+ PFIL 
Sbjct  231  MVDHYKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIAFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LG+  ++G   RGA+NE +++LPT+K+K                   
Sbjct  290  ATICCCLPCIISILGFREDLGQT-RGATNEAINALPTYKFKAKRSRNRGSEINSENLGEG  348

Query  395  --VCNNPDLEN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
              V    D E     E+  CCICLA+Y D +E+R+LPCSH FH+ CVD+WL+I + CPLC
Sbjct  349  GIVAAGTDKERVISAEDAVCCICLAKYADNDELRELPCSHFFHMVCVDKWLKINALCPLC  408

Query  233  KKDLA  219
            K ++ 
Sbjct  409  KSEVG  413



>ref|XP_010925106.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010925107.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010925108.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Elaeis guineensis]
Length=450

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            MV+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L ++ + Y+ PFIL 
Sbjct  237  MVDHYKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIAFLTFSCIGYAMPFILC  295

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LG+  ++G   RGA+NE +++LPT+K+K                   
Sbjct  296  ATICCCLPCIISILGFREDLGQT-RGATNEAINALPTYKFKAKRSRNRGSEINSENLGEG  354

Query  395  --VCNNPDLEN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
              V    D E     E+  CCICLA+Y D +E+R+LPCSH FH+ CVD+WL+I + CPLC
Sbjct  355  GIVAAGTDKERVISAEDAVCCICLAKYADNDELRELPCSHFFHMVCVDKWLKINALCPLC  414

Query  233  KKDLA  219
            K ++ 
Sbjct  415  KSEVG  419



>gb|KDP37180.1| hypothetical protein JCGZ_06236 [Jatropha curcas]
Length=421

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +++  +  ++ FFA+WFV+GNVW+F     +   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LMDNFKMALDCFFAVWFVVGNVWIFGGH-STPTDAPKLYKLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-QVCNNPD-----------  378
              +CCC+P + S LG+  +  S  RGA+ E ++SLPT+K+K Q C N D           
Sbjct  286  ATICCCLPCIISLLGFREDF-SHTRGATTESINSLPTYKFKLQKCENEDDHDNSGNSEGG  344

Query  377  -----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                       +  E+  CCICL +Y D EE+R+LPCSHVFH+ CVD+WL+I + CPLCK
Sbjct  345  VLAAGTENEREISGEDAICCICLNKYIDNEELRELPCSHVFHVECVDKWLKINASCPLCK  404

Query  230  KDLA  219
             +L 
Sbjct  405  SELG  408



>ref|XP_004498626.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498627.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Cicer arietinum]
 ref|XP_004498628.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Cicer arietinum]
 ref|XP_004498629.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Cicer arietinum]
 ref|XP_004498630.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Cicer arietinum]
 ref|XP_004498631.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X6 [Cicer arietinum]
Length=403

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 114/183 (62%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  LA++ + Y+ PFIL 
Sbjct  195  LVEYFKISLDCFFAVWFVVGNVWIFGGR-SSIDEAPNLYRLCIVFLAFSCIGYAMPFILC  253

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLEN---------  369
              +CCC+P + S LG   ++ +  RGA++E +++LPT+K+K   N  + EN         
Sbjct  254  STICCCLPCIISILGVREDL-TQNRGATSESINALPTYKFKMKKNKRNGENNSANMEGGI  312

Query  368  -------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  313  VAGGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  372

Query  227  DLA  219
            ++ 
Sbjct  373  EVG  375



>gb|KJB70539.1| hypothetical protein B456_011G078300 [Gossypium raimondii]
Length=420

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+G+VW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LVDHFKMALDCFFAVWFVVGSVWIFGGH-ASPSDAPKLYRLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QVCNNPDLEN-------  369
              +CCC+P + S LG   ++ S  RGA+ E +++LPT+K+K  +  NN D E+       
Sbjct  286  ATICCCLPCIISILGTREDL-SQTRGATTESINALPTYKFKSKKTANNDDREDSAGEGGV  344

Query  368  -------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         E+  CCICLA Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK 
Sbjct  345  LAAGTEKERLISGEDAACCICLANYVDNDELRELPCDHVFHVECVDKWLKINASCPLCKS  404

Query  227  DLA  219
            ++ 
Sbjct  405  EIG  407



>gb|KJB35097.1| hypothetical protein B456_006G100000 [Gossypium raimondii]
Length=393

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 114/180 (63%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V++ +  ++ FFA+WF++GN+W+F     S   APK++ LC+  L ++ + Y+ PFIL 
Sbjct  202  LVDRFKMVLDCFFAVWFIIGNMWIFGGH-SSPSDAPKMYRLCVVFLTFSFIGYAMPFILC  260

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QVCNNPDLE--------  372
              +CCC+P + S LG+  +  S  RGA+ E +S+LPT+++K  ++ N  DL+        
Sbjct  261  AAICCCLPCIISVLGFREHF-SPTRGATMESISALPTYRFKSKKIGNVDDLDVSCAVLAS  319

Query  371  ---------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                      E+  CCICLA Y D +E+R+LPC HVFH+ CVD+WLRI +CCPLCK ++ 
Sbjct  320  GTAKERVISGEDAVCCICLAAYADNDELRELPCIHVFHVKCVDKWLRINACCPLCKTEVG  379



>ref|XP_003522643.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
 ref|XP_006578174.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
 gb|KHN02589.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=385

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  V+ FFAIWFV+GNVW+F     S  +AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  175  LVEYFKIAVDCFFAIWFVVGNVWIFGGH-SSADQAPNLYRLCVVFLTFSCIGYAMPFILC  233

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLEN---------  369
              +CCC+P + S LG   +M    RGAS+E +++LPT+K+K   N    E+         
Sbjct  234  ATICCCLPCIISILGVREDMAQT-RGASSESINALPTYKFKMKRNKSKGESNSAVGEGGV  292

Query  368  -------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  293  VAAGTEKERMISGEDAACCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  352

Query  227  DLA  219
            +++
Sbjct  353  EVS  355



>gb|KHG11759.1| hypothetical protein F383_13582 [Gossypium arboreum]
Length=412

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 113/180 (63%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V++ +  ++ FFA+WF++GN+W+F     S   APK++ LC+  L ++ + Y+ PFIL 
Sbjct  221  LVDRFKMVLDCFFAVWFIIGNMWIFGGH-SSPSDAPKIYRLCVVFLTFSFIGYAMPFILC  279

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV----CNNPD--------  378
              +CCC+P V S LG+  +  S  RGA+ E +S+LPT+++K       ++PD        
Sbjct  280  AAICCCLPCVISVLGFRQHF-SPTRGATMESISTLPTYRFKSKKIVNVDDPDVSCGVLAS  338

Query  377  -------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                   +  E+  CCICLA Y D +E+R+LPC HVFH+ CVD+WLRI +CCPLCK ++ 
Sbjct  339  GTAKERVISGEDAVCCICLAAYADNDELRELPCIHVFHVKCVDKWLRINACCPLCKTEVG  398



>ref|XP_010429960.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429961.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429962.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429963.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429964.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429965.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429967.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429968.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429969.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010429970.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=414

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  229  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  287

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +++K    N DLE          
Sbjct  288  ATICCCLPCLISVLGFRENF-SQTRGATAEAINTLPVYRFKSKSRN-DLEFSEEGEGGFL  345

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICL +Y D EE+R+LPCSHVFH++CVD+WL+I + CPLCK +
Sbjct  346  LLGSQKKRLISGEDASCCICLTRYGDDEEVRELPCSHVFHVDCVDKWLKINATCPLCKNE  405

Query  224  LA  219
            + 
Sbjct  406  VG  407



>gb|KJB35096.1| hypothetical protein B456_006G100000 [Gossypium raimondii]
 gb|KJB35100.1| hypothetical protein B456_006G100000 [Gossypium raimondii]
 gb|KJB35101.1| hypothetical protein B456_006G100000 [Gossypium raimondii]
Length=412

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 114/180 (63%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V++ +  ++ FFA+WF++GN+W+F     S   APK++ LC+  L ++ + Y+ PFIL 
Sbjct  221  LVDRFKMVLDCFFAVWFIIGNMWIFGGH-SSPSDAPKMYRLCVVFLTFSFIGYAMPFILC  279

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QVCNNPDLE--------  372
              +CCC+P + S LG+  +  S  RGA+ E +S+LPT+++K  ++ N  DL+        
Sbjct  280  AAICCCLPCIISVLGFREHF-SPTRGATMESISALPTYRFKSKKIGNVDDLDVSCAVLAS  338

Query  371  ---------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                      E+  CCICLA Y D +E+R+LPC HVFH+ CVD+WLRI +CCPLCK ++ 
Sbjct  339  GTAKERVISGEDAVCCICLAAYADNDELRELPCIHVFHVKCVDKWLRINACCPLCKTEVG  398



>ref|XP_010472936.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010472937.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010472938.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010472939.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
 ref|XP_010472940.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=422

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  237  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  295

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E ++SLP +++K    N DLE          
Sbjct  296  ATICCCLPCLISVLGFRENF-SQTRGATAEAINSLPVYRFKSKSRN-DLEFSEEGEGGFL  353

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICL +Y D E++R+LPCSHVFH++CVD+WL+I + CPLCK +
Sbjct  354  LLGSQKKRLISGEDASCCICLTRYGDDEDVRELPCSHVFHVDCVDKWLKINATCPLCKNE  413

Query  224  LA  219
            + 
Sbjct  414  VG  415



>ref|XP_008809197.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Phoenix dactylifera]
Length=444

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 112/185 (61%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            MV+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L ++ + Y+ PFIL 
Sbjct  231  MVDHYKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIAFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LG+  ++G   RGA++E +++LPT+K+K                   
Sbjct  290  ATICCCLPCIISILGFREDLGQT-RGATSEAINALPTYKFKAKRSRNRGSEINSENLGDG  348

Query  395  --VCNNPDLEN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
              V    D E     E+  CCICLA+Y D +E+R+LPCSH FH+ CVD+WL+I + CPLC
Sbjct  349  GIVAAGTDKERVISAEDAVCCICLAKYADNDELRELPCSHFFHMVCVDKWLKINALCPLC  408

Query  233  KKDLA  219
            K ++ 
Sbjct  409  KSEVG  413



>emb|CDY37594.1| BnaA02g19760D [Brassica napus]
Length=391

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  204  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  262

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +K+K    N DLE          
Sbjct  263  ATICCCLPCLISVLGFRENF-SQTRGATAEAINALPVYKFKTKSRN-DLEFSEEGEGGFL  320

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICLA+Y D EE+R+LPC HVFH++CVD+WL+I + CPLCK +
Sbjct  321  LQGSEKKRLISGEDASCCICLARYGDDEEVRELPCLHVFHVDCVDKWLKINATCPLCKNE  380

Query  224  LAR  216
            +  
Sbjct  381  VGE  383



>ref|XP_009128425.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Brassica rapa]
Length=405

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  218  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  276

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +K+K    N DLE          
Sbjct  277  ATICCCLPCLISVLGFRENF-SQTRGATAEAINALPVYKFKTKSRN-DLEFSEEGEGGFL  334

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICLA+Y D EE+R+LPC HVFH++CVD+WL+I + CPLCK +
Sbjct  335  LQGSEKKRLISGEDASCCICLARYGDDEEVRELPCLHVFHVDCVDKWLKINATCPLCKNE  394

Query  224  LAR  216
            +  
Sbjct  395  VGE  397



>ref|XP_009760536.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=408

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 107/180 (59%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L  + + Y+ PFIL 
Sbjct  219  LVDHFKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIAFLTISCIGYAMPFILC  277

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG   NM  V RGA+ E +++LPT+KY+   N               
Sbjct  278  AMICCCLPCIISILGVRENMHGV-RGATEESINALPTYKYRAKTNGNKNSEGEEGGFIAT  336

Query  377  -------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                   +  E+  CCICL +Y D +E+R+LPCSH FH  CVD+WL+I + CPLCK ++ 
Sbjct  337  GTEKERAISGEDAVCCICLTKYEDNDELRELPCSHFFHTQCVDKWLKINASCPLCKSEIG  396



>ref|NP_178156.1| putative zinc ion binding protein [Arabidopsis thaliana]
 gb|AAG52430.1|AC018848_1 putative RING zinc finger protein; 53384-54880 [Arabidopsis thaliana]
 gb|AAL32923.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAN15389.1| putative RING zinc finger protein [Arabidopsis thaliana]
 dbj|BAH19697.1| AT1G80400 [Arabidopsis thaliana]
 gb|AEE36398.1| putative zinc ion binding protein [Arabidopsis thaliana]
Length=407

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  222  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  280

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +++K    N DLE          
Sbjct  281  ATICCCLPCLISVLGFRENF-SQTRGATAEAINALPVYRFKSKSRN-DLEFSEEGEGGFL  338

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICL +Y D E++R+LPCSHVFH++CVD+WL+I + CPLCK +
Sbjct  339  LLGSQKKRLISGEDASCCICLTRYGDDEQVRELPCSHVFHVDCVDKWLKINATCPLCKNE  398

Query  224  LA  219
            + 
Sbjct  399  VG  400



>emb|CDY38666.1| BnaC02g23130D [Brassica napus]
Length=390

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  204  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  262

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +K+K    N DLE          
Sbjct  263  ATICCCLPCLISVLGFRENF-SQTRGATAEAINALPVYKFKLKSRN-DLEFSEEGEGGFL  320

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICLA+Y D EE+R+LPC HVFH++CVD+WL+I + CPLCK +
Sbjct  321  LQGSEKKRLISGEDASCCICLARYGDDEEVRELPCLHVFHVDCVDKWLKINATCPLCKNE  380

Query  224  LAR  216
            +  
Sbjct  381  VGE  383



>ref|XP_006389789.1| hypothetical protein EUTSA_v10018651mg [Eutrema salsugineum]
 gb|ESQ27075.1| hypothetical protein EUTSA_v10018651mg [Eutrema salsugineum]
Length=404

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  219  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  277

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +K++    N DLE          
Sbjct  278  ATICCCLPCLISVLGFRENF-SQTRGATPEAINALPVYKFRTKSRN-DLEFSEEDEGGFL  335

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICLA+Y D EE+R+LPC HVFH++CVD+WL+I + CPLCK +
Sbjct  336  LLGSHKKRLISGEDASCCICLARYGDDEEVRELPCLHVFHVDCVDKWLKINATCPLCKSE  395

Query  224  LA  219
            + 
Sbjct  396  VG  397



>ref|XP_006601119.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Glycine max]
Length=369

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFIL 
Sbjct  159  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSVEEAPNLYRLCIVFLAFSCIGYAMPFILC  217

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPD----------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  N D          
Sbjct  218  STICCCLPCIISILGVREDM-SQNRGAASESINALPIYKFKTKKNKRNGDSNSAAAEGGV  276

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  277  VAAGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  336

Query  227  DLA  219
            D+ 
Sbjct  337  DVG  339



>ref|XP_006301574.1| hypothetical protein CARUB_v10022012mg [Capsella rubella]
 gb|EOA34472.1| hypothetical protein CARUB_v10022012mg [Capsella rubella]
Length=415

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 111/182 (61%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  230  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  288

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +++K    N DLE          
Sbjct  289  ATICCCLPCLISVLGFRENF-SQTRGATAEAINALPVYRFKSKSRN-DLEFSEEGEGGFL  346

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICL +Y D E +R+LPCSHVFH++CVD+WL+I + CPLCK +
Sbjct  347  LSGSQKKRLISGEDASCCICLTRYGDDEAVRELPCSHVFHVDCVDKWLKINATCPLCKSE  406

Query  224  LA  219
            + 
Sbjct  407  VG  408



>ref|XP_006601116.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
 ref|XP_006601117.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Glycine max]
 ref|XP_006601118.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Glycine max]
Length=419

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFIL 
Sbjct  209  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSVEEAPNLYRLCIVFLAFSCIGYAMPFILC  267

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPD----------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  N D          
Sbjct  268  STICCCLPCIISILGVREDM-SQNRGAASESINALPIYKFKTKKNKRNGDSNSAAAEGGV  326

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  327  VAAGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  386

Query  227  DLA  219
            D+ 
Sbjct  387  DVG  389



>ref|XP_003549235.2| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
Length=450

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFIL 
Sbjct  240  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSVEEAPNLYRLCIVFLAFSCIGYAMPFILC  298

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPD----------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  N D          
Sbjct  299  STICCCLPCIISILGVREDM-SQNRGAASESINALPIYKFKTKKNKRNGDSNSAAAEGGV  357

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  358  VAAGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  417

Query  227  DLA  219
            D+ 
Sbjct  418  DVG  420



>ref|XP_002971210.1| hypothetical protein SELMODRAFT_171829 [Selaginella moellendorffii]
 gb|EFJ27808.1| hypothetical protein SELMODRAFT_171829 [Selaginella moellendorffii]
Length=392

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 118/205 (58%), Gaps = 31/205 (15%)
 Frame = -2

Query  755  SAVXDIEQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
            SA  ++ + R+  G   ++VEK +  ++ FFA+WFV+GNVW+F     S R AP L+ LC
Sbjct  173  SASTEVVESRARVG---RLVEKFKIALDCFFAVWFVVGNVWIFGGHSSS-REAPNLYRLC  228

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ  396
            I  L ++ + Y+ PFIL   +CCC+P + + LG+        RGAS E +++LPT+K+K 
Sbjct  229  IVFLTFSCIGYAMPFILCATICCCLPCIIALLGFREEQAQ-NRGASAEVIAALPTYKFKS  287

Query  395  ----------------------VCNNPDLEN----ENPECCICLAQYRDKEEMRQLPCSH  294
                                  V    D E     ++  CCICLA+YRD E +R+L C+H
Sbjct  288  RPSSESKDGSESDSEGSNEGGFVAAGTDKERAVSADDAVCCICLARYRDGEPLRELSCTH  347

Query  293  VFHLNCVDQWLRIISCCPLCKKDLA  219
             FH++CVD+WL+I + CPLCK D+ 
Sbjct  348  HFHVDCVDKWLKINASCPLCKLDVG  372



>ref|XP_002516614.1| ring finger protein, putative [Ricinus communis]
 gb|EEF45955.1| ring finger protein, putative [Ricinus communis]
Length=437

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 112/185 (61%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP ++ LCI  L ++ + Y+ PFIL 
Sbjct  225  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSATEAPNMYRLCIVFLTFSCIGYAMPFILC  283

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----QVCNNPD--------  378
              +CCC+P + S LG+  ++G   RGA++E + +LPT+K+K    +  ++ D        
Sbjct  284  ATICCCLPCIISLLGFREDLGQT-RGATSESIDALPTYKFKLNKHRTGDDRDSNSGAGDG  342

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLC
Sbjct  343  GVVAAGTEHERFISGEDAVCCICLAKYANNDELRELPCSHFFHKDCVDKWLKINASCPLC  402

Query  233  KKDLA  219
            K ++ 
Sbjct  403  KTEVG  407



>ref|XP_002889294.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65553.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=401

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (61%), Gaps = 24/182 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL 
Sbjct  216  LVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFILC  274

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE----------  372
              +CCC+P + S LG+  N  S  RGA+ E +++LP +++K    N DLE          
Sbjct  275  ATICCCLPCLISVLGFRENF-SQTRGATTEAINALPVYRFKSKSRN-DLEFSEEGEGGFL  332

Query  371  -----------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKD  225
                        E+  CCICL +Y D  ++R+LPCSHVFH++CVD+WL+I + CPLCK +
Sbjct  333  LLGSQKKRLISGEDASCCICLTRYGDDVQVRELPCSHVFHVDCVDKWLKINATCPLCKNE  392

Query  224  LA  219
            + 
Sbjct  393  VG  394



>dbj|BAD19217.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD19854.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAG89963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=199

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 24/175 (14%)
 Frame = -2

Query  677  VELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVP  498
            ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CCC+P
Sbjct  3    LDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICCCLP  61

Query  497  MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------VCNNPD--  378
             + S +G+  +  +  RGA++E ++SLPT+K+K                   V    D  
Sbjct  62   CIISVMGFREDTNNT-RGATSESINSLPTYKFKTKKRRHSSGNEAEGQDGGIVAAGTDKE  120

Query  377  --LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
              L  E+  CCICLA+Y   +E+R+LPC+H FH  CVD+WL+I + CPLCK ++A
Sbjct  121  RSLSAEDAVCCICLAKYAHNDELRELPCTHCFHKECVDKWLKINALCPLCKSEIA  175



>gb|KHF98391.1| hypothetical protein F383_13476 [Gossypium arboreum]
Length=420

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 111/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+G+VW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LVDHFKMALDCFFAVWFVVGSVWIFGGH-ASPSDAPKLYRLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QVCNNPDLEN-------  369
              +CCC+P + S LG   ++ S  RGA+ E +++LPT+K+K  +  N+   E+       
Sbjct  286  ATICCCLPCIISILGTREDL-SQTRGATTESINALPTYKFKSKKTANDDGQEDSTGKGGV  344

Query  368  -------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         E+  CCICLA Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK 
Sbjct  345  LAAGTEKERLISGEDAACCICLANYVDDDELRELPCDHVFHVECVDKWLKINASCPLCKS  404

Query  227  DLA  219
            ++ 
Sbjct  405  EIG  407



>gb|KDP32286.1| hypothetical protein JCGZ_13211 [Jatropha curcas]
Length=409

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP ++ LCI  L ++ + Y+ PFIL 
Sbjct  202  LVEYFKMVLDCFFAVWFVVGNVWIFGGH-SSANEAPNMYRLCIVFLTFSCLGYAMPFILC  260

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
            V +CCC+P + S LG+  ++G   RGA+ E + +LPT+K+K   N N D           
Sbjct  261  VTICCCLPCIISLLGFREDLGQ-SRGATPESIDALPTYKFKLNKNRNIDDRESDGGIVAA  319

Query  377  -------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                   +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPLCK ++ 
Sbjct  320  GTEQERAISGEDAACCICLAKYANNDELRELPCSHFFHKECVDKWLKINASCPLCKSEVG  379



>ref|XP_002517522.1| ring finger protein, putative [Ricinus communis]
 gb|EEF44686.1| ring finger protein, putative [Ricinus communis]
Length=421

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 117/202 (58%), Gaps = 25/202 (12%)
 Frame = -2

Query  752  AVXDIEQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCI  573
            A+ + +  R        +++  +  ++ FFA+WFV+GNVW+F     +   APKL+ LCI
Sbjct  208  AIANGQTGRPLSSRLNGLMDHFKMALDCFFAVWFVVGNVWIFGGH-STPTDAPKLYKLCI  266

Query  572  SLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--  399
              L ++ + Y+ PFIL   +CCC+P + S LG+  +  S  RGA+ E ++SLP +K+K  
Sbjct  267  VFLTFSCIGYAMPFILCATICCCLPCIISLLGFREDF-SQTRGATTESINSLPIYKFKLQ  325

Query  398  --QVCNNPD-------------------LENENPECCICLAQYRDKEEMRQLPCSHVFHL  282
              +  N+ D                   +  E+  CCICL +Y D +E+R+LPCSHVFH+
Sbjct  326  KSESVNDHDNSGTGEGGVLAEGTEKERAISGEDAICCICLNKYADNDELRELPCSHVFHV  385

Query  281  NCVDQWLRIISCCPLCKKDLAR  216
            +CVD+WL+I + CPLCK +L  
Sbjct  386  DCVDKWLKINASCPLCKSELGE  407



>gb|KHN12061.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=419

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 111/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFI  
Sbjct  209  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSVEEAPNLYRLCIVFLAFSCIGYAMPFIFC  267

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPD----------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  N D          
Sbjct  268  STICCCLPCIISILGVREDM-SQNRGAASESINALPIYKFKTKKNKRNGDSNSAAAEGGV  326

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  327  VAAGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  386

Query  227  DLA  219
            D+ 
Sbjct  387  DVG  389



>ref|XP_004291419.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459149.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459150.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459151.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  224  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSANDAPNLYRLCIVFLTFSCIGYAMPFILC  282

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++    RGA+ E +++LPT+K+K   N N D           
Sbjct  283  ATICCCLPCIISVLGFREDLTQA-RGATTESINALPTYKFKMKKNRNGDSNEGVVAAGTE  341

Query  377  ----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPLCK ++ 
Sbjct  342  KERVISGEDAVCCICLAKYANNDELRELPCSHFFHKECVDKWLKINASCPLCKSEVG  398



>gb|EYU29255.1| hypothetical protein MIMGU_mgv1a007086mg [Erythranthe guttata]
Length=420

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 107/177 (60%), Gaps = 19/177 (11%)
 Frame = -2

Query  698  VEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFV  519
            VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFIL  
Sbjct  227  VEYFKMALDCFFAVWFVVGNVWIFGGHSSS-AEAPNLYRLCIVFLAFSCIGYAMPFILCT  285

Query  518  VLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD-------------  378
             +CCC+P + S LG+  +  S  RGA+ E ++SLPT+K+K   N                
Sbjct  286  TICCCLPCIISVLGFREDF-SQNRGATPESINSLPTYKFKAKKNKSGNDKEGGIVAAGTE  344

Query  377  ----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPLCK ++ 
Sbjct  345  KERVISEEDAVCCICLAKYANNDELRELPCSHFFHKECVDKWLKINASCPLCKAEVG  401



>ref|XP_006366871.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366872.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Solanum tuberosum]
Length=419

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 107/184 (58%), Gaps = 26/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L  + + Y+ PFIL 
Sbjct  220  LVDHFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIAFLTISCIGYAMPFILC  278

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG   NM  V RGA+ E +++LPT KY+   +               
Sbjct  279  AMICCCLPCIISILGVRENMHGV-RGATEESINALPTLKYRVKTDGTGSNESKNLGEEEG  337

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y D +E+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  338  GCVAAGTEKERAISGEDAACCICLAKYEDNDELRELPCSHFFHTQCVDKWLKINATCPLC  397

Query  233  KKDL  222
            K ++
Sbjct  398  KSEI  401



>ref|XP_009358216.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Pyrus x bretschneideri]
 ref|XP_009358219.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Pyrus x bretschneideri]
Length=421

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F +   S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  228  LVDHFKMALDCFFAVWFVVGNVWIFASH-SSPSDAPKLYKLCIVFLTFSCIGYAMPFILC  286

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPDLEN-------  369
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K   N  N D E        
Sbjct  287  ATICCCLPCIISVLGFREDL-SQTRGATVESINALPTYKFKLKENESNGDQEGNLGSECG  345

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  346  LLAAGTEKEREISGEDAVCCICLAKYADDDELRELPCLHVFHVECVDKWLKINASCPLCK  405

Query  230  KDLA  219
             ++ 
Sbjct  406  GEVG  409



>ref|XP_006596122.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
Length=418

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 110/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFI  
Sbjct  208  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSANEAPNLYRLCIVFLAFSCIGYAMPFIFC  266

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  +            
Sbjct  267  STICCCLPCIISILGVREDM-SQNRGATSESINALPIYKFKMKKNKRNGNGNSAAAEGGV  325

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  326  VAAGTEKEHVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  385

Query  227  DLA  219
            D+ 
Sbjct  386  DVG  388



>ref|XP_008337111.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Malus domestica]
Length=321

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 110/187 (59%), Gaps = 27/187 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  122  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAADAPNLYRLCIVFLTFSCIGYAMPFILC  180

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++    RGA+ E ++SLPT+K+K   N N D           
Sbjct  181  ATICCCLPCIISVLGFREDLAQA-RGATPESINSLPTYKFKIKKNKNGDNRDGGSSGATE  239

Query  377  -------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                         +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPL
Sbjct  240  GGVVAAGTEKERAISGEDAVCCICLAKYANNDELRELPCSHFFHKDCVDKWLKINASCPL  299

Query  236  CKKDLAR  216
            CK ++  
Sbjct  300  CKSEVGE  306



>ref|XP_008373479.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Malus domestica]
Length=421

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F +   S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  228  LVDHFKMALDCFFAVWFVVGNVWIFGSH-SSPSDAPKLYKLCIVFLTFSCIGYAMPFILC  286

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPDLEN-------  369
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K   N  N D E        
Sbjct  287  ATICCCLPCIISVLGFREDL-SQTRGATVESINALPTYKFKLKENESNDDQEGNLGSECG  345

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  346  LLAAGTEKEREISGEDAVCCICLAKYADDDELRELPCLHVFHVECVDKWLKINASCPLCK  405

Query  230  KDLA  219
             +  
Sbjct  406  SEAG  409



>ref|XP_009595010.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
tomentosiformis]
Length=413

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 106/185 (57%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L  + + Y+ PFIL 
Sbjct  219  LVDHFKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIAFLTISCIGYAMPFILC  277

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG   NM  V RGA+ E +++LPT KY+   N               
Sbjct  278  AMICCCLPCIISILGVRENMHGV-RGATEESINALPTHKYRVKTNGTGSNGNKNSEGEEG  336

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICL +Y D +E+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  337  GFIATGTEKERAISGEDAVCCICLTKYEDNDELRELPCSHFFHTQCVDKWLKINASCPLC  396

Query  233  KKDLA  219
            K ++ 
Sbjct  397  KSEIG  401



>ref|XP_010109041.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC20793.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=432

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 115/196 (59%), Gaps = 29/196 (15%)
 Frame = -2

Query  731  QRSXEGSSV------QMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCIS  570
             RS +GS +       +VE  +  ++ FFAIWFV+GNVW+F     S   AP L+ LCI 
Sbjct  210  HRSRQGSEIMNARLKALVEYFKMALDCFFAIWFVVGNVWIFGGH-SSANEAPNLYRLCIV  268

Query  569  LLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC  390
             L ++ + Y+ PFIL   +CCC+P + S LG+  ++ +  RGA++E + +LPT+K+K   
Sbjct  269  FLTFSCIGYAMPFILCATICCCLPCIISALGFREDL-TQNRGATSESIDALPTYKFKLKK  327

Query  389  N-NPD--------------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV  273
            N N D                    +  E+  CCICLA+Y + +E+R+LPCSH FH  CV
Sbjct  328  NRNGDDRDGASEGGIIAAGTDKERVISGEDAVCCICLAKYANNDELRELPCSHFFHKECV  387

Query  272  DQWLRIISCCPLCKKD  225
            D+WL+I + CPLCK +
Sbjct  388  DKWLKINASCPLCKSE  403



>ref|XP_003545507.2| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
Length=436

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 110/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFI  
Sbjct  226  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSANEAPNLYRLCIVFLAFSCIGYAMPFIFC  284

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  +            
Sbjct  285  STICCCLPCIISILGVREDM-SQNRGATSESINALPIYKFKMKKNKRNGNGNSAAAEGGV  343

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  344  VAAGTEKEHVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  403

Query  227  DLA  219
            D+ 
Sbjct  404  DVG  406



>gb|KHN25509.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=440

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 110/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA++ + Y+ PFI  
Sbjct  230  LVEYFKISLDCFFAVWFVVGNVWIFGGH-SSANEAPNLYRLCIVFLAFSCIGYAMPFIFC  288

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG   +M S  RGA++E +++LP +K+K   N  +            
Sbjct  289  STICCCLPCIISILGVREDM-SQNRGATSESINALPIYKFKMKKNKRNGNGNSAAAEGGV  347

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  348  VAAGTEKEHVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  407

Query  227  DLA  219
            D+ 
Sbjct  408  DVG  410



>ref|XP_004251592.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_004251593.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313717.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313718.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313719.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313720.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313721.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313722.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313723.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
Length=419

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 107/184 (58%), Gaps = 26/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L  + + Y+ PFIL 
Sbjct  220  LVDHFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIAFLTISCIGYAMPFILC  278

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG   NM  V RGA+ E +++LPT KY+   +               
Sbjct  279  AMICCCLPCIISILGVRENMHGV-RGATEESINALPTLKYRVKTDGTGSNESKNLEEEEG  337

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y D +E+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  338  GCVAAGTEKERAISGEDAVCCICLAKYEDNDELRELPCSHFFHTQCVDKWLKINATCPLC  397

Query  233  KKDL  222
            K ++
Sbjct  398  KSEI  401



>ref|XP_004138872.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 ref|XP_004160867.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN62894.1| hypothetical protein Csa_2G379250 [Cucumis sativus]
Length=424

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 119/201 (59%), Gaps = 33/201 (16%)
 Frame = -2

Query  728  RSXEGSSVQ------MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISL  567
            R  +GS V       +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  
Sbjct  210  RGSQGSGVLSARLKVLVEYFKMGLDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCIVF  268

Query  566  LAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QV  393
            L ++ + Y+ PFIL V +CCC+P + S LG+  ++ S  RGA++E +++LPT+K+K  + 
Sbjct  269  LTFSCIGYAMPFILCVTICCCLPCIISILGFREDL-SQTRGATSESINALPTYKFKLKKS  327

Query  392  CNNPDLEN-----------------------ENPECCICLAQYRDKEEMRQLPCSHVFHL  282
             +  D EN                       E+  CCICLA+Y + +E+R+LPCSH FH 
Sbjct  328  RSGDDRENNSGAGEGGGVVAAGTEKERVISGEDAVCCICLAKYANNDELRELPCSHFFHK  387

Query  281  NCVDQWLRIISCCPLCKKDLA  219
            +CVD+WL+I + CPLCK ++ 
Sbjct  388  DCVDKWLKINALCPLCKAEVG  408



>ref|XP_009358214.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009358217.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Pyrus x bretschneideri]
Length=434

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F +   S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  241  LVDHFKMALDCFFAVWFVVGNVWIFASH-SSPSDAPKLYKLCIVFLTFSCIGYAMPFILC  299

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPDLEN-------  369
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K   N  N D E        
Sbjct  300  ATICCCLPCIISVLGFREDL-SQTRGATVESINALPTYKFKLKENESNGDQEGNLGSECG  358

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  359  LLAAGTEKEREISGEDAVCCICLAKYADDDELRELPCLHVFHVECVDKWLKINASCPLCK  418

Query  230  KDLA  219
             ++ 
Sbjct  419  GEVG  422



>emb|CDY51672.1| BnaC03g67110D [Brassica napus]
Length=409

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 21/181 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFAIWFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  191  LMEYFKMALDCFFAIWFVVGNVWIFGGH-SSASEAPNLYRLCLVFLTFSCIGYAMPFILC  249

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  250  TTICCCLPCIISILGYREDL-TQPRGATTESINALPTHKFKLKKSRSGGSSSSEGGVVAA  308

Query  398  QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
               N   +  E+  CCICLA+Y + EE+R+LPCSH FH +CVD+WL+I + CPLCK ++ 
Sbjct  309  GTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKDCVDKWLKINASCPLCKSEVG  368

Query  218  R  216
             
Sbjct  369  E  369



>ref|XP_002961593.1| hypothetical protein SELMODRAFT_76977 [Selaginella moellendorffii]
 gb|EFJ36853.1| hypothetical protein SELMODRAFT_76977 [Selaginella moellendorffii]
Length=403

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 109/187 (58%), Gaps = 28/187 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VEK +  ++ FFA+WFV+GNVW+F     S R AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  199  LVEKFKIALDCFFAVWFVVGNVWIFGGHSSS-REAPNLYRLCIVFLTFSCIGYAMPFILC  257

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + + LG+        RGAS E +++LPT+K+K                   
Sbjct  258  ATICCCLPCIIALLGFREEQAQ-NRGASAEVIAALPTYKFKSRPSSESKDGSESDSEGSN  316

Query  395  ----VCNNPDLEN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCP  240
                V    D E     ++  CCICLA+YRD E +R+L C+H FH++CVD+WL+I + CP
Sbjct  317  EGGFVAAGTDKERAVSADDAVCCICLARYRDGEPLRELSCTHHFHVDCVDKWLKINASCP  376

Query  239  LCKKDLA  219
            LCK D+ 
Sbjct  377  LCKLDVG  383



>ref|XP_008228607.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Prunus mume]
Length=424

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  228  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  286

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPDLE--------  372
              +CCC+P + S LG+  +  S  RGA+ E +++LPT+K+K   N  N D E        
Sbjct  287  ATICCCLPCIISVLGFRGDF-SQTRGATAESINALPTYKFKLKENETNNDHECNLDSEGG  345

Query  371  -------------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D++E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  346  LLAAGTEKERAISGEDAVCCICLAKYADEDELRELPCLHVFHVECVDKWLKINASCPLCK  405

Query  230  KDLA  219
             ++ 
Sbjct  406  SEVG  409



>emb|CAN81037.1| hypothetical protein VITISV_017962 [Vitis vinifera]
Length=547

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 116/198 (59%), Gaps = 26/198 (13%)
 Frame = -2

Query  737  EQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAW  558
            E+Q    G    +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L +
Sbjct  329  EEQYEAMGRLKVLVEYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTF  387

Query  557  NAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NP  381
            + + Y+ PFIL   +CCC+P + S LG+  ++    RGA++E +++LPT+K+K   N N 
Sbjct  388  SCIGYAMPFILCATICCCLPCIISILGFREDLTQT-RGATSESINALPTYKFKLKKNRNG  446

Query  380  D-----------------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD  270
            D                       +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD
Sbjct  447  DDREGNSGAGEGGVVAAGTERERVISGEDAVCCICLAKYANNDELRELPCSHFFHKECVD  506

Query  269  QWLRIISCCPLCKKDLAR  216
            +WL+I + CPLCK+++ +
Sbjct  507  KWLKINALCPLCKREVKK  524



>ref|XP_007024038.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY26660.1| RING/U-box superfamily protein [Theobroma cacao]
Length=417

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 110/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  226  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  284

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV----CNNPD--------  378
              +CCC+P + S LG+  +  S  RGA+ E +++LP +K+K       NN D        
Sbjct  285  ATICCCLPCIISVLGFREDF-SQTRGATVESINALPIYKFKSRKSGNVNNQDNSAGDGGI  343

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK 
Sbjct  344  LAAGTAKERAISGEDAVCCICLAKYADNDELRELPCIHVFHVECVDKWLKINASCPLCKS  403

Query  227  DLA  219
            ++ 
Sbjct  404  EVG  406



>ref|XP_008445126.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Cucumis melo]
 ref|XP_008445127.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Cucumis melo]
Length=424

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 119/201 (59%), Gaps = 33/201 (16%)
 Frame = -2

Query  728  RSXEGSSVQ------MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISL  567
            R  +GS V       +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  
Sbjct  210  RGSQGSGVLSARLKVLVEYFKMGLDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCIVF  268

Query  566  LAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QV  393
            L ++ + Y+ PFIL V +CCC+P + S LG+  ++ +  RGA++E +++LPT+K+K  + 
Sbjct  269  LTFSCIGYAMPFILCVTICCCLPCIISILGFREDL-TQTRGATSESINALPTYKFKLKKS  327

Query  392  CNNPDLEN-----------------------ENPECCICLAQYRDKEEMRQLPCSHVFHL  282
             +  D EN                       E+  CCICLA+Y + +E+R+LPCSH FH 
Sbjct  328  RSGDDRENNSGTGEGGGVVAAGTEKERVISGEDAVCCICLAKYANNDELRELPCSHFFHK  387

Query  281  NCVDQWLRIISCCPLCKKDLA  219
            +CVD+WL+I + CPLCK ++ 
Sbjct  388  DCVDKWLKINALCPLCKAEVG  408



>ref|XP_010249880.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nelumbo 
nucifera]
Length=439

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  231  LVDHFKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIVFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG+  ++ +  RGA+ E +++LPT+K+K    N D            
Sbjct  290  ATICCCLPCIISILGFREDL-TQTRGATPESINALPTYKFKLKNENGDGRETISSEGAGE  348

Query  377  -------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                         +  E+  CCICLA+Y D EE+R+LPCSH FH+ CVD+WL+I + CPL
Sbjct  349  GGVLAAGTEKERVISGEDAVCCICLARYADNEELRELPCSHFFHMECVDKWLKINALCPL  408

Query  236  CK  231
            CK
Sbjct  409  CK  410



>ref|XP_008809167.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008809175.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008809181.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008809191.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Phoenix dactylifera]
Length=449

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 110/190 (58%), Gaps = 31/190 (16%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            MV+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI+ L ++ + Y+ PFIL 
Sbjct  231  MVDHYKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIAFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPE-----  357
              +CCC+P + S LG+  ++G   RGA++E +++LPT+K+K   +       N E     
Sbjct  290  ATICCCLPCIISILGFREDLGQT-RGATSEAINALPTYKFKAKRSRNRGSEINSENLGDG  348

Query  356  ------------------------CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS  249
                                    CCICLA+Y D +E+R+LPCSH FH+ CVD+WL+I +
Sbjct  349  GIVAAGTDKERVISAEDACVLLQVCCICLAKYADNDELRELPCSHFFHMVCVDKWLKINA  408

Query  248  CCPLCKKDLA  219
             CPLCK ++ 
Sbjct  409  LCPLCKSEVG  418



>ref|XP_010537938.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Tarenaya hassleriana]
 ref|XP_010537939.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Tarenaya hassleriana]
Length=420

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 121/203 (60%), Gaps = 27/203 (13%)
 Frame = -2

Query  764  DEFSAVXDIEQQRSXEGSSVQ-----MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRR  600
            DE +      + R+ +G +++     +V+  +  ++ FFA+WFV+GNVW+F     S   
Sbjct  205  DEETNTRIGAEPRNHQGENLRARLNGLVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSD  263

Query  599  APKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSS  420
            APKL+ LCI  L ++ + Y+ PFIL   +CCC+P + S LG+  N  S  RGA+ E +++
Sbjct  264  APKLYRLCIVFLTFSCIGYAMPFILCATICCCLPCLISVLGFRENF-SQTRGAAVEVINA  322

Query  419  LPTWKYK-QVCNNPDL-------------------ENENPECCICLAQYRDKEEMRQLPC  300
            LP +K++ +  N+ DL                     E+  CCICLA+Y D +E+R+LPC
Sbjct  323  LPVYKFRLKSVNDEDLAGEGEGGFLLSGSQKKCLISGEDAVCCICLARYADNDELRELPC  382

Query  299  SHVFHLNCVDQWLRIISCCPLCK  231
            +HVFH+ CVD+WL+I + CPLCK
Sbjct  383  THVFHVECVDKWLKINATCPLCK  405



>ref|XP_002309588.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE93111.2| zinc finger family protein [Populus trichocarpa]
Length=429

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 108/183 (59%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  224  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAEEAPNLYRLCIVFLTFSCIGYAMPFILC  282

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LGY  ++ +  RGA+ E + +LPT+K+K + N               
Sbjct  283  ATICCCLPCIISVLGYREDL-TQTRGATTESIDALPTYKFKLIKNRNGEDSSAGASDGGV  341

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA++ + +E+R+LPCSH FH  CVD+WL+I + CPLCK 
Sbjct  342  VAAGTEKERVISGEDAVCCICLAKFANNDELRELPCSHFFHKECVDKWLKINASCPLCKS  401

Query  227  DLA  219
            ++ 
Sbjct  402  EVG  404



>emb|CBI36189.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 112/186 (60%), Gaps = 28/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            MV+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  196  MVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  254

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLEN---------  369
              +CCC+P + S LG+  ++ S  RGA+ E + +LPT+K+K +  N D+++         
Sbjct  255  ATICCCLPCIISILGFREDL-SQTRGAAPESIDALPTYKFK-LKKNGDVDDQEVNSGAGE  312

Query  368  ----------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                            E+  CCICLA+Y D EE+R+LPC H FH+ CVD+WL+I + CPL
Sbjct  313  GGVLAAGTEKERAISGEDAVCCICLAKYADNEELRELPCCHFFHVECVDKWLKINALCPL  372

Query  236  CKKDLA  219
            CK ++ 
Sbjct  373  CKFEVG  378



>emb|CBI20932.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 112/185 (61%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  206  LVEYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTFSCIGYAMPFILC  264

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++ +  RGA++E +++LPT+K+K   N N D           
Sbjct  265  ATICCCLPCIISILGFREDL-TQTRGATSESINALPTYKFKLKKNRNGDDREGNSGAGEG  323

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  324  GVVAAGTERERVISGEDAVCCICLAKYANNDELRELPCSHFFHKECVDKWLKINALCPLC  383

Query  233  KKDLA  219
            K+++ 
Sbjct  384  KREVG  388



>ref|XP_007215429.1| hypothetical protein PRUPE_ppa006140mg [Prunus persica]
 gb|EMJ16628.1| hypothetical protein PRUPE_ppa006140mg [Prunus persica]
Length=425

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  229  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  287

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPDLE--------  372
              +CCC+P + S LG+  +  S  RGA+ E +++LPT+K+K   N  N D E        
Sbjct  288  ATICCCLPCIISVLGFRGDF-SQTRGATVESINALPTYKFKLKENETNNDHECNLDSEGG  346

Query  371  -------------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D++E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  347  LLAAGTEKERAISGEDAVCCICLAKYADEDELRELPCLHVFHVECVDKWLKINASCPLCK  406

Query  230  KDLA  219
             ++ 
Sbjct  407  SEVG  410



>ref|XP_008342734.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Malus 
domestica]
Length=425

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     +   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  229  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SAPSDAPKLYRLCIVFLTFSCIGYAMPFILC  287

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK---QVCNNP----------  381
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K    V N+           
Sbjct  288  ATICCCLPCIISVLGFREDL-SQARGATVESINALPTYKFKLKENVTNDDQEGSPGSQGG  346

Query  380  ----------DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                      ++  ++  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  347  LLAAGTEKEREISGDDAVCCICLAKYADNDELRELPCLHVFHVECVDKWLKINASCPLCK  406

Query  230  KDLA  219
             ++ 
Sbjct  407  SEVG  410



>ref|XP_002284536.2| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Vitis vinifera]
 ref|XP_010648554.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Vitis vinifera]
Length=421

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 112/185 (61%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  226  LVEYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTFSCIGYAMPFILC  284

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++ +  RGA++E +++LPT+K+K   N N D           
Sbjct  285  ATICCCLPCIISILGFREDL-TQTRGATSESINALPTYKFKLKKNRNGDDREGNSGAGEG  343

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  344  GVVAAGTERERVISGEDAVCCICLAKYANNDELRELPCSHFFHKECVDKWLKINALCPLC  403

Query  233  KKDLA  219
            K+++ 
Sbjct  404  KREVG  408



>ref|XP_008809011.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Phoenix 
dactylifera]
 ref|XP_008809012.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Phoenix 
dactylifera]
Length=445

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 115/186 (62%), Gaps = 27/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V++ +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  232  LVDRFKMALDCFFAVWFVVGNVWIFGGRSSS-HDAPNLYGLCIVFLTFSCIGYAMPFILC  290

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----QVCNNPDLENEN---  363
             ++CCC+P + S +G+  +M S  RGA++E +++LPT+K+K    Q  +  ++ +EN   
Sbjct  291  AMICCCLPCIISIMGFREDM-SYGRGATSELINALPTYKFKLKRPQNGDENEINSENQVN  349

Query  362  ------------------PECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                                CCICLA Y + +E+R+LPC+H FH+ CVD+WL+I + CPL
Sbjct  350  GGILAAGTDKERTISAEDAVCCICLANYVNNDELRELPCTHYFHMECVDKWLKINALCPL  409

Query  236  CKKDLA  219
            CK ++ 
Sbjct  410  CKSEVG  415



>ref|XP_009413619.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413620.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413621.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413622.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413623.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=415

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 116/206 (56%), Gaps = 24/206 (12%)
 Frame = -2

Query  770  QRDEFSAVXDIEQQRSXEGSSVQ-MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            +R  F+++    Q     G      V+  +  ++ FFA+WFV+GNVW+F      +  AP
Sbjct  182  ERSSFASILQYRQNSMIVGPRFNGFVDHFKMALDCFFAVWFVVGNVWIFSEHSSEYS-AP  240

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             L+ LCI  LA + + Y+ PFI F  +CCC P + S LG   ++    RGA++E ++SLP
Sbjct  241  NLYRLCIVFLALSCIGYAIPFIRFATVCCCFPCIISVLGIREDLRPT-RGANSEVVNSLP  299

Query  413  TWKYK-----QVCNNPD----------------LENENPECCICLAQYRDKEEMRQLPCS  297
            T+K++      + NN +                +  E+  CCICLA+Y D +E+R+LPCS
Sbjct  300  TYKFRSKRRADIGNNQEYLFTFGILSSGSEERIISAEDSACCICLAKYVDNDELRELPCS  359

Query  296  HVFHLNCVDQWLRIISCCPLCKKDLA  219
            H FH  C+D+WL+I + CPLCK ++ 
Sbjct  360  HFFHKECIDKWLKINALCPLCKSEVG  385



>emb|CDY23333.1| BnaA08g12130D [Brassica napus]
Length=424

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 107/181 (59%), Gaps = 21/181 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFAIWFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  206  LMEYFKMALDCFFAIWFVVGNVWIFGGH-SSASEAPNLYRLCLVFLTFSCIGYAMPFILC  264

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  265  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGSSSIEGGVVAA  323

Query  398  QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
               N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK ++ 
Sbjct  324  GTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCKSEVG  383

Query  218  R  216
             
Sbjct  384  E  384



>ref|XP_010654710.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Vitis vinifera]
Length=444

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 112/186 (60%), Gaps = 28/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            MV+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  222  MVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  280

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLEN---------  369
              +CCC+P + S LG+  ++ S  RGA+ E + +LPT+K+K +  N D+++         
Sbjct  281  ATICCCLPCIISILGFREDL-SQTRGAAPESIDALPTYKFK-LKKNGDVDDQEVNSGAGE  338

Query  368  ----------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                            E+  CCICLA+Y D EE+R+LPC H FH+ CVD+WL+I + CPL
Sbjct  339  GGVLAAGTEKERAISGEDAVCCICLAKYADNEELRELPCCHFFHVECVDKWLKINALCPL  398

Query  236  CKKDLA  219
            CK ++ 
Sbjct  399  CKFEVG  404



>ref|XP_008352040.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
 ref|XP_008352042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=406

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 110/186 (59%), Gaps = 27/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  207  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAADAPNLYRLCIVFLTFSCIGYAMPFILC  265

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++    RGA+ E ++SLPT+K+K   N N D           
Sbjct  266  ATICCCLPCIISVLGFREDLAQA-RGATPESINSLPTYKFKIKKNKNGDNRDGGSSGATE  324

Query  377  -------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                         +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPL
Sbjct  325  GGVVAAGTEKERAISGEDAVCCICLAKYANNDELRELPCSHFFHKDCVDKWLKINASCPL  384

Query  236  CKKDLA  219
            CK ++ 
Sbjct  385  CKSEVG  390



>ref|XP_011026527.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Populus 
euphratica]
Length=432

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFA+WFV+GNVW+F +   S   AP L+ LCI  L  + + Y+ PFIL 
Sbjct  222  LLEYFKMALDCFFAVWFVVGNVWIFGSH-SSAEEAPNLYRLCIVFLTISCIGYAMPFILC  280

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG+  ++ +  RGA+ E + +LPT+K+K + N               
Sbjct  281  ATICCCLPCIISILGFREDL-TQTRGATPESIDALPTYKFKLIKNRNGEDSGSGAADGGI  339

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLCK 
Sbjct  340  VAAGTEKERVISGEDAVCCICLAKYANNDELRELPCSHFFHKDCVDKWLKINASCPLCKS  399

Query  227  DLA  219
            ++ 
Sbjct  400  EVG  402



>ref|XP_006465443.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Citrus sinensis]
Length=369

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  175  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  233

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP--DLEN-------  369
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K   N    D +N       
Sbjct  234  ATICCCLPCIISVLGIREDY-SQTRGATAETINALPTYKFKSKKNGNLNDQDNSGGTEGG  292

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+L CSHVFH++CVD+WL+I + CPLCK
Sbjct  293  VLAAGTEKERMISGEDAVCCICLAKYVDDDELRELICSHVFHVDCVDKWLKINASCPLCK  352

Query  230  KDLA  219
             +++
Sbjct  353  SEIS  356



>ref|XP_008342732.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Malus 
domestica]
 ref|XP_008342733.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Malus 
domestica]
Length=438

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     +   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  242  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SAPSDAPKLYRLCIVFLTFSCIGYAMPFILC  300

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK---QVCNNP----------  381
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K    V N+           
Sbjct  301  ATICCCLPCIISVLGFREDL-SQARGATVESINALPTYKFKLKENVTNDDQEGSPGSQGG  359

Query  380  ----------DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                      ++  ++  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  360  LLAAGTEKEREISGDDAVCCICLAKYADNDELRELPCLHVFHVECVDKWLKINASCPLCK  419

Query  230  KDLA  219
             ++ 
Sbjct  420  SEVG  423



>ref|XP_009108867.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Brassica 
rapa]
Length=423

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 107/181 (59%), Gaps = 21/181 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFAIWFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  205  LMEYFKMALDCFFAIWFVVGNVWIFGGH-SSASEAPNLYRLCLVFLTFSCIGYAMPFILC  263

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  264  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGSSSIEGGVVAA  322

Query  398  QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
               N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK ++ 
Sbjct  323  GTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCKSEVG  382

Query  218  R  216
             
Sbjct  383  E  383



>ref|XP_010254223.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Nelumbo nucifera]
Length=399

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 111/187 (59%), Gaps = 28/187 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  211  LVDHFKMALDCFFAVWFVIGNVWIFGGHSSS-SDAPNLYRLCIVFLTFSCIGYAMPFILC  269

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-QVCNNPD-----------  378
              +CCC+P + S LG+  ++ +  RGA++E ++SLPT+K+K +   N D           
Sbjct  270  ATICCCLPCIISILGFREDL-TQTRGATSESINSLPTYKFKLKKTQNRDGRETVNSEGVG  328

Query  377  --------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCP  240
                          +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CP
Sbjct  329  EGGVLAAGTEKERVISGEDAVCCICLARYANNDELRELPCSHFFHRECVDKWLKINALCP  388

Query  239  LCKKDLA  219
            LCK D+ 
Sbjct  389  LCKSDVG  395



>ref|XP_006427098.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 ref|XP_006427101.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 ref|XP_006427103.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|ESR40338.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|ESR40341.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|ESR40343.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
Length=369

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  175  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  233

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP--DLEN-------  369
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K   N    D +N       
Sbjct  234  ATICCCLPCIISVLGIREDY-SQTRGATAETINALPTYKFKSKKNGNLNDQDNSGGTEGG  292

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+L CSHVFH++CVD+WL+I + CPLCK
Sbjct  293  VLAAGTEKERMISGEDAVCCICLAKYVDDDELRELICSHVFHVDCVDKWLKINASCPLCK  352

Query  230  KDLA  219
             ++ 
Sbjct  353  SEIG  356



>ref|XP_010254222.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Nelumbo nucifera]
Length=410

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 111/187 (59%), Gaps = 28/187 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  222  LVDHFKMALDCFFAVWFVIGNVWIFGGHSSS-SDAPNLYRLCIVFLTFSCIGYAMPFILC  280

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-QVCNNPD-----------  378
              +CCC+P + S LG+  ++ +  RGA++E ++SLPT+K+K +   N D           
Sbjct  281  ATICCCLPCIISILGFREDL-TQTRGATSESINSLPTYKFKLKKTQNRDGRETVNSEGVG  339

Query  377  --------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCP  240
                          +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CP
Sbjct  340  EGGVLAAGTEKERVISGEDAVCCICLARYANNDELRELPCSHFFHRECVDKWLKINALCP  399

Query  239  LCKKDLA  219
            LCK D+ 
Sbjct  400  LCKSDVG  406



>gb|KJB68139.1| hypothetical protein B456_010G227900 [Gossypium raimondii]
 gb|KJB68140.1| hypothetical protein B456_010G227900 [Gossypium raimondii]
Length=420

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV----CNNPDLE------  372
              +CCC+P + S LG   +  S  RGAS E +++LPT+K+K       NN ++       
Sbjct  286  ATICCCLPCIVSILGIQEDF-SPTRGASREIINALPTFKFKSKKTGNVNNQEISASEGGV  344

Query  371  ------------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         E+  CCICLA++ D +E+R+LPC HVFH+ CVD+WL+I + CPLCK 
Sbjct  345  LAAGTAKERVISGEDAVCCICLAKFADDDELRELPCLHVFHVECVDKWLKINASCPLCKT  404

Query  227  DLA  219
            +++
Sbjct  405  EIS  407



>ref|XP_006465441.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Citrus sinensis]
 ref|XP_006465442.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Citrus sinensis]
Length=423

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  229  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  287

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP--DLEN-------  369
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K   N    D +N       
Sbjct  288  ATICCCLPCIISVLGIREDY-SQTRGATAETINALPTYKFKSKKNGNLNDQDNSGGTEGG  346

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+L CSHVFH++CVD+WL+I + CPLCK
Sbjct  347  VLAAGTEKERMISGEDAVCCICLAKYVDDDELRELICSHVFHVDCVDKWLKINASCPLCK  406

Query  230  KDLA  219
             +++
Sbjct  407  SEIS  410



>ref|XP_010254214.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254215.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254216.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254217.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254218.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254219.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254220.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010254221.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
Length=419

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 111/187 (59%), Gaps = 28/187 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  231  LVDHFKMALDCFFAVWFVIGNVWIFGGHSSS-SDAPNLYRLCIVFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-QVCNNPD-----------  378
              +CCC+P + S LG+  ++ +  RGA++E ++SLPT+K+K +   N D           
Sbjct  290  ATICCCLPCIISILGFREDL-TQTRGATSESINSLPTYKFKLKKTQNRDGRETVNSEGVG  348

Query  377  --------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCP  240
                          +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CP
Sbjct  349  EGGVLAAGTEKERVISGEDAVCCICLARYANNDELRELPCSHFFHRECVDKWLKINALCP  408

Query  239  LCKKDLA  219
            LCK D+ 
Sbjct  409  LCKSDVG  415



>ref|XP_010915017.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Elaeis 
guineensis]
 ref|XP_010915018.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Elaeis 
guineensis]
 ref|XP_010915019.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Elaeis 
guineensis]
Length=443

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 114/185 (62%), Gaps = 27/185 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  230  LVDHFKMALDCFFAVWFVVGNVWIFGGRSSS-HDAPNLYGLCIVFLTFSCIGYAMPFILC  288

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----QVCNNPDLENENPE-  357
             ++CCC+P + S +G+  +M S  RGA++E +++LPT+K+K    Q  +  ++ +EN   
Sbjct  289  AMICCCLPCIISIMGFREDM-SHNRGATSESINALPTYKFKLKRLQNGDESEINSENQGN  347

Query  356  --------------------CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                                CCICLA Y + +E+R+LPC+H FH+ CVD+WL+I + CPL
Sbjct  348  GGILAAGTDKERMISAEDAVCCICLANYVNNDELRELPCTHHFHMECVDKWLKINALCPL  407

Query  236  CKKDL  222
            CK ++
Sbjct  408  CKSEV  412



>ref|XP_007161262.1| hypothetical protein PHAVU_001G055600g [Phaseolus vulgaris]
 gb|ESW33256.1| hypothetical protein PHAVU_001G055600g [Phaseolus vulgaris]
Length=415

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 111/181 (61%), Gaps = 22/181 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  LA++ + Y+ PFIL 
Sbjct  207  LVEYFKISLDCFFAVWFVVGNVWIFGGR-SSADEAPNLYRLCIVFLAFSCIGYAMPFILC  265

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPE-----  357
              +CCC+P + S LG   +M    RGA++E +++LPT+K+K   N  + E  + E     
Sbjct  266  STICCCLPCIISILGVREDMPQ-NRGATSESINALPTYKFKMKKNKKNGEGNSTEGGVVA  324

Query  356  ---------------CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
                           CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I S CPLCK D 
Sbjct  325  AGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINSLCPLCKSDA  384

Query  221  A  219
             
Sbjct  385  G  385



>gb|KEH35942.1| zinc finger, C3HC4 type (RING finger) protein, putative [Medicago 
truncatula]
Length=392

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 111/186 (60%), Gaps = 26/186 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +T ++LFFAIWFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  180  LMEYFKTTLDLFFAIWFVIGNVWIFGGH-ASANDAPNLYRLCIVFLTFSCIGYAMPFILC  238

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENEN-------  363
            + +CCC+P + S LG   ++    RGA++E +++LPT  +K + +  + E++N       
Sbjct  239  LTICCCLPCIISTLGVTEDLTQT-RGATSESINALPTHIFKTMKSKSNDESDNIPVVIEG  297

Query  362  -----------------PECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                               CCIC+A Y + +E+R+LPCSH+FH  CVD+WL+I + CPLC
Sbjct  298  GIVAEGTEKERMISGEDAVCCICIANYENDDELRELPCSHLFHKECVDKWLKINALCPLC  357

Query  233  KKDLAR  216
            K ++  
Sbjct  358  KSEIGE  363



>ref|XP_006427099.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 ref|XP_006427100.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 ref|XP_006427102.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|ESR40339.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|ESR40340.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|ESR40342.1| hypothetical protein CICLE_v10025899mg [Citrus clementina]
 gb|KDO58186.1| hypothetical protein CISIN_1g037568mg [Citrus sinensis]
Length=423

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  229  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  287

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP--DLEN-------  369
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K   N    D +N       
Sbjct  288  ATICCCLPCIISVLGIREDY-SQTRGATAETINALPTYKFKSKKNGNLNDQDNSGGTEGG  346

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+L CSHVFH++CVD+WL+I + CPLCK
Sbjct  347  VLAAGTEKERMISGEDAVCCICLAKYVDDDELRELICSHVFHVDCVDKWLKINASCPLCK  406

Query  230  KDLA  219
             ++ 
Sbjct  407  SEIG  410



>ref|XP_009377510.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Pyrus x bretschneideri]
 ref|XP_009377511.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Pyrus x bretschneideri]
 ref|XP_009377512.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Pyrus x bretschneideri]
Length=417

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 109/186 (59%), Gaps = 27/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  207  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAADAPNLYRLCIVFLTFSCIGYAMPFILC  265

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++    RGA+ E ++SLPT+K+K   N N D           
Sbjct  266  ATICCCLPCIISVLGFREDLAQA-RGATPESINSLPTYKFKIKKNKNGDNRDGGSSGATE  324

Query  377  -------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                         +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPL
Sbjct  325  GGFVAVGTEKERAISGEDAVCCICLAKYSNNDELRELPCSHFFHKECVDKWLKINASCPL  384

Query  236  CKKDLA  219
            CK ++ 
Sbjct  385  CKSEVG  390



>ref|XP_010670760.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 115/197 (58%), Gaps = 28/197 (14%)
 Frame = -2

Query  731  QRSXEGSSVQM--------VEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLC  576
             R+  G SV M        VE  +  ++ FFAIWFV+GNVW+F     S   AP L+ LC
Sbjct  210  NRNATGQSVGMRNARLKAAVEYFKMGLDCFFAIWFVVGNVWIFGGH-ASSSEAPNLYRLC  268

Query  575  ISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-  399
            I  L ++ + Y+ PFIL   +CCC+P + S LG+  ++    RGA++E +++LPT+K+K 
Sbjct  269  IVFLIFSCIGYAMPFILCATICCCLPCIISVLGFREDLNQT-RGATSESINALPTYKFKL  327

Query  398  QVCNNPD-----------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD  270
            +   N D                 +  E+  CCICLA+Y + +E+R+L CSH+FH  CVD
Sbjct  328  KKSRNSDGVGESGVVAAGTEKERAISGEDAVCCICLAKYVNNDELRELTCSHLFHKECVD  387

Query  269  QWLRIISCCPLCKKDLA  219
            +WL+I + CPLCK ++ 
Sbjct  388  KWLKINALCPLCKNEVG  404



>ref|XP_006465440.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Citrus sinensis]
Length=425

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  231  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP--DLEN-------  369
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K   N    D +N       
Sbjct  290  ATICCCLPCIISVLGIREDY-SQTRGATAETINALPTYKFKSKKNGNLNDQDNSGGTEGG  348

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+L CSHVFH++CVD+WL+I + CPLCK
Sbjct  349  VLAAGTEKERMISGEDAVCCICLAKYVDDDELRELICSHVFHVDCVDKWLKINASCPLCK  408

Query  230  KDLA  219
             +++
Sbjct  409  SEIS  412



>ref|XP_011019728.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Populus euphratica]
 ref|XP_011019729.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Populus euphratica]
 ref|XP_011019730.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Populus euphratica]
Length=429

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 108/183 (59%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  224  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAEEAPNLYRLCIVFLTFSCIGYAMPFILC  282

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG+  ++ +  RGA+ E + +LPT+K+K + N               
Sbjct  283  ATICCCLPCIISVLGFREDL-TQTRGATTESIDALPTYKFKLIKNRNGEDSSAGASDGGV  341

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA++ + +E+R+LPCSH FH  CVD+WL+I + CPLCK 
Sbjct  342  VAAGTEKERVISGEDAVCCICLAKFANNDELRELPCSHFFHKECVDKWLKINASCPLCKS  401

Query  227  DLA  219
            ++ 
Sbjct  402  EVG  404



>ref|XP_011081882.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011081883.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011081884.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011081885.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=426

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 110/190 (58%), Gaps = 26/190 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  224  LIEYFKMALDCFFAVWFVVGNVWIFGGHSSS-NEAPNLYRLCIVFLTFSCIGYAMPFILC  282

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPE-----  357
              +CCC+P + S LG+  ++ S  RGA+ + ++SLPT+K+K   N    + +N       
Sbjct  283  ATICCCLPCIISVLGFREDL-SQNRGATQDSINSLPTYKFKVKKNKSGSDKDNSSSAGEG  341

Query  356  -------------------CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                               CCICLA+Y   +E+R++PCSH FH +CVD+WL+I + CPLC
Sbjct  342  GIVAAGTEKERAISGEDAVCCICLAKYVHNDELREMPCSHFFHKDCVDKWLKINATCPLC  401

Query  233  KKDLAR*MKS  204
            K ++   M S
Sbjct  402  KAEVGETMLS  411



>ref|XP_002324833.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF03398.1| zinc finger family protein [Populus trichocarpa]
Length=434

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFA+WFV+GNVW+F +   S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  224  LLEYFKMALDCFFAVWFVVGNVWIFGSH-SSAEEAPNLYRLCIVFLTFSCIGYAMPFILC  282

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S LG+  ++ +  RGA+ E + +LPT K+K + N               
Sbjct  283  ATICCCLPCIISILGFREDL-TQTRGATPESIDALPTHKFKLIKNRNGEDSSSGAADGGI  341

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLCK 
Sbjct  342  VAAGTEKERVISGEDAVCCICLAKYANNDELRELPCSHFFHKDCVDKWLKINASCPLCKS  401

Query  227  DLA  219
            ++ 
Sbjct  402  EVG  404



>ref|XP_009339006.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Pyrus 
x bretschneideri]
Length=423

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F         APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SVPSDAPKLYRLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK---QVCNNP----------  381
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K    V N+           
Sbjct  286  ATICCCLPCIISVLGFREDL-SQARGATVESINALPTYKFKLKENVTNDDQEGSPGSEGG  344

Query  380  ----------DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                      ++  ++  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  345  LLAAGTEKEREISGDDAVCCICLAKYADDDELRELPCLHVFHVECVDKWLKINASCPLCK  404

Query  230  KDLA  219
             ++ 
Sbjct  405  SEVG  408



>ref|XP_006465439.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Citrus sinensis]
Length=437

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  243  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  301

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP--DLEN-------  369
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K   N    D +N       
Sbjct  302  ATICCCLPCIISVLGIREDY-SQTRGATAETINALPTYKFKSKKNGNLNDQDNSGGTEGG  360

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  CCICLA+Y D +E+R+L CSHVFH++CVD+WL+I + CPLCK
Sbjct  361  VLAAGTEKERMISGEDAVCCICLAKYVDDDELRELICSHVFHVDCVDKWLKINASCPLCK  420

Query  230  KDLA  219
             +++
Sbjct  421  SEIS  424



>ref|NP_001048342.1| Os02g0787500 [Oryza sativa Japonica Group]
 dbj|BAF10256.1| Os02g0787500, partial [Oryza sativa Japonica Group]
Length=342

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 108/178 (61%), Gaps = 24/178 (13%)
 Frame = -2

Query  686  RTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCC  507
            +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CC
Sbjct  143  KMALDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICC  201

Query  506  CVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------VCNNP  381
            C+P + S +G+  +  +  RGA++E ++SLPT+K+K                   V    
Sbjct  202  CLPCIISVMGFREDTNNT-RGATSESINSLPTYKFKTKKRRHSSGNEAEGQDGGIVAAGT  260

Query  380  D----LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            D    L  E+  CCICLA+Y   +E+R+LPC+H FH  CVD+WL+I + CPLCK ++A
Sbjct  261  DKERSLSAEDAVCCICLAKYAHNDELRELPCTHCFHKECVDKWLKINALCPLCKSEIA  318



>gb|KJB83263.1| hypothetical protein B456_013G238400 [Gossypium raimondii]
Length=456

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 107/185 (58%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L  + + Y+ PFIL 
Sbjct  232  LVEYFKMILDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCIVFLTISCIGYAIPFILC  290

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++ S  RGA+ E + +LPT+K+K   N N D           
Sbjct  291  ATICCCLPCIISVLGFREDL-SHARGATPESIEALPTYKFKVKKNRNGDGKDVNSGASEA  349

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y + EE+R+LPCSH  H  CVD+WL+I + CPLC
Sbjct  350  GVVAAGTEKERIISGEDAVCCICLAKYTNNEELRELPCSHFMHKECVDKWLKINASCPLC  409

Query  233  KKDLA  219
            K D+ 
Sbjct  410  KNDIG  414



>ref|XP_006412451.1| hypothetical protein EUTSA_v10025242mg [Eutrema salsugineum]
 gb|ESQ53904.1| hypothetical protein EUTSA_v10025242mg [Eutrema salsugineum]
Length=435

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  215  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCLVFLTFSCIGYAMPFILC  273

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  274  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGDGNGSSNSEGG  332

Query  398  ----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                   N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  333  VVAAGTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  392

Query  230  KDLA  219
             ++ 
Sbjct  393  SEVG  396



>ref|XP_009339004.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339005.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Pyrus 
x bretschneideri]
Length=436

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F         APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  240  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SVPSDAPKLYRLCIVFLTFSCIGYAMPFILC  298

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK---QVCNNP----------  381
              +CCC+P + S LG+  ++ S  RGA+ E +++LPT+K+K    V N+           
Sbjct  299  ATICCCLPCIISVLGFREDL-SQARGATVESINALPTYKFKLKENVTNDDQEGSPGSEGG  357

Query  380  ----------DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                      ++  ++  CCICLA+Y D +E+R+LPC HVFH+ CVD+WL+I + CPLCK
Sbjct  358  LLAAGTEKEREISGDDAVCCICLAKYADDDELRELPCLHVFHVECVDKWLKINASCPLCK  417

Query  230  KDLA  219
             ++ 
Sbjct  418  SEVG  421



>ref|XP_007225629.1| hypothetical protein PRUPE_ppa005884mg [Prunus persica]
 gb|EMJ26828.1| hypothetical protein PRUPE_ppa005884mg [Prunus persica]
Length=439

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 27/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  226  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCIVFLTFSCIGYAMPFILC  284

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++ +  RGA+ E +++LPT+K+K   N N D           
Sbjct  285  ATICCCLPCIISVLGFREDL-TQARGATPESINALPTYKFKLKKNKNSDNRDSSSAGVSE  343

Query  377  -------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                         +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPL
Sbjct  344  GGVVAAGTEKERVISGEDAVCCICLAKYANNDELRELPCSHFFHKECVDKWLKINASCPL  403

Query  236  CKKDLA  219
            CK ++ 
Sbjct  404  CKSEVG  409



>gb|KJB83264.1| hypothetical protein B456_013G238400 [Gossypium raimondii]
 gb|KJB83265.1| hypothetical protein B456_013G238400 [Gossypium raimondii]
Length=468

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 107/185 (58%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L  + + Y+ PFIL 
Sbjct  232  LVEYFKMILDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCIVFLTISCIGYAIPFILC  290

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++ S  RGA+ E + +LPT+K+K   N N D           
Sbjct  291  ATICCCLPCIISVLGFREDL-SHARGATPESIEALPTYKFKVKKNRNGDGKDVNSGASEA  349

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y + EE+R+LPCSH  H  CVD+WL+I + CPLC
Sbjct  350  GVVAAGTEKERIISGEDAVCCICLAKYTNNEELRELPCSHFMHKECVDKWLKINASCPLC  409

Query  233  KKDLA  219
            K D+ 
Sbjct  410  KNDIG  414



>ref|XP_006356611.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=421

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 108/179 (60%), Gaps = 21/179 (12%)
 Frame = -2

Query  698  VEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFV  519
            VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL  
Sbjct  225  VEYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTFSCIGYAMPFILCA  283

Query  518  VLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD-------------  378
             +CCC+P + S +G+  ++ +  +GA+ E ++SLPT+K+K   N                
Sbjct  284  TICCCLPCIISVMGFREDL-TQNKGATPESINSLPTYKFKVKKNKSGNKEAAEGGVVAAG  342

Query  377  ------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                  +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLCK ++ 
Sbjct  343  TDKERVISGEDAACCICLAKYVNNDELRELPCSHFFHKDCVDKWLKINNSCPLCKAEVG  401



>ref|XP_006648026.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Oryza 
brachyantha]
Length=399

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 108/176 (61%), Gaps = 22/176 (13%)
 Frame = -2

Query  686  RTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCC  507
            +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CC
Sbjct  202  KMALDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICC  260

Query  506  CVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ----------------VCNNPDL  375
            C+P + S +G+  +  +  RGA++E ++SLPT+K+K                 V    D 
Sbjct  261  CLPCIISVMGFREDTNNT-RGATSESINSLPTYKFKTKKRRHGNEAEGQDGGIVAAGTDK  319

Query  374  EN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            E     E+  CCICLA+Y   +E+R+LPC+H FH  CVD+WL+I + CPLCK ++A
Sbjct  320  ERSLSAEDAVCCICLAKYAHNDELRELPCTHCFHKECVDKWLKINALCPLCKSEIA  375



>gb|KHG19351.1| E3 ubiquitin ligase RIE1 -like protein [Gossypium arboreum]
Length=453

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 119/209 (57%), Gaps = 29/209 (14%)
 Frame = -2

Query  764  DEFSAVXDIEQQRSXEGSSVQ---MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP  594
            D  +A  +    +S   SS +   +VE  +  ++ FFA+WFV+GNVW+F     S   AP
Sbjct  198  DHHNATTNSRGGQSAGVSSARIKALVEYFKMVLDCFFAVWFVVGNVWIFGGH-SSANEAP  256

Query  593  KLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP  414
             ++ LCI  LA + + Y+ PFIL   +CCC+P + S LG+  ++ S  RGA++E +++LP
Sbjct  257  NMYRLCIVFLAISCIGYAMPFILCATICCCLPCIISVLGFREDL-SQTRGATSESINALP  315

Query  413  TWKYK-QVCNNPD-----------------------LENENPECCICLAQYRDKEEMRQL  306
            T+K+K +   N D                       +  E+  CCICLA+Y + +E+R+L
Sbjct  316  TYKFKVKKSRNGDGREINLGAGEGGVVAAGTEKERVISGEDAICCICLAKYANNDELREL  375

Query  305  PCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            PCSH  H  CVD+WL+I + CPLCK ++ 
Sbjct  376  PCSHFMHKECVDKWLKINASCPLCKSEVG  404



>ref|XP_008219854.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Prunus mume]
Length=439

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 27/186 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  226  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCIVFLTFSCIGYAMPFILC  284

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG+  ++ +  RGA+ E +++LPT+K+K   N N D           
Sbjct  285  ATICCCLPCIISVLGFREDL-TQARGATPESINALPTYKFKLKKNKNSDNRDSSSAGVSE  343

Query  377  -------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPL  237
                         +  E+  CCICLA+Y + +E+R+LPCSH FH  CVD+WL+I + CPL
Sbjct  344  GGVVAAGTEKERVISGEDAVCCICLAKYSNNDELRELPCSHFFHKECVDKWLKINASCPL  403

Query  236  CKKDLA  219
            CK ++ 
Sbjct  404  CKSEVG  409



>gb|EAY87799.1| hypothetical protein OsI_09219 [Oryza sativa Indica Group]
 gb|EAZ24878.1| hypothetical protein OsJ_08658 [Oryza sativa Japonica Group]
Length=398

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 108/178 (61%), Gaps = 24/178 (13%)
 Frame = -2

Query  686  RTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCC  507
            +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CC
Sbjct  199  KMALDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICC  257

Query  506  CVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------VCNNP  381
            C+P + S +G+  +  +  RGA++E ++SLPT+K+K                   V    
Sbjct  258  CLPCIISVMGFREDTNNT-RGATSESINSLPTYKFKTKKRRHSSGNEAEGQDGGIVAAGT  316

Query  380  DLEN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
            D E     E+  CCICLA+Y   +E+R+LPC+H FH  CVD+WL+I + CPLCK ++A
Sbjct  317  DKERSLSAEDAVCCICLAKYAHNDELRELPCTHCFHKECVDKWLKINALCPLCKSEIA  374



>gb|KHG22085.1| hypothetical protein F383_26605 [Gossypium arboreum]
Length=420

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 110/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QVCNNPDLE--------  372
              +CCC+P + S LG   +  S  RGA+ E +++LPT+K+K  +  N  D E        
Sbjct  286  ATICCCLPCIISILGIQEDF-SPTRGATREIINALPTFKFKSKKTGNVNDQEISTSEGGV  344

Query  371  ------------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         E+  CCICLA++ D +E+R+LPC HVFH+ CVD+WL+I + CPLCK 
Sbjct  345  LAAGTAKERVISGEDAVCCICLAKFADNDELRELPCLHVFHVECVDKWLKINASCPLCKT  404

Query  227  DLA  219
            ++ 
Sbjct  405  EIG  407



>ref|XP_010048264.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Eucalyptus 
grandis]
 ref|XP_010048265.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Eucalyptus 
grandis]
 ref|XP_010048266.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Eucalyptus 
grandis]
 gb|KCW80469.1| hypothetical protein EUGRSUZ_C01814 [Eucalyptus grandis]
 gb|KCW80470.1| hypothetical protein EUGRSUZ_C01814 [Eucalyptus grandis]
 gb|KCW80471.1| hypothetical protein EUGRSUZ_C01814 [Eucalyptus grandis]
Length=418

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  ++ FFAIWFV+GNVW+F     S   AP ++ LCI  L ++ + Y+ PFIL 
Sbjct  225  LMEYFKMGLDCFFAIWFVVGNVWIFGGH-ASANDAPNMYRLCIVFLTFSCIGYAMPFILC  283

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK--QVCNNPDLEN-------  369
              +CCC+P + S LG+  ++ S  RGA++E + +LPT+K+K  +  N+ D EN       
Sbjct  284  ATICCCLPCIISILGFREDL-SRTRGATDEAIHALPTYKFKLKKNRNSSDTENSASGEGV  342

Query  368  -------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                         ++  CCICLA+Y + +E+R+LPC+H FH  CVD+WL+I + CPLCK 
Sbjct  343  IAAGTERERVISGDDAVCCICLAKYANNDELRELPCNHFFHKECVDKWLKINALCPLCKS  402

Query  227  DLA  219
            ++ 
Sbjct  403  EVG  405



>ref|XP_010062440.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Eucalyptus 
grandis]
Length=356

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 111/186 (60%), Gaps = 26/186 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  162  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  220

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG   +  S  RGA++E +++LP +K+K   + N D           
Sbjct  221  ATICCCLPCIMSVLGIREDF-SQTRGATSESINALPIYKFKVKQDLNADGEEFITGGSEG  279

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        L  E+  CCICL++Y D +E+++LPC HVFH+ C+D+WL+I + CPLC
Sbjct  280  GVLAPGTEKERFLSGEDAVCCICLSRYADNDELKELPCHHVFHVECIDKWLKINASCPLC  339

Query  233  KKDLAR  216
            K +++ 
Sbjct  340  KSEISE  345



>ref|NP_194986.2| C3H4 type zinc finger protein [Arabidopsis thaliana]
 gb|AAL66968.1| unknown protein [Arabidopsis thaliana]
 gb|AAL91189.1| putative protein [Arabidopsis thaliana]
 gb|AAM20289.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86087.1| C3H4 type zinc finger protein [Arabidopsis thaliana]
Length=453

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  227  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  286  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSNGDDNGSSTSEGG  344

Query  398  ----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                   N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  345  VVAAGTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  404

Query  230  KDLA  219
             ++ 
Sbjct  405  SEVG  408



>gb|KHN44137.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=419

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 110/185 (59%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP+L+ LCI  L ++ + Y+ PFIL 
Sbjct  228  LVDHFKMALDCFFAVWFVVGNVWIFGGHT-SPSDAPQLYRLCIVFLTFSCIGYAMPFILC  286

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG   +  S  RGA+ E +++LP +K+K   N N D           
Sbjct  287  ATICCCLPCIISVLGIREDF-SQNRGATVESINALPIFKFKLKNNENGDDQDANSAIDEG  345

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y D +E+R+LPCSHVFH+ CVD+WL+I + CPLC
Sbjct  346  GILAAGTEKERMISGEDAVCCICLAKYADDDELRELPCSHVFHVECVDKWLKINATCPLC  405

Query  233  KKDLA  219
            K ++ 
Sbjct  406  KNEVG  410



>ref|XP_003543658.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Glycine max]
Length=419

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 110/185 (59%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP+L+ LCI  L ++ + Y+ PFIL 
Sbjct  228  LVDHFKMALDCFFAVWFVVGNVWIFGGHT-SPSDAPQLYRLCIVFLTFSCIGYAMPFILC  286

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG   +  S  RGA+ E +++LP +K+K   N N D           
Sbjct  287  ATICCCLPCIISVLGIREDF-SQNRGATVESINALPIFKFKLKNNENGDDQDANSAIDEG  345

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y D +E+R+LPCSHVFH+ CVD+WL+I + CPLC
Sbjct  346  GILAAGTEKERMISGEDAVCCICLAKYADDDELRELPCSHVFHVECVDKWLKINATCPLC  405

Query  233  KKDLA  219
            K ++ 
Sbjct  406  KNEVG  410



>ref|XP_004245237.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
Length=421

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 108/179 (60%), Gaps = 21/179 (12%)
 Frame = -2

Query  698  VEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFV  519
            VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL  
Sbjct  225  VEYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTFSCIGYAMPFILCA  283

Query  518  VLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD-------------  378
             +CCC+P + S +G+  ++ +  +GA+ E +++LPT+K+K   N                
Sbjct  284  TICCCLPCIISVMGFREDL-TQNKGATPESINALPTYKFKVKKNKSGNKEAAEGGVVAAG  342

Query  377  ------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                  +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLCK ++ 
Sbjct  343  TDKERVISGEDAACCICLAKYVNNDELRELPCSHFFHKDCVDKWLKINNSCPLCKAEVG  401



>ref|XP_010437885.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=458

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 108/184 (59%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  231  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCLVFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  290  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGDDNGSTTSEGG  348

Query  395  -VCNNPDLE----NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
             V    D E     E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  349  VVAAGTDKERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  408

Query  230  KDLA  219
             ++ 
Sbjct  409  SEVG  412



>gb|KJB53919.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53920.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53921.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53922.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53923.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53926.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53927.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
Length=451

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 110/185 (59%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP ++ LCI  LA + + Y+ PFIL 
Sbjct  222  LVEYFKMVLDCFFAVWFVVGNVWIFGGH-SSANEAPNMYRLCIVFLAISCIGYAMPFILC  280

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-QVCNNPD-----------  378
              +CCC+P + S LG+  ++ S  RGA++E +++LPT+K+K +   N D           
Sbjct  281  ATICCCLPCIISVLGFREDL-SQTRGATSESINALPTYKFKAKKSRNGDGREINLGAGEG  339

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y + +E+R+LPCSH  H  CVD+WL+I + CPLC
Sbjct  340  GVVAAGTEKERVISGEDAICCICLAKYANNDELRELPCSHFMHKECVDKWLKINASCPLC  399

Query  233  KKDLA  219
            K ++ 
Sbjct  400  KSEVG  404



>ref|XP_009775580.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Nicotiana 
sylvestris]
Length=422

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 109/180 (61%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  225  LVDYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTFSCIGYAMPFILC  283

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S +G+  ++ +  +GA+ E +++LPT+K+K   N               
Sbjct  284  ATICCCLPCIISVMGFREDL-TQNKGATPESINALPTYKFKVKKNKSGYKEAAEGGIVAA  342

Query  377  -------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                   +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLCK ++ 
Sbjct  343  GTEKERVISGEDAACCICLAKYVNNDELRELPCSHFFHKDCVDKWLKINNTCPLCKAEVG  402



>ref|XP_006283708.1| hypothetical protein CARUB_v10004779mg [Capsella rubella]
 gb|EOA16606.1| hypothetical protein CARUB_v10004779mg [Capsella rubella]
Length=454

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 108/184 (59%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  226  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  284

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  285  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGDDNGSSTSEGG  343

Query  395  -VCNNPDLE----NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
             V    D E     E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  344  VVAAGTDKERTISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  403

Query  230  KDLA  219
             ++ 
Sbjct  404  SEVG  407



>emb|CDX75258.1| BnaA01g04440D [Brassica napus]
Length=417

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 107/185 (58%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  189  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  247

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  248  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGSDDNGSSTGEG  306

Query  398  -----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                    N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  307  GVVAAGTENERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLC  366

Query  233  KKDLA  219
            K ++ 
Sbjct  367  KSEVG  371



>ref|XP_004302944.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  227  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN--NPDLEN-------  369
              +CCC+P + S LG+  +  S  RGA+ E ++SLPT+K+K   N  N DL++       
Sbjct  286  ATICCCLPCIISVLGFREDH-SQTRGATTESINSLPTYKFKLKRNEINDDLDSNTTAEGG  344

Query  368  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                          E+  C ICLA Y D +E+R+L C HVFH+ CVD+WL+I + CPLCK
Sbjct  345  LLAAGTEKERAILEEDAVCSICLANYSDNDELRELTCLHVFHVECVDKWLKINASCPLCK  404

Query  230  KDLA  219
             ++ 
Sbjct  405  SEVG  408



>ref|XP_004954169.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Setaria 
italica]
Length=406

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 24/178 (13%)
 Frame = -2

Query  686  RTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCC  507
            +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CC
Sbjct  207  KMALDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICC  265

Query  506  CVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ----------------------V  393
            C+P + S +G+  +  +  RGA++E +++LPT+K+K                        
Sbjct  266  CLPCIISVMGFREDTNNT-RGATSESINALPTYKFKTKKRRHGSGSEAEGQEGGIVAAGT  324

Query  392  CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                 L  E+  CCICLA+Y   +E+R+LPCSH FH +CVD+WL+I + CPLCK ++A
Sbjct  325  EKERSLSAEDAVCCICLAKYAHNDELRELPCSHCFHKDCVDKWLKINALCPLCKSEIA  382



>ref|XP_010432691.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=460

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 108/184 (59%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  232  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  290

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  291  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGDDNGSTTSEGG  349

Query  395  -VCNNPDLE----NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
             V    D E     E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  350  VVAAGTDKERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  409

Query  230  KDLA  219
             ++ 
Sbjct  410  SEVG  413



>ref|XP_010447366.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=461

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 108/184 (59%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  233  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSASEAPNLYRLCLVFLTFSCIGYAMPFILC  291

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  292  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGDDNGSSTSEGG  350

Query  395  -VCNNPDLE----NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
             V    D E     E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  351  VVAAGTDKERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  410

Query  230  KDLA  219
             ++ 
Sbjct  411  SEVG  414



>ref|XP_002869261.1| hypothetical protein ARALYDRAFT_328473 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45520.1| hypothetical protein ARALYDRAFT_328473 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  227  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  286  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGDDNGSSTSEGG  344

Query  398  ----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                   N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  345  VVAAGTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  404

Query  230  KDLA  219
             ++ 
Sbjct  405  SEVG  408



>emb|CDX68865.1| BnaC01g05880D [Brassica napus]
Length=421

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 107/185 (58%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  193  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  251

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  252  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSSGGDENGSSTGEG  310

Query  398  -----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                    N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLC
Sbjct  311  GVVAAGTENERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLC  370

Query  233  KKDLA  219
            K ++ 
Sbjct  371  KSEVG  375



>ref|XP_009586726.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Nicotiana tomentosiformis]
 ref|XP_009586727.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Nicotiana tomentosiformis]
 ref|XP_009586728.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Nicotiana tomentosiformis]
Length=422

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 109/180 (61%), Gaps = 21/180 (12%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  225  LVDYFKMALDCFFAVWFVVGNVWIFGGHSSS-SEAPNLYRLCIVFLTFSCIGYAMPFILC  283

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
              +CCC+P + S +G+  ++ +  +GA+ E +++LPT+K+K   N               
Sbjct  284  ATICCCLPCIISVMGFREDL-TQNKGATPESINALPTYKFKVKKNKSGNKEAAEGGIVAA  342

Query  377  -------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA  219
                   +  E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLCK ++ 
Sbjct  343  GTEKERVISGEDAACCICLAKYVNNDELRELPCSHFFHKDCVDKWLKINNTCPLCKAEVG  402



>emb|CAA18601.1| putative protein [Arabidopsis thaliana]
 emb|CAB79977.1| putative protein [Arabidopsis thaliana]
Length=495

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 107/184 (58%), Gaps = 25/184 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LC+  L ++ + Y+ PFIL 
Sbjct  227  IVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILC  285

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-------------------  399
              +CCC+P + S LGY  ++ +  RGA+ E +++LPT K+K                   
Sbjct  286  TTICCCLPCIISILGYREDL-TQPRGATPESINALPTHKFKLKKSRSNGDDNGSSTSEGG  344

Query  398  ----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                   N   +  E+  CCICLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  345  VVAAGTDNERAISGEDAVCCICLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCK  404

Query  230  KDLA  219
             ++ 
Sbjct  405  SEVG  408



>ref|XP_007150683.1| hypothetical protein PHAVU_005G172800g [Phaseolus vulgaris]
 gb|ESW22677.1| hypothetical protein PHAVU_005G172800g [Phaseolus vulgaris]
Length=425

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 111/185 (60%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   AP+L+ LCI  L ++ + Y+ PFIL 
Sbjct  228  LVDHFKMALDCFFAVWFVVGNVWIFGGHT-SPSDAPQLYRLCIVFLTFSCIGYAMPFILC  286

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----QVCNNPD--------  378
              +CCC+P + S LG   +  S  RGA+ E +++LP +K+K    + C + D        
Sbjct  287  ATICCCLPCIISVLGIREDF-SQNRGATVESINALPIFKFKLKNNENCGDQDVNAAIDEG  345

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        +  E+  CCICLA+Y D +E+R+LPCSHVFH+ CVD+WL+I + CPLC
Sbjct  346  GVLAAGTEKERVISGEDAVCCICLAKYADDDELRELPCSHVFHVVCVDKWLKINASCPLC  405

Query  233  KKDLA  219
            K ++ 
Sbjct  406  KTEVG  410



>ref|XP_003588675.1| RING finger protein [Medicago truncatula]
 gb|AES58926.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=403

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 113/183 (62%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  LA++ + Y+ PFIL 
Sbjct  206  LVEYFKISLDCFFAVWFVVGNVWIFGGR-SSAAVAPNLYRLCIVFLAFSCIGYAMPFILC  264

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV---------CNNPD---  378
              +CCC+P + S LG   ++ S  RGA++E +++LPT+K+K             N D   
Sbjct  265  STICCCLPCIISILGVREDL-SQNRGATSESINALPTYKFKMKKNKKNSENNSANIDGGT  323

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCICLA+Y + +E+R+LPCSH+FH +CVD+WL+I + CPLCK 
Sbjct  324  VAAGTEKERVISGEDAVCCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKS  383

Query  227  DLA  219
            ++ 
Sbjct  384  EVG  386



>ref|XP_010062439.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69582.1| hypothetical protein EUGRSUZ_F03004 [Eucalyptus grandis]
Length=423

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +V+  +  ++ FFA+WFV+GNVW+F     S   APKL+ LCI  L ++ + Y+ PFIL 
Sbjct  229  LVDHFKMALDCFFAVWFVVGNVWIFGGH-SSPSDAPKLYRLCIVFLTFSCIGYAMPFILC  287

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN-NPD-----------  378
              +CCC+P + S LG   +  S  RGA++E +++LP +K+K   + N D           
Sbjct  288  ATICCCLPCIMSVLGIREDF-SQTRGATSESINALPIYKFKVKQDLNADGEEFITGGSEG  346

Query  377  ------------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                        L  E+  CCICL++Y D +E+++LPC HVFH+ C+D+WL+I + CPLC
Sbjct  347  GVLAPGTEKERFLSGEDAVCCICLSRYADNDELKELPCHHVFHVECIDKWLKINASCPLC  406

Query  233  KKDLA  219
            K +++
Sbjct  407  KSEIS  411



>ref|XP_001765270.1| predicted protein [Physcomitrella patens]
 gb|EDQ69998.1| predicted protein, partial [Physcomitrella patens]
Length=300

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 109/198 (55%), Gaps = 33/198 (17%)
 Frame = -2

Query  737  EQQRSXEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAW  558
             +QRS  G   ++   C      FFAIWFV+GNVW+F     +   AP L+ LCI LL +
Sbjct  110  SRQRSGVGQVFKIALDC------FFAIWFVVGNVWIFGGHSAA-HDAPNLYRLCIVLLTF  162

Query  557  NAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD  378
            + + Y+ PFIL   +CCC+P + + LG+  +     RGAS E +++LPT+K+K   +N  
Sbjct  163  SCIGYAMPFILCATICCCLPCIIALLGFREDQNQ-PRGASQEAIAALPTYKFKAKASNES  221

Query  377  LENENPE-------------------------CCICLAQYRDKEEMRQLPCSHVFHLNCV  273
              N++                           CCICL +Y+D  E+R+L C+H FH+ CV
Sbjct  222  KLNKDGNDSDSEGAWVAAGTEKERWVSADDAVCCICLGKYKDGVELRELVCTHHFHVECV  281

Query  272  DQWLRIISCCPLCKKDLA  219
            D+WL+I + CPLCK D+ 
Sbjct  282  DKWLKINASCPLCKYDIG  299



>ref|XP_004501279.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=396

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 108/183 (59%), Gaps = 24/183 (13%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            ++E  +  V+ FFAIWFV+GNVW+F     S   AP ++ LC+  L ++ V Y+ PFIL 
Sbjct  189  LMEYFKIAVDCFFAIWFVVGNVWIFGGH-SSANEAPNMYRLCVVFLTFSCVGYAMPFILC  247

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN------NPD------  378
            V +CCC+P + S LG   ++ +  RGA+ E +++LPT K+K   N       PD      
Sbjct  248  VTICCCLPCIISTLGVTEDL-TQTRGATTESINALPTHKFKLNRNKSRDESTPDVFEGGV  306

Query  377  ----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK  228
                      +  E+  CCIC+A Y + +++R+LPCSH+FH  CVD WL+I + CPLCK 
Sbjct  307  VAGGTEKERMISGEDAVCCICIANYENNDDLRELPCSHLFHKECVDTWLKINALCPLCKS  366

Query  227  DLA  219
            ++ 
Sbjct  367  EVG  369



>ref|XP_010238065.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Brachypodium distachyon]
Length=384

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 108/189 (57%), Gaps = 29/189 (15%)
 Frame = -2

Query  686  RTCVELFFAIWFVMGNVWVFDTRFGS--FRRAPKLHVLCISLLAWNAVTYSFPFILFVVL  513
            +T V+ FFA+WFV+GNVW+F  R  S   + AP ++ LC++ LA + V Y+ PFI+   +
Sbjct  171  KTAVDCFFAVWFVVGNVWIFGGRGTSSDAQDAPNMYRLCLAFLALSCVGYAVPFIMCAAI  230

Query  512  CCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----------------------  399
            CCC P + S L    ++G   RGA+ E + +LPT+K+K                      
Sbjct  231  CCCFPCLISVLRLQEDLGQT-RGATQELIEALPTYKFKPRRSKNWGLDYASSSENLSEGG  289

Query  398  ----QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                       +  E+  CCICL +Y D +E+R+LPC+H+FH+ CVD+WL+I + CPLCK
Sbjct  290  ILGPGTKKERTVSAEDAVCCICLTKYGDDDELRELPCTHLFHVQCVDKWLKINAVCPLCK  349

Query  230  KDLAR*MKS  204
             D+   ++S
Sbjct  350  TDIGGVVRS  358



>emb|CBI28122.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 106/180 (59%), Gaps = 26/180 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            + +  +  ++ FFA+WFV+GNVW+F     SF  AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  211  LADYYKMALDCFFAVWFVVGNVWIFGGH-SSFTAAPNLYRLCIVFLTFSCIGYAMPFILC  269

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG+  ++  V RGAS E +++LPT+K+K   N               
Sbjct  270  AMICCCLPCIISILGHG-DLSQV-RGASAESINALPTYKFKLKKNGSGNSGEISSGVEGG  327

Query  377  -----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                       +  E+  CCICL +Y D +E+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  328  VVGAGTEKERAISGEDAVCCICLTRYADDDELRELPCSHFFHSECVDKWLKINASCPLCK  387



>ref|XP_002281595.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Vitis vinifera]
 ref|XP_010656373.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Vitis vinifera]
 ref|XP_010656374.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Vitis vinifera]
 ref|XP_010656375.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Vitis vinifera]
 ref|XP_010656376.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Vitis vinifera]
Length=427

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 106/180 (59%), Gaps = 26/180 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            + +  +  ++ FFA+WFV+GNVW+F     SF  AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  231  LADYYKMALDCFFAVWFVVGNVWIFGGH-SSFTAAPNLYRLCIVFLTFSCIGYAMPFILC  289

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG+  ++  V RGAS E +++LPT+K+K   N               
Sbjct  290  AMICCCLPCIISILGHG-DLSQV-RGASAESINALPTYKFKLKKNGSGNSGEISSGVEGG  347

Query  377  -----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                       +  E+  CCICL +Y D +E+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  348  VVGAGTEKERAISGEDAVCCICLTRYADDDELRELPCSHFFHSECVDKWLKINASCPLCK  407



>ref|NP_001169753.1| uncharacterized LOC100383634 [Zea mays]
 ref|XP_008644090.1| PREDICTED: uncharacterized LOC100383634 isoform X1 [Zea mays]
 gb|ACN32065.1| unknown [Zea mays]
 gb|ACN34805.1| unknown [Zea mays]
 gb|AFW73803.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=401

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 106/177 (60%), Gaps = 24/177 (14%)
 Frame = -2

Query  686  RTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCC  507
            +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CC
Sbjct  202  KMALDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICC  260

Query  506  CVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----------------------QV  393
            C+P + S +G+  +  +  RGAS+E +++LPT+K+K                        
Sbjct  261  CLPCIISIMGFREDTNNT-RGASSESINALPTYKFKIKKRRHGSGSETEGQEGGILAAGT  319

Query  392  CNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL  222
                 L  E+  CCICLA+Y   +E+R+LPC+H FH +CVD+WL+I + CPLCK ++
Sbjct  320  DKERSLSAEDAVCCICLAKYAHNDELRELPCAHCFHKDCVDKWLKINALCPLCKSEI  376



>ref|XP_006450563.1| hypothetical protein CICLE_v10008289mg [Citrus clementina]
 ref|XP_006450565.1| hypothetical protein CICLE_v10008289mg [Citrus clementina]
 gb|ESR63803.1| hypothetical protein CICLE_v10008289mg [Citrus clementina]
 gb|ESR63805.1| hypothetical protein CICLE_v10008289mg [Citrus clementina]
Length=447

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 107/185 (58%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  LA + + Y+ PFIL 
Sbjct  224  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSAADAPNLYRLCIVFLAISCIGYAMPFILC  282

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------  396
              +CCC+P + S LG   ++    RGA+ E + +LPT+K+K                   
Sbjct  283  ATICCCLPCIVSILGLREDLAQT-RGATAESIDALPTYKFKLKKSRSSNDRDNSSSVGDG  341

Query  395  --VCNNPDLE----NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
              V    + E     E+  CCICLA+Y + +E+R+LPCSH FH +CVD+WL+I + CPLC
Sbjct  342  GVVAAGTEKERVISGEDAVCCICLAKYANNDELRELPCSHFFHKDCVDKWLKINASCPLC  401

Query  233  KKDLA  219
            K ++ 
Sbjct  402  KSEVG  406



>ref|XP_007013746.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY31365.1| RING/U-box superfamily protein [Theobroma cacao]
Length=446

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 110/185 (59%), Gaps = 26/185 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            +VE  +  ++ FFA+WFV+GNVW+F     S   AP ++ LCI  L ++ + Y+ PFIL 
Sbjct  223  LVEYFKMALDCFFAVWFVVGNVWIFGGH-SSASEAPNMYRLCIVFLTFSCIGYAMPFILC  281

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK----QVCNNPDL-------  375
              +CCC+P + S LG+  ++ S  RGA+ E + +LPT+K+K    + C++ ++       
Sbjct  282  ATICCCLPCIISVLGFREDL-SQARGATPESIDALPTYKFKVKKSRNCDDREIISGAGEG  340

Query  374  -------------ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLC  234
                           E+  CCICLA+Y + +E+R+LPCSH  H  CVD+WL+I + CPLC
Sbjct  341  GVVAAGTEKERAISGEDAVCCICLAKYANNDELRELPCSHFMHKECVDKWLKINASCPLC  400

Query  233  KKDLA  219
            K ++ 
Sbjct  401  KSEVG  405



>ref|XP_006844405.1| hypothetical protein AMTR_s00142p00106560 [Amborella trichopoda]
 gb|ERN06080.1| hypothetical protein AMTR_s00142p00106560 [Amborella trichopoda]
Length=451

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 112/199 (56%), Gaps = 31/199 (16%)
 Frame = -2

Query  740  IEQQRSXEGSSVQMV-EKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLL  564
            I Q R      + M+ +  +  ++ FFA+WFV+GNVW+F     S   AP L+ LCI  L
Sbjct  214  IGQDRVPSNPRLGMIMDHFKMALDCFFAVWFVVGNVWIFGGHSSS-SDAPNLYRLCIVFL  272

Query  563  AWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPT--WKYKQVC  390
             ++ + Y+ PFIL   +CCC+P + S LG+  +  S  RGA+ E ++SLPT  +K K VC
Sbjct  273  TFSCIGYAMPFILCATICCCLPCIISILGFRDDQ-SRTRGATTEAINSLPTCKFKAKGVC  331

Query  389  N-NPDLEN-------------------------ENPECCICLAQYRDKEEMRQLPCSHVF  288
              N + EN                         E+  CCICLA+Y D+EE+R+LPCSH F
Sbjct  332  ERNRERENGEIDSEVGEGGVIAAGTDKERIVSAEDAVCCICLAKYEDEEELRELPCSHCF  391

Query  287  HLNCVDQWLRIISCCPLCK  231
            H+ CVD WL+I   CPLCK
Sbjct  392  HVECVDTWLKINGSCPLCK  410



>ref|XP_010656378.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Vitis vinifera]
Length=394

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 106/180 (59%), Gaps = 26/180 (14%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF  522
            + +  +  ++ FFA+WFV+GNVW+F     SF  AP L+ LCI  L ++ + Y+ PFIL 
Sbjct  198  LADYYKMALDCFFAVWFVVGNVWIFGGH-SSFTAAPNLYRLCIVFLTFSCIGYAMPFILC  256

Query  521  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD------------  378
             ++CCC+P + S LG+  ++  V RGAS E +++LPT+K+K   N               
Sbjct  257  AMICCCLPCIISILGHG-DLSQV-RGASAESINALPTYKFKLKKNGSGNSGEISSGVEGG  314

Query  377  -----------LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK  231
                       +  E+  CCICL +Y D +E+R+LPCSH FH  CVD+WL+I + CPLCK
Sbjct  315  VVGAGTEKERAISGEDAVCCICLTRYADDDELRELPCSHFFHSECVDKWLKINASCPLCK  374



>ref|XP_010238063.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010238064.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Brachypodium distachyon]
Length=415

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 109/194 (56%), Gaps = 29/194 (15%)
 Frame = -2

Query  701  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGS--FRRAPKLHVLCISLLAWNAVTYSFPFI  528
            +    +T V+ FFA+WFV+GNVW+F  R  S   + AP ++ LC++ LA + V Y+ PFI
Sbjct  197  LAYHSKTAVDCFFAVWFVVGNVWIFGGRGTSSDAQDAPNMYRLCLAFLALSCVGYAVPFI  256

Query  527  LFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYK-----------------  399
            +   +CCC P + S L    ++G   RGA+ E + +LPT+K+K                 
Sbjct  257  MCAAICCCFPCLISVLRLQEDLGQT-RGATQELIEALPTYKFKPRRSKNWGLDYASSSEN  315

Query  398  ---------QVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISC  246
                            +  E+  CCICL +Y D +E+R+LPC+H+FH+ CVD+WL+I + 
Sbjct  316  LSEGGILGPGTKKERTVSAEDAVCCICLTKYGDDDELRELPCTHLFHVQCVDKWLKINAV  375

Query  245  CPLCKKDLAR*MKS  204
            CPLCK D+   ++S
Sbjct  376  CPLCKTDIGGVVRS  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520