BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF035A03

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010245461.1|  PREDICTED: topless-related protein 2-like is...    138   4e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010245460.1|  PREDICTED: topless-related protein 2-like is...    138   4e-33   Nelumbo nucifera [Indian lotus]
emb|CDP17223.1|  unnamed protein product                                137   1e-32   Coffea canephora [robusta coffee]
ref|XP_006344709.1|  PREDICTED: topless-related protein 3-like is...    137   1e-32   Solanum tuberosum [potatoes]
ref|XP_006344708.1|  PREDICTED: topless-related protein 3-like is...    137   1e-32   Solanum tuberosum [potatoes]
ref|XP_006344707.1|  PREDICTED: topless-related protein 3-like is...    137   1e-32   Solanum tuberosum [potatoes]
ref|XP_004230269.1|  PREDICTED: topless-related protein 3 isoform X3    136   2e-32   Solanum lycopersicum
ref|XP_010313271.1|  PREDICTED: topless-related protein 3 isoform X2    136   2e-32   Solanum lycopersicum
ref|XP_010313267.1|  PREDICTED: topless-related protein 3 isoform X1    136   2e-32   Solanum lycopersicum
ref|XP_009785868.1|  PREDICTED: topless-related protein 3-like          135   6e-32   Nicotiana sylvestris
ref|XP_011092107.1|  PREDICTED: topless-related protein 3-like          134   7e-32   Sesamum indicum [beniseed]
gb|KDP23429.1|  hypothetical protein JCGZ_23262                         130   3e-31   Jatropha curcas
ref|XP_009766750.1|  PREDICTED: topless-related protein 3-like is...    132   4e-31   Nicotiana sylvestris
ref|XP_009766749.1|  PREDICTED: topless-related protein 3-like is...    132   4e-31   Nicotiana sylvestris
ref|XP_009616373.1|  PREDICTED: topless-related protein 3-like          132   5e-31   Nicotiana tomentosiformis
emb|CAN79774.1|  hypothetical protein VITISV_013612                     131   9e-31   Vitis vinifera
ref|XP_009611828.1|  PREDICTED: topless-related protein 3-like is...    131   1e-30   Nicotiana tomentosiformis
ref|XP_009611827.1|  PREDICTED: topless-related protein 3-like is...    131   1e-30   Nicotiana tomentosiformis
ref|XP_007204953.1|  hypothetical protein PRUPE_ppa000487mg             130   2e-30   Prunus persica
ref|XP_008795824.1|  PREDICTED: topless-related protein 2-like          130   2e-30   
ref|XP_002283157.1|  PREDICTED: topless-related protein 3               130   2e-30   Vitis vinifera
ref|XP_008790866.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...    129   4e-30   
ref|XP_010259448.1|  PREDICTED: topless-related protein 2 isoform X1    129   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010259450.1|  PREDICTED: topless-related protein 2 isoform X3    129   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002512473.1|  WD-repeat protein, putative                        128   1e-29   Ricinus communis
ref|XP_008245640.1|  PREDICTED: topless-related protein 3               127   2e-29   Prunus mume [ume]
ref|XP_008388509.1|  PREDICTED: topless-related protein 3-like          127   3e-29   Malus domestica [apple tree]
gb|KDO81756.1|  hypothetical protein CISIN_1g001190mg                   126   5e-29   Citrus sinensis [apfelsine]
gb|KDO81755.1|  hypothetical protein CISIN_1g001190mg                   126   5e-29   Citrus sinensis [apfelsine]
gb|KDO81757.1|  hypothetical protein CISIN_1g001190mg                   126   5e-29   Citrus sinensis [apfelsine]
ref|XP_006433483.1|  hypothetical protein CICLE_v10000084mg             126   5e-29   Citrus clementina [clementine]
ref|XP_010094719.1|  Topless-related protein 3                          126   5e-29   Morus notabilis
ref|XP_004144768.1|  PREDICTED: topless-related protein 3-like          126   6e-29   Cucumis sativus [cucumbers]
ref|XP_004158753.1|  PREDICTED: topless-related protein 3-like          126   6e-29   
ref|XP_010921589.1|  PREDICTED: topless-related protein 2-like is...    125   1e-28   Elaeis guineensis
ref|XP_010921588.1|  PREDICTED: topless-related protein 2-like is...    125   1e-28   Elaeis guineensis
ref|XP_010259449.1|  PREDICTED: topless-related protein 2 isoform X2    125   1e-28   Nelumbo nucifera [Indian lotus]
gb|KDO71780.1|  hypothetical protein CISIN_1g001178mg                   125   2e-28   Citrus sinensis [apfelsine]
ref|XP_006489020.1|  PREDICTED: topless-related protein 2-like is...    125   2e-28   
ref|XP_006419483.1|  hypothetical protein CICLE_v10004197mg             125   2e-28   Citrus clementina [clementine]
ref|XP_004494565.1|  PREDICTED: topless-related protein 3-like          125   2e-28   
ref|XP_006472151.1|  PREDICTED: topless-related protein 3-like          125   2e-28   Citrus sinensis [apfelsine]
ref|XP_006644007.1|  PREDICTED: topless-related protein 2-like          124   2e-28   Oryza brachyantha
ref|XP_010938347.1|  PREDICTED: topless-related protein 2-like is...    124   2e-28   Elaeis guineensis
ref|XP_010938346.1|  PREDICTED: topless-related protein 2-like is...    124   2e-28   Elaeis guineensis
ref|XP_009338219.1|  PREDICTED: topless-related protein 3 isoform X2    124   2e-28   
ref|XP_009338217.1|  PREDICTED: topless-related protein 3 isoform X1    124   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_004508183.1|  PREDICTED: topless-related protein 2-like          124   2e-28   Cicer arietinum [garbanzo]
ref|XP_010024093.1|  PREDICTED: topless-related protein 3 isoform X1    124   2e-28   Eucalyptus grandis [rose gum]
gb|KCW60526.1|  hypothetical protein EUGRSUZ_H03269                     124   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010024094.1|  PREDICTED: topless-related protein 3 isoform X2    124   2e-28   Eucalyptus grandis [rose gum]
ref|XP_008370406.1|  PREDICTED: topless-related protein 3-like is...    123   5e-28   Malus domestica [apple tree]
ref|XP_008370405.1|  PREDICTED: topless-related protein 3-like is...    123   5e-28   Malus domestica [apple tree]
ref|XP_008453896.1|  PREDICTED: topless-related protein 3-like          123   5e-28   Cucumis melo [Oriental melon]
ref|XP_010086586.1|  Topless-related protein 3                          123   7e-28   Morus notabilis
ref|XP_007163344.1|  hypothetical protein PHAVU_001G227000g             122   1e-27   Phaseolus vulgaris [French bean]
ref|XP_007163345.1|  hypothetical protein PHAVU_001G227000g             122   1e-27   Phaseolus vulgaris [French bean]
gb|EAY73338.1|  hypothetical protein OsI_01216                          122   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_009421409.1|  PREDICTED: topless-related protein 2-like          121   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042616.1|  Os01g0254100                                       121   2e-27   
ref|XP_010546752.1|  PREDICTED: topless-related protein 3 isoform X2    121   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_010546750.1|  PREDICTED: topless-related protein 3 isoform X1    121   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_003566431.1|  PREDICTED: topless-related protein 2-like is...    121   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_010230707.1|  PREDICTED: topless-related protein 2-like is...    121   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_010230706.1|  PREDICTED: topless-related protein 2-like is...    121   3e-27   Brachypodium distachyon [annual false brome]
dbj|BAJ96033.1|  predicted protein                                      121   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85297.1|  predicted protein                                      121   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006606545.1|  PREDICTED: topless-related protein 3-like          121   3e-27   Glycine max [soybeans]
ref|XP_007099669.1|  TOPLESS-related 3                                  115   4e-27   
ref|XP_004495685.1|  PREDICTED: topless-related protein 3-like is...    120   4e-27   Cicer arietinum [garbanzo]
ref|XP_004495684.1|  PREDICTED: topless-related protein 3-like is...    120   4e-27   Cicer arietinum [garbanzo]
ref|XP_004967836.1|  PREDICTED: topless-related protein 2-like          120   4e-27   Setaria italica
gb|AAB61051.1|  Hypothetical protein F2P16.14                           111   4e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ88304.1|  predicted protein                                      119   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO71781.1|  hypothetical protein CISIN_1g001178mg                   120   5e-27   Citrus sinensis [apfelsine]
ref|XP_006489019.1|  PREDICTED: topless-related protein 2-like is...    120   5e-27   Citrus sinensis [apfelsine]
ref|XP_003591186.1|  WD repeat-containing protein                       120   5e-27   
gb|ABD28351.1|  Lissencephaly type-1-like homology motif; CTLH, C...    120   5e-27   Medicago truncatula
emb|CDM82632.1|  unnamed protein product                                120   7e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006589130.1|  PREDICTED: topless-related protein 3-like is...    119   9e-27   
gb|KHN16088.1|  Topless-related protein 3                               119   9e-27   Glycine soja [wild soybean]
ref|XP_010043204.1|  PREDICTED: topless-related protein 3-like          119   1e-26   
ref|XP_006589131.1|  PREDICTED: topless-related protein 3-like is...    119   1e-26   
ref|XP_003626186.1|  hypothetical protein MTR_7g112460                  119   1e-26   Medicago truncatula
dbj|BAJ91882.1|  predicted protein                                      118   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS69182.1|  hypothetical protein M569_05580                         119   2e-26   Genlisea aurea
emb|CDY25010.1|  BnaC02g39980D                                          118   2e-26   Brassica napus [oilseed rape]
emb|CDY05552.1|  BnaA02g31390D                                          118   2e-26   
ref|XP_009129893.1|  PREDICTED: topless-related protein 3               118   2e-26   Brassica rapa
ref|XP_010528913.1|  PREDICTED: topless-related protein 3-like          118   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_006604796.1|  PREDICTED: topless-related protein 3-like          118   4e-26   Glycine max [soybeans]
ref|XP_007144973.1|  hypothetical protein PHAVU_007G198900g             118   4e-26   Phaseolus vulgaris [French bean]
ref|XP_010524852.1|  PREDICTED: topless-related protein 3-like is...    117   4e-26   Tarenaya hassleriana [spider flower]
ref|XP_010524851.1|  PREDICTED: topless-related protein 3-like is...    117   4e-26   Tarenaya hassleriana [spider flower]
ref|XP_006394928.1|  hypothetical protein EUTSA_v10003550mg             117   8e-26   
ref|XP_007031067.1|  Transducin family protein / WD-40 repeat fam...    117   8e-26   
emb|CDX88252.1|  BnaA06g28430D                                          117   9e-26   
ref|XP_007031064.1|  TOPLESS-related 3 isoform 1                        116   1e-25   
gb|KJB26374.1|  hypothetical protein B456_004G238300                    116   2e-25   Gossypium raimondii
gb|KJB26372.1|  hypothetical protein B456_004G238300                    116   2e-25   Gossypium raimondii
gb|KJB26373.1|  hypothetical protein B456_004G238300                    116   2e-25   Gossypium raimondii
gb|KHG26583.1|  Topless-related 3 -like protein                         115   3e-25   Gossypium arboreum [tree cotton]
gb|AES91919.2|  topless-like protein                                    115   3e-25   Medicago truncatula
ref|XP_009151171.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...    115   3e-25   Brassica rapa
ref|XP_002307097.2|  WD-40 repeat family protein                        114   7e-25   
ref|XP_003609722.1|  WD repeat-containing protein                       114   7e-25   
emb|CDX80607.1|  BnaC07g28370D                                          114   7e-25   
ref|NP_198055.3|  Topless-related protein 3                             114   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190409.1|  Topless-related protein 3                          114   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036914.1|  PREDICTED: topless-related protein 3               114   8e-25   Populus euphratica
gb|KHN03954.1|  Topless-related protein 3                               114   9e-25   Glycine soja [wild soybean]
ref|XP_006577218.1|  PREDICTED: topless-related protein 3-like          114   9e-25   Glycine max [soybeans]
gb|KHG04331.1|  Topless-related 2 -like protein                         113   2e-24   Gossypium arboreum [tree cotton]
emb|CDY50502.1|  BnaC01g44400D                                          113   2e-24   Brassica napus [oilseed rape]
dbj|BAA95777.1|  unnamed protein product                                113   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188306.2|  Topless-related 2 protein                             113   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114175.1|  PREDICTED: topless-related protein 2               113   2e-24   Brassica rapa
ref|XP_010674104.1|  PREDICTED: topless-related protein 3-like          113   2e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB26371.1|  hypothetical protein B456_004G238300                    113   2e-24   Gossypium raimondii
ref|XP_009382518.1|  PREDICTED: topless-related protein 2-like is...    112   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382517.1|  PREDICTED: topless-related protein 2-like is...    112   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006406802.1|  hypothetical protein EUTSA_v10019939mg             112   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_006299477.1|  hypothetical protein CARUB_v10015642mg             112   4e-24   Capsella rubella
ref|XP_009146056.1|  PREDICTED: topless-related protein 2-like          112   4e-24   Brassica rapa
ref|XP_007035678.1|  TOPLESS-related 2 isoform 4                        111   5e-24   
ref|XP_007035677.1|  TOPLESS-related 2 isoform 3                        111   5e-24   
ref|XP_007035675.1|  TOPLESS-related 2 isoform 1                        111   5e-24   
ref|XP_007035676.1|  TOPLESS-related 2 isoform 2                        111   5e-24   
gb|KFK39016.1|  hypothetical protein AALP_AA3G189500                    111   7e-24   Arabis alpina [alpine rockcress]
ref|XP_004487868.1|  PREDICTED: topless-related protein 2-like          111   7e-24   
ref|XP_008673872.1|  PREDICTED: topless-related protein 2 isoform X2    111   8e-24   Zea mays [maize]
ref|XP_008673871.1|  PREDICTED: topless-related protein 2 isoform X1    111   8e-24   Zea mays [maize]
emb|CDY50500.1|  BnaC01g44380D                                          108   8e-24   Brassica napus [oilseed rape]
emb|CDX92100.1|  BnaA05g23070D                                          110   1e-23   
gb|KFK27551.1|  hypothetical protein AALP_AA8G398300                    110   1e-23   Arabis alpina [alpine rockcress]
ref|XP_010440213.1|  PREDICTED: topless-related protein 2-like          110   1e-23   
emb|CDX95900.1|  BnaC05g36510D                                          110   1e-23   
ref|XP_011023731.1|  PREDICTED: topless-related protein 3-like          110   2e-23   Populus euphratica
ref|XP_010487553.1|  PREDICTED: topless-related protein 2-like          110   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002319498.2|  WD-40 repeat family protein                        109   3e-23   
ref|XP_001781989.1|  predicted protein                                  109   4e-23   
ref|XP_004495686.1|  PREDICTED: topless-related protein 3-like is...    108   5e-23   
ref|XP_010465706.1|  PREDICTED: topless-related protein 2-like          108   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010449856.1|  PREDICTED: topless-related protein 2-like          108   7e-23   
ref|XP_001768092.1|  predicted protein                                  108   9e-23   
ref|XP_002883029.1|  hypothetical protein ARALYDRAFT_479149             108   1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_007031068.1|  TOPLESS-related 3                                  107   1e-22   
ref|XP_006285940.1|  hypothetical protein CARUB_v10007460mg             107   2e-22   
gb|KEH37175.1|  topless-like protein                                    107   2e-22   Medicago truncatula
gb|EMS62858.1|  Topless-related protein 2                               106   3e-22   Triticum urartu
ref|XP_010504697.1|  PREDICTED: topless-related protein 2               106   3e-22   Camelina sativa [gold-of-pleasure]
gb|KJB72745.1|  hypothetical protein B456_011G194100                    106   3e-22   Gossypium raimondii
ref|XP_004506964.1|  PREDICTED: protein TOPLESS-like                    106   3e-22   Cicer arietinum [garbanzo]
ref|XP_006414395.1|  hypothetical protein EUTSA_v10024263mg             106   3e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008655511.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...    106   4e-22   
ref|XP_010050139.1|  PREDICTED: topless-related protein 4-like          105   8e-22   
ref|XP_006341391.1|  PREDICTED: protein TOPLESS-like                    104   1e-21   
ref|XP_002960294.1|  hypothetical protein SELMODRAFT_163891             104   1e-21   
ref|XP_010318715.1|  PREDICTED: protein TOPLESS-like isoform X1         104   1e-21   Solanum lycopersicum
ref|XP_002967419.1|  hypothetical protein SELMODRAFT_439915             104   2e-21   
gb|EYU21684.1|  hypothetical protein MIMGU_mgv1a000459mg                104   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_002870186.1|  predicted protein                                  104   2e-21   Arabidopsis lyrata subsp. lyrata
gb|KJB34663.1|  hypothetical protein B456_006G077300                    103   2e-21   Gossypium raimondii
gb|KJB34661.1|  hypothetical protein B456_006G077300                    103   2e-21   Gossypium raimondii
ref|XP_011073378.1|  PREDICTED: protein TOPLESS                         103   3e-21   Sesamum indicum [beniseed]
ref|XP_006855163.1|  hypothetical protein AMTR_s00051p00079490          103   3e-21   Amborella trichopoda
ref|XP_009405763.1|  PREDICTED: protein TOPLESS-like isoform X3         103   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405760.1|  PREDICTED: protein TOPLESS-like isoform X1         103   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002309645.1|  WD-40 repeat family protein                        103   4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009405761.1|  PREDICTED: protein TOPLESS-like isoform X2         103   5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009369993.1|  PREDICTED: topless-related protein 2-like          103   5e-21   Pyrus x bretschneideri [bai li]
ref|XP_008390610.1|  PREDICTED: topless-related protein 2-like          103   5e-21   
ref|XP_002324880.2|  WD-40 repeat family protein                        102   5e-21   
gb|KCW80100.1|  hypothetical protein EUGRSUZ_C014271                  96.7    7e-21   Eucalyptus grandis [rose gum]
ref|XP_007150781.1|  hypothetical protein PHAVU_005G180100g             102   7e-21   Phaseolus vulgaris [French bean]
ref|XP_009382516.1|  PREDICTED: topless-related protein 2-like is...    102   7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007227035.1|  hypothetical protein PRUPE_ppa000503mg             102   8e-21   Prunus persica
ref|XP_004486640.1|  PREDICTED: protein TOPLESS-like isoform X1         102   9e-21   Cicer arietinum [garbanzo]
ref|XP_009796750.1|  PREDICTED: protein TOPLESS-like                    102   1e-20   Nicotiana sylvestris
ref|XP_009611336.1|  PREDICTED: protein TOPLESS-like                    102   1e-20   Nicotiana tomentosiformis
ref|XP_010318718.1|  PREDICTED: protein TOPLESS-like                  99.0    1e-20   Solanum lycopersicum
gb|KCW80088.1|  hypothetical protein EUGRSUZ_C01415                   98.6    1e-20   Eucalyptus grandis [rose gum]
ref|XP_006341390.1|  PREDICTED: protein TOPLESS-like                  97.8    1e-20   
ref|XP_011036611.1|  PREDICTED: topless-related protein 1-like          101   1e-20   Populus euphratica
ref|XP_008337262.1|  PREDICTED: topless-related protein 4               101   2e-20   
ref|XP_010047998.1|  PREDICTED: topless-related protein 4-like is...  98.2    2e-20   
ref|XP_010539522.1|  PREDICTED: protein TOPLESS-like                    101   2e-20   Tarenaya hassleriana [spider flower]
ref|XP_008385358.1|  PREDICTED: topless-related protein 4-like        97.1    2e-20   
gb|KCW80072.1|  hypothetical protein EUGRSUZ_C01404                     100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_009363995.1|  PREDICTED: topless-related protein 4-like          101   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009395915.1|  PREDICTED: topless-related protein 1-like          101   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW80086.1|  hypothetical protein EUGRSUZ_C01415                   98.6    2e-20   Eucalyptus grandis [rose gum]
ref|XP_002517701.1|  WD-repeat protein, putative                        100   2e-20   
ref|XP_002275116.1|  PREDICTED: protein TOPLESS isoform X3              100   2e-20   Vitis vinifera
ref|XP_004486641.1|  PREDICTED: protein TOPLESS-like isoform X2         100   3e-20   Cicer arietinum [garbanzo]
ref|XP_010662133.1|  PREDICTED: protein TOPLESS isoform X1              100   3e-20   Vitis vinifera
ref|XP_010048001.1|  PREDICTED: topless-related protein 4-like is...    100   3e-20   
gb|KCW80076.1|  hypothetical protein EUGRSUZ_C01409                     100   3e-20   Eucalyptus grandis [rose gum]
tpg|DAA53973.1|  TPA: hypothetical protein ZEAMMB73_351755              100   3e-20   
ref|XP_010906011.1|  PREDICTED: protein TOPLESS                         100   3e-20   Elaeis guineensis
ref|XP_008223259.1|  PREDICTED: topless-related protein 2               100   3e-20   Prunus mume [ume]
ref|XP_007135775.1|  hypothetical protein PHAVU_010G157700g             100   3e-20   Phaseolus vulgaris [French bean]
ref|XP_009368882.1|  PREDICTED: topless-related protein 4-like          100   3e-20   Pyrus x bretschneideri [bai li]
ref|XP_010662135.1|  PREDICTED: protein TOPLESS isoform X4              100   3e-20   Vitis vinifera
ref|XP_010662134.1|  PREDICTED: protein TOPLESS isoform X2              100   3e-20   Vitis vinifera
ref|XP_010050598.1|  PREDICTED: topless-related protein 4-like          100   3e-20   
ref|XP_009361201.1|  PREDICTED: topless-related protein 1-like is...    100   3e-20   Pyrus x bretschneideri [bai li]
ref|XP_009361190.1|  PREDICTED: topless-related protein 1-like is...    100   3e-20   Pyrus x bretschneideri [bai li]
ref|XP_007138952.1|  hypothetical protein PHAVU_009G252100g             100   3e-20   Phaseolus vulgaris [French bean]
ref|XP_009346204.1|  PREDICTED: topless-related protein 2-like is...    100   4e-20   Pyrus x bretschneideri [bai li]
ref|XP_009346203.1|  PREDICTED: topless-related protein 2-like is...    100   4e-20   Pyrus x bretschneideri [bai li]
ref|XP_010048000.1|  PREDICTED: topless-related protein 4-like is...    100   4e-20   
ref|XP_010047999.1|  PREDICTED: topless-related protein 4-like is...    100   4e-20   
ref|XP_010047997.1|  PREDICTED: topless-related protein 4-like is...  98.2    4e-20   
emb|CDP10439.1|  unnamed protein product                                100   4e-20   Coffea canephora [robusta coffee]
ref|XP_002268265.1|  PREDICTED: protein TOPLESS                         100   5e-20   Vitis vinifera
ref|XP_008363005.1|  PREDICTED: topless-related protein 4-like        99.8    5e-20   
ref|XP_011039630.1|  PREDICTED: topless-related protein 1-like is...  99.8    5e-20   Populus euphratica
ref|XP_011039629.1|  PREDICTED: topless-related protein 1-like is...  99.8    5e-20   Populus euphratica
ref|XP_006389801.1|  hypothetical protein EUTSA_v10018037mg           99.8    6e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006389802.1|  hypothetical protein EUTSA_v10018037mg           99.8    6e-20   
gb|KFK25571.1|  hypothetical protein AALP_AA8G132300                  98.6    6e-20   Arabis alpina [alpine rockcress]
ref|XP_010050137.1|  PREDICTED: topless-related protein 1-like        97.4    7e-20   
gb|KHG27106.1|  Topless-related 1 -like protein                       99.4    7e-20   Gossypium arboreum [tree cotton]
gb|KCW80012.1|  hypothetical protein EUGRSUZ_C01349                   96.7    7e-20   Eucalyptus grandis [rose gum]
ref|NP_563981.1|  protein TOPLESS                                     99.4    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013512.1|  Transducin family protein / WD-40 repeat fam...  99.4    7e-20   
ref|XP_007013513.1|  Transducin family protein / WD-40 repeat fam...  99.4    8e-20   
gb|KJB64729.1|  hypothetical protein B456_010G062200                  99.4    8e-20   Gossypium raimondii
gb|KJB64727.1|  hypothetical protein B456_010G062200                  99.4    8e-20   Gossypium raimondii
ref|XP_004296880.1|  PREDICTED: topless-related protein 2             99.4    8e-20   Fragaria vesca subsp. vesca
gb|AAF82145.1|AC034256_9  Strong similarity to an unknown protein...  99.4    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013508.1|  WUS-interacting protein 2 isoform 3              99.4    9e-20   
ref|XP_007013506.1|  WUS-interacting protein 2 isoform 1              99.4    9e-20   
ref|XP_007013509.1|  WUS-interacting protein 2 isoform 4              99.4    9e-20   
ref|XP_007013510.1|  WUS-interacting protein 2 isoform 5              99.4    9e-20   
ref|XP_007013507.1|  WUS-interacting protein 2 isoform 2              99.4    9e-20   
ref|XP_008813124.1|  PREDICTED: protein TOPLESS-like isoform X1       99.4    9e-20   
ref|XP_006597113.1|  PREDICTED: protein TOPLESS-like isoform X1       99.4    9e-20   Glycine max [soybeans]
emb|CDO98186.1|  unnamed protein product                              99.0    1e-19   Coffea canephora [robusta coffee]
gb|KHN22427.1|  Topless-related protein 1                             99.0    1e-19   Glycine soja [wild soybean]
gb|KCW80002.1|  hypothetical protein EUGRSUZ_C01336                   97.4    1e-19   Eucalyptus grandis [rose gum]
ref|XP_010241551.1|  PREDICTED: topless-related protein 1-like is...  99.0    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010241550.1|  PREDICTED: topless-related protein 4-like is...  99.0    1e-19   
ref|XP_008376897.1|  PREDICTED: topless-related protein 1-like is...  99.0    1e-19   Malus domestica [apple tree]
ref|XP_008376892.1|  PREDICTED: topless-related protein 1-like is...  99.0    1e-19   
ref|XP_008228737.1|  PREDICTED: protein TOPLESS                       99.0    1e-19   Prunus mume [ume]
ref|XP_007214907.1|  hypothetical protein PRUPE_ppa000478mg           99.0    1e-19   Prunus persica
emb|CDY33387.1|  BnaC05g11960D                                        99.0    1e-19   Brassica napus [oilseed rape]
ref|XP_010250289.1|  PREDICTED: protein TOPLESS-like isoform X3       99.0    1e-19   Nelumbo nucifera [Indian lotus]
emb|CDY36584.1|  BnaA06g10370D                                        99.0    1e-19   Brassica napus [oilseed rape]
ref|XP_010497362.1|  PREDICTED: protein TOPLESS                       99.0    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010250290.1|  PREDICTED: protein TOPLESS-like isoform X4       99.0    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006416884.1|  hypothetical protein EUTSA_v10006622mg           99.0    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009148962.1|  PREDICTED: protein TOPLESS                       99.0    1e-19   Brassica rapa
ref|XP_010250288.1|  PREDICTED: protein TOPLESS-like isoform X2       99.0    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010250287.1|  PREDICTED: protein TOPLESS-like isoform X1       99.0    1e-19   Nelumbo nucifera [Indian lotus]
emb|CDY53312.1|  BnaA09g56690D                                        98.6    1e-19   Brassica napus [oilseed rape]
ref|XP_011457926.1|  PREDICTED: topless-related protein 4-like is...  98.6    1e-19   Fragaria vesca subsp. vesca
ref|XP_004287287.1|  PREDICTED: topless-related protein 4-like is...  98.6    2e-19   Fragaria vesca subsp. vesca
ref|XP_010656455.1|  PREDICTED: topless-related protein 4 isoform X5  98.6    2e-19   
emb|CDX81729.1|  BnaC08g38720D                                        98.6    2e-19   
ref|XP_010656453.1|  PREDICTED: topless-related protein 4 isoform X2  98.6    2e-19   Vitis vinifera
ref|XP_002285341.2|  PREDICTED: topless-related protein 4 isoform X3  98.6    2e-19   Vitis vinifera
ref|XP_010656454.1|  PREDICTED: topless-related protein 4 isoform X4  98.6    2e-19   Vitis vinifera
ref|XP_002443908.1|  hypothetical protein SORBIDRAFT_07g004180        98.6    2e-19   
ref|XP_010656452.1|  PREDICTED: topless-related protein 4 isoform X1  98.6    2e-19   Vitis vinifera
ref|XP_008340770.1|  PREDICTED: topless-related protein 2             98.2    2e-19   
ref|XP_008353208.1|  PREDICTED: topless-related protein 2-like        98.2    2e-19   
ref|XP_010476664.1|  PREDICTED: protein TOPLESS-like                  98.2    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006306622.1|  hypothetical protein CARUB_v10008139mg           98.2    2e-19   
ref|XP_008788791.1|  PREDICTED: topless-related protein 1-like is...  98.2    2e-19   Phoenix dactylifera
ref|XP_004303268.1|  PREDICTED: protein TOPLESS isoform X1            98.2    2e-19   Fragaria vesca subsp. vesca
ref|XP_011011325.1|  PREDICTED: protein TOPLESS-like                  98.2    2e-19   Populus euphratica
gb|KJB35153.1|  hypothetical protein B456_006G102300                  98.2    2e-19   Gossypium raimondii
ref|XP_008788792.1|  PREDICTED: topless-related protein 1-like is...  98.2    2e-19   
ref|XP_006649759.1|  PREDICTED: protein TOPLESS-like                  98.2    2e-19   Oryza brachyantha
ref|NP_001061055.1|  Os08g0162100                                     98.2    2e-19   
ref|XP_010532341.1|  PREDICTED: protein TOPLESS                       98.2    2e-19   Tarenaya hassleriana [spider flower]
gb|KJB35154.1|  hypothetical protein B456_006G102300                  97.8    2e-19   
dbj|BAC99788.1|  WD-40 repeat protein-like                            97.8    2e-19   
ref|XP_010244894.1|  PREDICTED: topless-related protein 1-like is...  97.8    2e-19   
ref|XP_010244893.1|  PREDICTED: topless-related protein 1-like is...  97.8    2e-19   
ref|XP_010928279.1|  PREDICTED: protein TOPLESS-like                  97.8    3e-19   
ref|XP_006584165.1|  PREDICTED: protein TOPLESS-like                  97.8    3e-19   
gb|KCW59942.1|  hypothetical protein EUGRSUZ_H02668                   97.4    3e-19   
gb|KCW70755.1|  hypothetical protein EUGRSUZ_F03923                   97.8    3e-19   
ref|NP_001167872.2|  ramosa 1 enhancer locus 2                        97.8    3e-19   
ref|XP_010063532.1|  PREDICTED: protein TOPLESS isoform X2            97.8    3e-19   
ref|XP_006492116.1|  PREDICTED: protein TOPLESS-like isoform X1       97.8    3e-19   
ref|XP_006427463.1|  hypothetical protein CICLE_v10024745mg           97.8    3e-19   
ref|XP_006427465.1|  hypothetical protein CICLE_v10024745mg           97.8    3e-19   
ref|XP_006585625.1|  PREDICTED: protein TOPLESS-like isoform X1       97.8    3e-19   
ref|XP_004972767.1|  PREDICTED: topless-related protein 1-like        97.8    3e-19   
gb|KCW70758.1|  hypothetical protein EUGRSUZ_F03923                   97.8    3e-19   
gb|KCW80031.1|  hypothetical protein EUGRSUZ_C013682                  96.7    3e-19   
ref|XP_010063530.1|  PREDICTED: protein TOPLESS isoform X1            97.4    3e-19   
gb|KCW80498.1|  hypothetical protein EUGRSUZ_C01846                   97.1    3e-19   
gb|KHN38006.1|  Topless-related protein 1                             97.1    3e-19   
emb|CDX67950.1|  BnaA07g19900D                                        97.4    3e-19   
ref|XP_008372696.1|  PREDICTED: protein TOPLESS                       97.4    4e-19   
ref|XP_009348312.1|  PREDICTED: protein TOPLESS-like                  97.4    4e-19   
ref|XP_009338495.1|  PREDICTED: protein TOPLESS                       97.4    4e-19   
ref|XP_010691083.1|  PREDICTED: protein TOPLESS                       97.4    4e-19   
gb|AES86542.2|  topless-like protein                                  97.4    4e-19   
gb|KGN52925.1|  hypothetical protein Csa_4G006320                     97.4    4e-19   
gb|KCW80499.1|  hypothetical protein EUGRSUZ_C01846                   97.1    4e-19   
ref|XP_010026693.1|  PREDICTED: topless-related protein 4-like        97.4    4e-19   
ref|XP_008454191.1|  PREDICTED: protein TOPLESS                       97.4    4e-19   
ref|XP_011044877.1|  PREDICTED: topless-related protein 1 isoform X1  97.4    4e-19   
ref|XP_004165893.1|  PREDICTED: LOW QUALITY PROTEIN: protein TOPL...  97.4    4e-19   
ref|XP_004152185.1|  PREDICTED: protein TOPLESS-like                  97.4    4e-19   
ref|XP_008801888.1|  PREDICTED: protein TOPLESS-like                  97.4    4e-19   
ref|XP_008380984.1|  PREDICTED: topless-related protein 1-like        97.4    4e-19   
gb|KJB26782.1|  hypothetical protein B456_004G259300                  97.1    4e-19   
ref|XP_002892877.1|  wus-interacting protein 1                        97.1    4e-19   
ref|XP_006369294.1|  WD-40 repeat family protein                      97.1    4e-19   
ref|XP_010462721.1|  PREDICTED: protein TOPLESS-like                  96.3    4e-19   
ref|XP_011044878.1|  PREDICTED: topless-related protein 1 isoform X2  97.1    5e-19   
ref|XP_009117812.1|  PREDICTED: protein TOPLESS                       97.1    5e-19   
gb|ACN26367.1|  unknown                                               94.4    5e-19   
ref|XP_006659155.1|  PREDICTED: protein TOPLESS-like                  97.1    5e-19   
ref|XP_011467045.1|  PREDICTED: protein TOPLESS isoform X2            97.1    5e-19   
ref|XP_007029511.1|  WD-40 repeat protein-like isoform 3              97.1    6e-19   
ref|XP_011470141.1|  PREDICTED: topless-related protein 1-like is...  96.7    6e-19   
ref|XP_011470140.1|  PREDICTED: topless-related protein 1-like is...  96.7    6e-19   
gb|KGN60698.1|  hypothetical protein Csa_2G007420                     96.7    6e-19   
ref|XP_004139298.1|  PREDICTED: topless-related protein 4-like        96.7    6e-19   
gb|KHG17585.1|  Protein TOPLESS -like protein                         96.7    6e-19   
ref|XP_003597932.1|  WD repeat-containing protein, putative           96.7    6e-19   
ref|XP_006385279.1|  hypothetical protein POPTR_0003s02410g           94.0    7e-19   
ref|XP_003597933.1|  WD repeat-containing protein, putative           96.7    7e-19   
ref|XP_007029509.1|  WD-40 repeat protein-like isoform 1              96.7    7e-19   
ref|XP_003597931.1|  WD repeat-containing protein, putative           96.7    7e-19   
ref|XP_010047995.1|  PREDICTED: uncharacterized protein LOC104436835  96.7    8e-19   
ref|XP_003599718.1|  WD repeat-containing protein, putative           96.3    8e-19   
gb|KHN01309.1|  Protein TOPLESS                                       95.1    8e-19   
ref|XP_002324641.2|  WD-40 repeat family protein                      96.3    8e-19   
ref|XP_010537925.1|  PREDICTED: protein TOPLESS-like                  96.3    8e-19   
gb|KDO52285.1|  hypothetical protein CISIN_1g0012242mg                95.1    8e-19   
gb|KCW80090.1|  hypothetical protein EUGRSUZ_C01417                   93.6    8e-19   
ref|XP_010097168.1|  Protein TOPLESS                                  96.3    9e-19   
gb|AAF27128.1|AC018849_16  unknown protein; 52184-57536               96.3    9e-19   
ref|NP_178164.3|  Topless-related protein 1                           96.3    9e-19   
dbj|BAE98958.1|  hypothetical protein                                 96.3    9e-19   
ref|NP_849913.2|  Topless-related protein 1                           96.3    9e-19   
ref|XP_002887825.1|  hypothetical protein ARALYDRAFT_895943           96.3    9e-19   
gb|KDO52287.1|  hypothetical protein CISIN_1g0012242mg                95.1    1e-18   
ref|XP_010472920.1|  PREDICTED: topless-related protein 1 isoform X4  96.3    1e-18   
ref|XP_006301454.1|  hypothetical protein CARUB_v10021876mg           96.3    1e-18   
ref|XP_010472916.1|  PREDICTED: topless-related protein 1 isoform X1  96.3    1e-18   
ref|XP_010472918.1|  PREDICTED: topless-related protein 1 isoform X3  96.3    1e-18   
ref|XP_006492117.1|  PREDICTED: protein TOPLESS-like isoform X2       95.9    1e-18   
ref|XP_006427464.1|  hypothetical protein CICLE_v10024745mg           95.9    1e-18   
ref|XP_010472917.1|  PREDICTED: topless-related protein 1 isoform X2  95.9    1e-18   
gb|AAN62336.1|AF506028_3  CTV.2                                       95.9    1e-18   
ref|XP_009407206.1|  PREDICTED: protein TOPLESS-like                  95.9    1e-18   
ref|XP_010417699.1|  PREDICTED: topless-related protein 1-like        95.9    1e-18   
ref|XP_004307882.1|  PREDICTED: topless-related protein 1-like is...  95.9    1e-18   
ref|XP_011470138.1|  PREDICTED: topless-related protein 1-like is...  95.9    1e-18   
ref|XP_006595172.1|  PREDICTED: protein TOPLESS-like isoform X3       95.9    1e-18   
ref|XP_010250163.1|  PREDICTED: protein TOPLESS-like                  95.9    1e-18   
ref|XP_010927352.1|  PREDICTED: protein TOPLESS                       95.9    1e-18   
ref|XP_007204297.1|  hypothetical protein PRUPE_ppa000492mg           95.9    1e-18   
ref|XP_004165979.1|  PREDICTED: topless-related protein 4-like        94.7    1e-18   
ref|XP_010278757.1|  PREDICTED: topless-related protein 1-like is...  95.5    1e-18   
gb|AFP55591.1|  topless-related protein                               95.1    1e-18   
ref|XP_003543688.1|  PREDICTED: protein TOPLESS-like isoform X1       95.5    1e-18   
ref|XP_010278758.1|  PREDICTED: topless-related protein 1-like is...  95.5    1e-18   
gb|AES68182.2|  topless-like protein                                  95.5    1e-18   
ref|XP_009400780.1|  PREDICTED: topless-related protein 1-like        95.5    2e-18   
gb|KEH39610.1|  topless-like protein                                  95.5    2e-18   
ref|XP_008788808.1|  PREDICTED: protein TOPLESS-like                  95.5    2e-18   
ref|XP_010942722.1|  PREDICTED: protein TOPLESS-like                  95.5    2e-18   
ref|XP_009397650.1|  PREDICTED: topless-related protein 1-like        95.5    2e-18   
gb|AES68183.2|  topless-like protein                                  95.5    2e-18   
gb|KEH39609.1|  topless-like protein                                  95.1    2e-18   
ref|XP_009351851.1|  PREDICTED: topless-related protein 1-like is...  95.1    2e-18   
ref|XP_009351850.1|  PREDICTED: topless-related protein 1-like is...  95.1    2e-18   
ref|XP_009351849.1|  PREDICTED: topless-related protein 1-like is...  95.1    2e-18   
ref|XP_009351848.1|  PREDICTED: topless-related protein 1-like is...  95.1    2e-18   
ref|XP_011017799.1|  PREDICTED: topless-related protein 4-like is...  95.1    2e-18   
ref|XP_011017798.1|  PREDICTED: topless-related protein 4-like is...  95.1    2e-18   
ref|XP_011017797.1|  PREDICTED: topless-related protein 4-like is...  95.1    2e-18   
ref|XP_008219537.1|  PREDICTED: topless-related protein 1-like        95.1    2e-18   
emb|CAN64663.1|  hypothetical protein VITISV_035348                   95.1    2e-18   
ref|XP_002265778.1|  PREDICTED: topless-related protein 4             95.1    2e-18   
ref|XP_010046869.1|  PREDICTED: topless-related protein 4-like        92.0    2e-18   
ref|XP_007225505.1|  hypothetical protein PRUPE_ppa000570mg           94.7    2e-18   
gb|EMS49891.1|  Topless-related protein 1                             94.7    3e-18   
ref|XP_010103710.1|  Topless-related protein 4                        94.7    3e-18   
gb|KHG11821.1|  Protein TOPLESS -like protein                         94.7    3e-18   
gb|EMT24067.1|  hypothetical protein F775_25939                       94.7    3e-18   
gb|KCW80006.1|  hypothetical protein EUGRSUZ_C013432                  91.7    3e-18   
ref|XP_008456978.1|  PREDICTED: topless-related protein 4-like is...  94.7    3e-18   
gb|KJB55044.1|  hypothetical protein B456_009G059700                  94.7    3e-18   
ref|XP_008456972.1|  PREDICTED: topless-related protein 4-like is...  94.7    3e-18   
ref|XP_007029510.1|  WD-40 repeat protein-like isoform 2              94.7    3e-18   
gb|EEC74885.1|  hypothetical protein OsI_10796                        94.7    3e-18   
ref|XP_007023319.1|  TOPLESS-related 1 isoform 1                      94.4    3e-18   
gb|KDO52286.1|  hypothetical protein CISIN_1g0012242mg                93.6    3e-18   
ref|NP_001049587.1|  Os03g0254700                                     94.4    4e-18   
ref|XP_008234585.1|  PREDICTED: topless-related protein 1-like        94.4    4e-18   
gb|KHG04944.1|  Topless-related 1 -like protein                       94.4    4e-18   
gb|KJB68075.1|  hypothetical protein B456_010G224000                  94.4    4e-18   
ref|XP_008242803.1|  PREDICTED: topless-related protein 4-like        94.4    4e-18   
ref|XP_009104466.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  94.4    4e-18   
gb|EPS69099.1|  hypothetical protein M569_05666                       94.0    4e-18   
ref|XP_007220318.1|  hypothetical protein PRUPE_ppa000528m1g          93.6    5e-18   
ref|XP_007155033.1|  hypothetical protein PHAVU_003G167500g           94.0    5e-18   
ref|XP_007155035.1|  hypothetical protein PHAVU_003G167500g           94.0    5e-18   
ref|XP_007155032.1|  hypothetical protein PHAVU_003G167500g           94.0    5e-18   
ref|XP_007155034.1|  hypothetical protein PHAVU_003G167500g           94.0    5e-18   
ref|XP_011470144.1|  PREDICTED: topless-related protein 1-like is...  94.0    5e-18   
ref|XP_011470143.1|  PREDICTED: topless-related protein 1-like is...  94.0    5e-18   
ref|XP_010243111.1|  PREDICTED: protein TOPLESS-like                  94.0    6e-18   
gb|KJB56591.1|  hypothetical protein B456_009G126400                  93.6    7e-18   
emb|CDX79383.1|  BnaC06g19200D                                        93.6    7e-18   
ref|XP_009772955.1|  PREDICTED: topless-related protein 4 isoform X1  93.6    7e-18   
ref|XP_009772956.1|  PREDICTED: topless-related protein 4 isoform X2  93.6    7e-18   
ref|XP_009613434.1|  PREDICTED: topless-related protein 4 isoform X1  93.6    7e-18   
ref|XP_009613435.1|  PREDICTED: topless-related protein 4 isoform X2  93.6    8e-18   
gb|KEH32128.1|  topless-like protein                                  93.6    8e-18   
ref|XP_003609377.1|  WD repeat-containing protein                     93.2    8e-18   
gb|AES91574.2|  topless-like protein                                  93.2    8e-18   
ref|XP_010533140.1|  PREDICTED: topless-related protein 4-like        93.2    1e-17   
gb|KDP37032.1|  hypothetical protein JCGZ_06088                       93.2    1e-17   
ref|XP_011459156.1|  PREDICTED: topless-related protein 1-like        92.8    1e-17   
ref|XP_009396205.1|  PREDICTED: topless-related protein 1-like        92.8    1e-17   
ref|XP_009355787.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_009355784.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_009355785.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_002967579.1|  hypothetical protein SELMODRAFT_88677            92.8    1e-17   
ref|XP_002981766.1|  hypothetical protein SELMODRAFT_115161           92.8    1e-17   
ref|XP_011073420.1|  PREDICTED: topless-related protein 4             92.8    1e-17   
gb|ACF82743.1|  unknown                                               88.6    1e-17   
ref|XP_003573449.1|  PREDICTED: topless-related protein 1-like        92.4    2e-17   
gb|KDP33561.1|  hypothetical protein JCGZ_07132                       92.4    2e-17   
emb|CDP19688.1|  unnamed protein product                              88.2    2e-17   
gb|EMT12268.1|  hypothetical protein F775_05335                       92.0    2e-17   
ref|XP_010087497.1|  Protein TOPLESS                                  92.0    2e-17   
ref|XP_009395323.1|  PREDICTED: protein TOPLESS-like isoform X3       92.0    2e-17   
ref|XP_004508472.1|  PREDICTED: topless-related protein 4-like is...  92.0    2e-17   
ref|XP_008456966.1|  PREDICTED: topless-related protein 4-like is...  92.0    2e-17   
ref|XP_008456943.1|  PREDICTED: topless-related protein 4-like is...  92.0    2e-17   
ref|XP_004508471.1|  PREDICTED: topless-related protein 4-like is...  92.0    2e-17   
ref|XP_009395322.1|  PREDICTED: protein TOPLESS-like isoform X2       92.0    2e-17   
ref|XP_009395318.1|  PREDICTED: protein TOPLESS-like isoform X1       92.0    2e-17   
ref|XP_004984975.1|  PREDICTED: protein TOPLESS-like isoform X4       91.7    3e-17   
ref|XP_004984974.1|  PREDICTED: protein TOPLESS-like isoform X3       91.7    3e-17   
ref|XP_004984972.1|  PREDICTED: protein TOPLESS-like isoform X1       91.7    3e-17   
gb|AFK40029.1|  unknown                                               87.8    3e-17   
ref|XP_002439315.1|  hypothetical protein SORBIDRAFT_09g004230        89.4    3e-17   
gb|EYU21655.1|  hypothetical protein MIMGU_mgv1a000483mg              91.7    3e-17   
ref|XP_004235952.1|  PREDICTED: topless-related protein 4 isoform X1  91.7    3e-17   
ref|XP_010244887.1|  PREDICTED: topless-related protein 1-like is...  91.7    3e-17   
ref|XP_006594237.1|  PREDICTED: topless-related protein 4-like is...  91.7    3e-17   
ref|XP_006594236.1|  PREDICTED: topless-related protein 4-like is...  91.7    3e-17   
ref|XP_006364222.1|  PREDICTED: topless-related protein 4-like        91.3    3e-17   
ref|XP_010244892.1|  PREDICTED: topless-related protein 1-like is...  91.3    3e-17   
ref|XP_006381123.1|  hypothetical protein POPTR_0006s06570g           91.3    3e-17   
ref|XP_003549747.1|  PREDICTED: topless-related protein 4-like is...  91.3    4e-17   
ref|XP_006600746.1|  PREDICTED: topless-related protein 4-like is...  91.3    4e-17   
gb|KHN22119.1|  Topless-related protein 4                             91.3    4e-17   
ref|XP_002527178.1|  WD-repeat protein, putative                      91.3    4e-17   
dbj|BAJ91520.1|  predicted protein                                    90.9    5e-17   
ref|XP_002520011.1|  conserved hypothetical protein                   90.9    5e-17   
ref|XP_011020159.1|  PREDICTED: topless-related protein 4-like is...  90.9    5e-17   
ref|XP_010318758.1|  PREDICTED: topless-related protein 4 isoform X2  90.9    5e-17   
ref|XP_006450874.1|  hypothetical protein CICLE_v10007287mg           90.9    5e-17   
dbj|BAJ97681.1|  predicted protein                                    89.7    6e-17   
gb|KDO80174.1|  hypothetical protein CISIN_1g001163mg                 90.5    6e-17   
ref|XP_002465540.1|  hypothetical protein SORBIDRAFT_01g040800        90.5    7e-17   
gb|KDP30260.1|  hypothetical protein JCGZ_17042                       90.5    7e-17   
ref|XP_010928339.1|  PREDICTED: protein TOPLESS-like isoform X5       90.5    7e-17   
ref|XP_010928338.1|  PREDICTED: protein TOPLESS-like isoform X4       90.5    7e-17   
ref|XP_010928337.1|  PREDICTED: protein TOPLESS-like isoform X3       90.5    7e-17   
ref|XP_010928336.1|  PREDICTED: protein TOPLESS-like isoform X2       90.5    7e-17   
ref|XP_010928335.1|  PREDICTED: protein TOPLESS-like isoform X1       90.5    7e-17   
ref|XP_006358294.1|  PREDICTED: topless-related protein 4-like is...  90.5    7e-17   
ref|XP_006358293.1|  PREDICTED: topless-related protein 4-like is...  90.5    7e-17   
ref|XP_008394115.1|  PREDICTED: topless-related protein 1-like is...  90.5    7e-17   
ref|NP_001132574.1|  uncharacterized protein LOC100194042             87.0    8e-17   
ref|XP_008394116.1|  PREDICTED: topless-related protein 1-like is...  90.5    8e-17   
ref|XP_004242769.1|  PREDICTED: topless-related protein 4-like is...  90.1    8e-17   
gb|AFW88942.1|  hypothetical protein ZEAMMB73_764411                  89.4    8e-17   
ref|XP_010323294.1|  PREDICTED: topless-related protein 4-like is...  90.1    9e-17   
ref|XP_008803471.1|  PREDICTED: topless-related protein 1-like is...  90.1    9e-17   
ref|XP_008803470.1|  PREDICTED: topless-related protein 1-like is...  90.1    9e-17   
ref|XP_011036613.1|  PREDICTED: protein TOPLESS-like isoform X2       89.7    1e-16   
ref|XP_011036612.1|  PREDICTED: protein TOPLESS-like isoform X1       89.7    1e-16   
gb|EPS67565.1|  hypothetical protein M569_07208                       86.7    1e-16   
ref|XP_009595073.1|  PREDICTED: topless-related protein 4-like is...  89.7    1e-16   
ref|XP_009803412.1|  PREDICTED: topless-related protein 4-like is...  89.7    1e-16   
ref|XP_009595072.1|  PREDICTED: topless-related protein 4-like is...  89.7    1e-16   
ref|XP_009803406.1|  PREDICTED: topless-related protein 4-like is...  89.7    1e-16   
ref|XP_003558327.1|  PREDICTED: topless-related protein 1-like        89.4    2e-16   
ref|XP_010943652.1|  PREDICTED: topless-related protein 1-like is...  89.0    2e-16   
ref|XP_010943653.1|  PREDICTED: topless-related protein 1-like is...  89.0    2e-16   
ref|XP_006478899.1|  PREDICTED: protein TOPLESS-like isoform X1       89.0    2e-16   



>ref|XP_010245461.1| PREDICTED: topless-related protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=1126

 Score =   138 bits (348),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAYL QAV N N  VY +V+ AHPQEPNQ
Sbjct  1019  CNSQLVYASFSDGNIGVFDADNLRLRCQIAPSAYLPQAVSNSNHAVYPLVVAAHPQEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES G+WG++
Sbjct  1079  LAIGLTDGSVKVIEPSESEGKWGVA  1103



>ref|XP_010245460.1| PREDICTED: topless-related protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=1129

 Score =   138 bits (348),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAYL QAV N N  VY +V+ AHPQEPNQ
Sbjct  1022  CNSQLVYASFSDGNIGVFDADNLRLRCQIAPSAYLPQAVSNSNHAVYPLVVAAHPQEPNQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES G+WG++
Sbjct  1082  LAIGLTDGSVKVIEPSESEGKWGVA  1106



>emb|CDP17223.1| unnamed protein product [Coffea canephora]
Length=1132

 Score =   137 bits (344),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVLN ++ VY +VI AHPQ+PNQ
Sbjct  1019  CNSQLVYASFCDGNIGVFDADTLRLRCRVAPSAYLSQAVLNGSQAVYPLVIAAHPQDPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES G+WG++
Sbjct  1079  FAIGLTDGSVKVIEPQESEGKWGVT  1103



>ref|XP_006344709.1| PREDICTED: topless-related protein 3-like isoform X3 [Solanum 
tuberosum]
Length=1131

 Score =   137 bits (344),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1019  CNSQLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG++KVIEPLES G+WG+S
Sbjct  1079  FAVGLTDGTVKVIEPLESDGKWGVS  1103



>ref|XP_006344708.1| PREDICTED: topless-related protein 3-like isoform X2 [Solanum 
tuberosum]
Length=1132

 Score =   137 bits (344),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1020  CNSQLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG++KVIEPLES G+WG+S
Sbjct  1080  FAVGLTDGTVKVIEPLESDGKWGVS  1104



>ref|XP_006344707.1| PREDICTED: topless-related protein 3-like isoform X1 [Solanum 
tuberosum]
Length=1155

 Score =   137 bits (344),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1043  CNSQLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQ  1102

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG++KVIEPLES G+WG+S
Sbjct  1103  FAVGLTDGTVKVIEPLESDGKWGVS  1127



>ref|XP_004230269.1| PREDICTED: topless-related protein 3 isoform X3 [Solanum lycopersicum]
Length=1131

 Score =   136 bits (343),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1019  CNSQLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG++KVIEPLES G+WG+S
Sbjct  1079  FAVGLTDGTVKVIEPLESEGKWGVS  1103



>ref|XP_010313271.1| PREDICTED: topless-related protein 3 isoform X2 [Solanum lycopersicum]
Length=1132

 Score =   136 bits (343),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1020  CNSQLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG++KVIEPLES G+WG+S
Sbjct  1080  FAVGLTDGTVKVIEPLESEGKWGVS  1104



>ref|XP_010313267.1| PREDICTED: topless-related protein 3 isoform X1 [Solanum lycopersicum]
Length=1155

 Score =   136 bits (343),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1043  CNSQLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQ  1102

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG++KVIEPLES G+WG+S
Sbjct  1103  FAVGLTDGTVKVIEPLESEGKWGVS  1127



>ref|XP_009785868.1| PREDICTED: topless-related protein 3-like [Nicotiana sylvestris]
Length=1129

 Score =   135 bits (339),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR +C IAPSAYLSQAVLN ++ VY +VI AHPQEPNQ
Sbjct  1016  CNSQLVYASFCDGNIGVFDADSLRLKCHIAPSAYLSQAVLNGSQAVYPLVIAAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A GL+DG +KVIEPLES G+WG
Sbjct  1076  IAVGLSDGIVKVIEPLESEGKWG  1098



>ref|XP_011092107.1| PREDICTED: topless-related protein 3-like [Sesamum indicum]
Length=1129

 Score =   134 bits (338),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++ASF DGNIG+FDA  LR RC +APSAYLSQAVLN ++ VY VV+ AHPQEPNQ
Sbjct  1017  CNSQLVFASFCDGNIGIFDADTLRLRCRVAPSAYLSQAVLNGSQAVYPVVVAAHPQEPNQ  1076

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES  +WG+S
Sbjct  1077  FAVGLTDGSVKVIEPTESESKWGVS  1101



>gb|KDP23429.1| hypothetical protein JCGZ_23262 [Jatropha curcas]
Length=516

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QLIYA+F DGNIGVFDA  LR RC IA SAYLSQAVLN ++ VY +V+ AHPQEPNQ
Sbjct  404  CNSQLIYATFCDGNIGVFDADSLRLRCRIASSAYLSQAVLNGSQSVYPLVVAAHPQEPNQ  463

Query  537  LAFGLTDGSIKVIEPLESGGEWGIS  463
            L+ GLTDGS+KV+EP ES G+WG +
Sbjct  464  LSIGLTDGSVKVMEPTESEGKWGTT  488



>ref|XP_009766750.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
sylvestris]
Length=1131

 Score =   132 bits (332),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGN+GVFDA  LR RC +APSAYL QAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1019  CNSQLVYASFSDGNVGVFDADTLRLRCRVAPSAYLPQAVLTGSQAVYPLVVAAHPQEPSQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KVIEPLES G+WG+S
Sbjct  1079  FAVGLSDGTVKVIEPLESEGKWGLS  1103



>ref|XP_009766749.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
sylvestris]
Length=1132

 Score =   132 bits (332),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGN+GVFDA  LR RC +APSAYL QAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1020  CNSQLVYASFSDGNVGVFDADTLRLRCRVAPSAYLPQAVLTGSQAVYPLVVAAHPQEPSQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KVIEPLES G+WG+S
Sbjct  1080  FAVGLSDGTVKVIEPLESEGKWGLS  1104



>ref|XP_009616373.1| PREDICTED: topless-related protein 3-like [Nicotiana tomentosiformis]
Length=1132

 Score =   132 bits (332),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGN+GVFDA  LR RC +APSAYL QAVL  ++ VY +V+ AHPQEP+Q
Sbjct  1020  CNSQLVYASFSDGNVGVFDADTLRLRCRVAPSAYLPQAVLTGSQSVYPLVVAAHPQEPSQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KVIEPLES G+WG+S
Sbjct  1080  FAVGLSDGTVKVIEPLESEGKWGLS  1104



>emb|CAN79774.1| hypothetical protein VITISV_013612 [Vitis vinifera]
Length=1088

 Score =   131 bits (330),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAYLSQA LN ++  Y VV+ +HPQE NQ
Sbjct  976   CNSQLIYATFCDGNIGVFDADSLRLRCRIAPSAYLSQAALNGSQPPYPVVVASHPQESNQ  1035

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES G+WG+S
Sbjct  1036  LAVGLTDGSVKVIEPPESEGKWGVS  1060



>ref|XP_009611828.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1101

 Score =   131 bits (329),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR +C IAPSAYLSQAVL  ++ VY +VI AHPQEPNQ
Sbjct  988   CNSQLVYASFCDGNIGVFDADSLRLKCRIAPSAYLSQAVLIGSQAVYPLVIAAHPQEPNQ  1047

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A GL+DG +KVIEPLES G+WG
Sbjct  1048  IAVGLSDGIVKVIEPLESEGKWG  1070



>ref|XP_009611827.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1129

 Score =   131 bits (329),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR +C IAPSAYLSQAVL  ++ VY +VI AHPQEPNQ
Sbjct  1016  CNSQLVYASFCDGNIGVFDADSLRLKCRIAPSAYLSQAVLIGSQAVYPLVIAAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A GL+DG +KVIEPLES G+WG
Sbjct  1076  IAVGLSDGIVKVIEPLESEGKWG  1098



>ref|XP_007204953.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
 gb|EMJ06152.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
Length=1134

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F D NIGVFDA  LR RC IAPSAYLSQAVLN ++ VY +V+  HPQEPNQ
Sbjct  1020  CNSQLVYAAFSDSNIGVFDADTLRLRCRIAPSAYLSQAVLNGSQAVYPLVVAVHPQEPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1080  FAVGLGDGSVKVIEPTESEGKWGSS  1104



>ref|XP_008795824.1| PREDICTED: topless-related protein 2-like [Phoenix dactylifera]
Length=1029

 Score =   130 bits (326),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QL+YA+F DGNIGVFDA  LR RC IAPSAY+S A  N N  VY +VI AHPQEPNQ
Sbjct  917  CNSQLVYATFCDGNIGVFDADNLRLRCRIAPSAYMSPATANSNLPVYPLVIAAHPQEPNQ  976

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
            LA GLTDG++KVIEPLES G+WG
Sbjct  977  LAVGLTDGAVKVIEPLESEGKWG  999



>ref|XP_002283157.1| PREDICTED: topless-related protein 3 [Vitis vinifera]
 emb|CBI39553.3| unnamed protein product [Vitis vinifera]
Length=1132

 Score =   130 bits (326),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAYLSQA LN ++  Y VV+ +HPQE NQ
Sbjct  1020  CNSQLIYATFCDGNIGVFDADSLRLRCRIAPSAYLSQAGLNGSQPPYPVVVASHPQESNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES G+WG+S
Sbjct  1080  LAVGLTDGSVKVIEPPESEGKWGVS  1104



>ref|XP_008790866.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Phoenix dactylifera]
Length=1138

 Score =   129 bits (325),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC I PSAY+S A  N N  VY +V+ AHPQEPNQ
Sbjct  1024  CNSQLVYASFCDGNIGVFDADNLRLRCRIGPSAYMSPASANSNPPVYPLVVAAHPQEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             LA GLTDG++KVIEPLES G+WG
Sbjct  1084  LAVGLTDGAVKVIEPLESEGKWG  1106



>ref|XP_010259448.1| PREDICTED: topless-related protein 2 isoform X1 [Nelumbo nucifera]
Length=1136

 Score =   129 bits (324),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IAPS+YL Q+V N +  VY +V+ AHPQEPNQ
Sbjct  1024  CNSQLVYATFCDGNIGVFDADSLRLRCRIAPSSYLPQSVSNSSHAVYPLVVAAHPQEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS KVIEP ES G+WG++
Sbjct  1084  LAVGLTDGSAKVIEPSESEGKWGVT  1108



>ref|XP_010259450.1| PREDICTED: topless-related protein 2 isoform X3 [Nelumbo nucifera]
Length=1099

 Score =   129 bits (323),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IAPS+YL Q+V N +  VY +V+ AHPQEPNQ
Sbjct  987   CNSQLVYATFCDGNIGVFDADSLRLRCRIAPSSYLPQSVSNSSHAVYPLVVAAHPQEPNQ  1046

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS KVIEP ES G+WG++
Sbjct  1047  LAVGLTDGSAKVIEPSESEGKWGVT  1071



>ref|XP_002512473.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49925.1| WD-repeat protein, putative [Ricinus communis]
Length=1132

 Score =   128 bits (321),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLI+ASF+DGNIGVFDA  LR RC IAPSAYLS AVLN ++ +Y +V+ AHP E NQ
Sbjct  1020  CNSQLIFASFRDGNIGVFDADSLRLRCRIAPSAYLSPAVLNGSQSIYPLVVAAHPHETNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KV+EP  S G+WG S
Sbjct  1080  LAVGLTDGSVKVMEPKASDGKWGTS  1104



>ref|XP_008245640.1| PREDICTED: topless-related protein 3 [Prunus mume]
Length=1134

 Score =   127 bits (320),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F D NIGVFDA  LR RC IAPSAYLS AVLN ++ VY +V+  HPQEPNQ
Sbjct  1020  CNSQLVYAAFSDSNIGVFDADTLRLRCRIAPSAYLSLAVLNGSQAVYPLVVAVHPQEPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1080  FAVGLGDGSVKVIEPTESEGKWGSS  1104



>ref|XP_008388509.1| PREDICTED: topless-related protein 3-like [Malus domestica]
Length=1135

 Score =   127 bits (318),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAYL QAVLN ++ +Y +V+  HPQEP Q
Sbjct  1022  CNSQLIYAAFYDGNIGVFDADSLRLRCRIAPSAYLPQAVLNGSQAMYPLVVAVHPQEPTQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1082  FAVGLGDGSVKVIEPKESEGKWGSS  1106



>gb|KDO81756.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1096

 Score =   126 bits (317),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ
Sbjct  985   CNSQLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQ  1044

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KV+EP ES G+WG+S
Sbjct  1045  FAIGLTDGSVKVMEPSESEGKWGVS  1069



>gb|KDO81755.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1101

 Score =   126 bits (317),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ
Sbjct  990   CNSQLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQ  1049

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KV+EP ES G+WG+S
Sbjct  1050  FAIGLTDGSVKVMEPSESEGKWGVS  1074



>gb|KDO81757.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1128

 Score =   126 bits (317),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ
Sbjct  1017  CNSQLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQ  1076

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KV+EP ES G+WG+S
Sbjct  1077  FAIGLTDGSVKVMEPSESEGKWGVS  1101



>ref|XP_006433483.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
 gb|ESR46723.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
Length=1130

 Score =   126 bits (317),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ
Sbjct  1019  CNSQLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KV+EP ES G+WG+S
Sbjct  1079  FAIGLTDGSVKVMEPSESEGKWGVS  1103



>ref|XP_010094719.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB56799.1| Topless-related protein 3 [Morus notabilis]
Length=1117

 Score =   126 bits (317),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFD   LR RC IAPSAY SQAVLN ++ VY +V+ AHP E NQ
Sbjct  1020  CNSQLIYATFCDGNIGVFDPDSLRLRCRIAPSAYFSQAVLNGSQAVYPLVVAAHPHEANQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP E+ G+WG +
Sbjct  1080  FAVGLTDGSVKVIEPTEAEGKWGTA  1104



>ref|XP_004144768.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
 gb|KGN60972.1| hypothetical protein Csa_2G033270 [Cucumis sativus]
Length=1127

 Score =   126 bits (316),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGN+GVFDA  LR RC IAPS YL  AVLN ++ +Y +V+  HP +PNQ
Sbjct  1015  CNSQLVYATFCDGNVGVFDADTLRLRCRIAPSVYLPSAVLNSSQAIYPLVVATHPLDPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GL+DGS+KVIEP ES G+WG+S
Sbjct  1075  LAIGLSDGSVKVIEPTESEGKWGVS  1099



>ref|XP_004158753.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
Length=1126

 Score =   126 bits (316),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGN+GVFDA  LR RC IAPS YL  AVLN ++ +Y +V+  HP +PNQ
Sbjct  1014  CNSQLVYATFCDGNVGVFDADTLRLRCRIAPSVYLPSAVLNSSQAIYPLVVATHPLDPNQ  1073

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GL+DGS+KVIEP ES G+WG+S
Sbjct  1074  LAIGLSDGSVKVIEPTESEGKWGVS  1098



>ref|XP_010921589.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1135

 Score =   125 bits (314),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IAP AY+S A  N N  VY +VI AHPQEPNQ
Sbjct  1023  CNSQLVYATFCDGNIGVFDADNLRLRCRIAPLAYMSPASANSNPPVYPLVIAAHPQEPNQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             LA GLTDG++KVIEP ES G+WG
Sbjct  1083  LAVGLTDGAVKVIEPSESEGKWG  1105



>ref|XP_010921588.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1136

 Score =   125 bits (314),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IAP AY+S A  N N  VY +VI AHPQEPNQ
Sbjct  1024  CNSQLVYATFCDGNIGVFDADNLRLRCRIAPLAYMSPASANSNPPVYPLVIAAHPQEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             LA GLTDG++KVIEP ES G+WG
Sbjct  1084  LAVGLTDGAVKVIEPSESEGKWG  1106



>ref|XP_010259449.1| PREDICTED: topless-related protein 2 isoform X2 [Nelumbo nucifera]
Length=1135

 Score =   125 bits (313),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IAPS+YL Q+V N +  VY +V+ AHPQEPNQ
Sbjct  1024  CNSQLVYATFCDGNIGVFDADSLRLRCRIAPSSYLPQSVSN-SHAVYPLVVAAHPQEPNQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS KVIEP ES G+WG++
Sbjct  1083  LAVGLTDGSAKVIEPSESEGKWGVT  1107



>gb|KDO71780.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1131

 Score =   125 bits (313),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQ
Sbjct  1019  CNSQLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPNSSQTVFPLVVTSHPQEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP E+  +WG++
Sbjct  1079  LAVGLTDGSVKVIEPSETERKWGVA  1103



>ref|XP_006489020.1| PREDICTED: topless-related protein 2-like isoform X2 [Citrus 
sinensis]
Length=1131

 Score =   125 bits (313),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQ
Sbjct  1019  CNSQLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPNSSQTVFPLVVTSHPQEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP E+  +WG++
Sbjct  1079  LAVGLTDGSVKVIEPSETERKWGVA  1103



>ref|XP_006419483.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
 gb|ESR32723.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
Length=1131

 Score =   125 bits (313),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQ
Sbjct  1019  CNSQLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPNSSQTVFPLVVTSHPQEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP E+  +WG++
Sbjct  1079  LAVGLTDGSVKVIEPSETERKWGVA  1103



>ref|XP_004494565.1| PREDICTED: topless-related protein 3-like [Cicer arietinum]
Length=1151

 Score =   125 bits (313),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGN GVFDA  LR RC IAPS Y + + LN ++GVY VV+ AHP EPNQ
Sbjct  1038  CNSQLIYATFCDGNTGVFDADSLRLRCRIAPSMYFTPSTLNGSQGVYPVVVAAHPLEPNQ  1097

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES G+WG S
Sbjct  1098  FALGLTDGSVKVIEPNESEGKWGSS  1122



>ref|XP_006472151.1| PREDICTED: topless-related protein 3-like [Citrus sinensis]
Length=1128

 Score =   125 bits (313),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY  V+ AHP EPNQ
Sbjct  1017  CNSQLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPHVVAAHPLEPNQ  1076

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KV+EP ES G+WG+S
Sbjct  1077  FAIGLTDGSVKVMEPSESEGKWGVS  1101



>ref|XP_006644007.1| PREDICTED: topless-related protein 2-like [Oryza brachyantha]
Length=1128

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -3

Query  714   NCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQL  535
             N QL++A+F DGNIG+FD   LR RC IAP AY+S A +N N  VY +V+ AHPQEPNQ 
Sbjct  1017  NSQLVFAAFTDGNIGIFDVENLRLRCRIAPPAYMSSATINSNPSVYPLVVAAHPQEPNQF  1076

Query  534   AFGLTDGSIKVIEPLESGGEWGIS  463
             A GL+DGS+KVIEPLES G+WG +
Sbjct  1077  AVGLSDGSVKVIEPLESEGKWGTT  1100



>ref|XP_010938347.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1134

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DG+IGVFDA  LR RC I PSAY+S A  N N  V+ +V+ AHPQEPNQ
Sbjct  1022  CNSQLVYASFWDGSIGVFDADYLRLRCRIGPSAYMSPANANSNPPVHPLVVAAHPQEPNQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             LA GLTDG++KVIEPLES G+WG
Sbjct  1082  LAVGLTDGAVKVIEPLESEGKWG  1104



>ref|XP_010938346.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1135

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DG+IGVFDA  LR RC I PSAY+S A  N N  V+ +V+ AHPQEPNQ
Sbjct  1023  CNSQLVYASFWDGSIGVFDADYLRLRCRIGPSAYMSPANANSNPPVHPLVVAAHPQEPNQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             LA GLTDG++KVIEPLES G+WG
Sbjct  1083  LAVGLTDGAVKVIEPLESEGKWG  1105



>ref|XP_009338219.1| PREDICTED: topless-related protein 3 isoform X2 [Pyrus x bretschneideri]
Length=1123

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAYL Q VLN ++ +Y +V+  HPQEP Q
Sbjct  1010  CNSQLIYAAFCDGNIGVFDADSLRLRCRIAPSAYLPQVVLNGSQAMYPLVVAVHPQEPTQ  1069

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1070  FAVGLGDGSVKVIEPNESEGKWGSS  1094



>ref|XP_009338217.1| PREDICTED: topless-related protein 3 isoform X1 [Pyrus x bretschneideri]
Length=1135

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAYL Q VLN ++ +Y +V+  HPQEP Q
Sbjct  1022  CNSQLIYAAFCDGNIGVFDADSLRLRCRIAPSAYLPQVVLNGSQAMYPLVVAVHPQEPTQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1082  FAVGLGDGSVKVIEPNESEGKWGSS  1106



>ref|XP_004508183.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1125

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IA SAYL Q+  N ++ +Y  VI AHPQEPNQ
Sbjct  1019  CNSQLVYAAFTDGNIGVFDADSLRLRCRIASSAYLHQSSSN-SQNIYPFVIAAHPQEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A G++DGSIKVIEPLES G WG+S
Sbjct  1078  FAVGMSDGSIKVIEPLESNGRWGVS  1102



>ref|XP_010024093.1| PREDICTED: topless-related protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW60527.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1137

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF DGN+GVFDA  LR RC I PS YL Q +L  ++ VY +VI  HP EPNQ
Sbjct  1025  CNSQLIYASFCDGNVGVFDADTLRLRCRIGPSTYLPQPILTGSQAVYPLVIATHPHEPNQ  1084

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KV+EP ES G+WG +
Sbjct  1085  LAIGLTDGSVKVLEPTESDGKWGAT  1109



>gb|KCW60526.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1138

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF DGN+GVFDA  LR RC I PS YL Q +L  ++ VY +VI  HP EPNQ
Sbjct  1026  CNSQLIYASFCDGNVGVFDADTLRLRCRIGPSTYLPQPILTGSQAVYPLVIATHPHEPNQ  1085

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KV+EP ES G+WG +
Sbjct  1086  LAIGLTDGSVKVLEPTESDGKWGAT  1110



>ref|XP_010024094.1| PREDICTED: topless-related protein 3 isoform X2 [Eucalyptus grandis]
Length=1130

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF DGN+GVFDA  LR RC I PS YL Q +L  ++ VY +VI  HP EPNQ
Sbjct  1018  CNSQLIYASFCDGNVGVFDADTLRLRCRIGPSTYLPQPILTGSQAVYPLVIATHPHEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KV+EP ES G+WG +
Sbjct  1078  LAIGLTDGSVKVLEPTESDGKWGAT  1102



>ref|XP_008370406.1| PREDICTED: topless-related protein 3-like isoform X2 [Malus domestica]
Length=1123

 Score =   123 bits (309),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAY+ QA LN ++ +Y +V+  HPQEP Q
Sbjct  1010  CNSQLIYAAFCDGNIGVFDADSLRLRCRIAPSAYIPQAALNGSQAMYPLVVAVHPQEPTQ  1069

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1070  FAVGLGDGSVKVIEPNESEGKWGSS  1094



>ref|XP_008370405.1| PREDICTED: topless-related protein 3-like isoform X1 [Malus domestica]
Length=1135

 Score =   123 bits (309),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAY+ QA LN ++ +Y +V+  HPQEP Q
Sbjct  1022  CNSQLIYAAFCDGNIGVFDADSLRLRCRIAPSAYIPQAALNGSQAMYPLVVAVHPQEPTQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DGS+KVIEP ES G+WG S
Sbjct  1082  FAVGLGDGSVKVIEPNESEGKWGSS  1106



>ref|XP_008453896.1| PREDICTED: topless-related protein 3-like [Cucumis melo]
Length=1127

 Score =   123 bits (309),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  LR RC IAPS YL   +LN ++ +Y +V+  HP +PNQ
Sbjct  1015  CNSQLVYATFCDGNIGVFDADTLRLRCRIAPSVYLPPTLLNSSQAIYPLVVATHPLDPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GL+DGS+KVIEP ES G+WG+S
Sbjct  1075  LAIGLSDGSVKVIEPTESEGKWGVS  1099



>ref|XP_010086586.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB21430.1| Topless-related protein 3 [Morus notabilis]
Length=1132

 Score =   123 bits (308),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F D NIGVFD   LR RC IAPSAY SQAVLN ++ VY +V+ AHP E NQ
Sbjct  1020  CNSQLIYATFCDCNIGVFDPDSLRLRCRIAPSAYFSQAVLNGSQAVYPLVVAAHPHEANQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP E+ G+WG +
Sbjct  1080  FAVGLTDGSVKVIEPTEAEGKWGTA  1104



>ref|XP_007163344.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35338.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1102

 Score =   122 bits (306),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGN GVFDA  LR RC IA S Y S A L+ N+ VY VV+ AHP EPNQ
Sbjct  990   CNSQLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPATLSVNQSVYPVVVAAHPAEPNQ  1049

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES G+WG S
Sbjct  1050  FAVGLTDGSVKVIEPCESEGKWGTS  1074



>ref|XP_007163345.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35339.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1130

 Score =   122 bits (306),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGN GVFDA  LR RC IA S Y S A L+ N+ VY VV+ AHP EPNQ
Sbjct  1018  CNSQLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPATLSVNQSVYPVVVAAHPAEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES G+WG S
Sbjct  1078  FAVGLTDGSVKVIEPCESEGKWGTS  1102



>gb|EAY73338.1| hypothetical protein OsI_01216 [Oryza sativa Indica Group]
Length=1118

 Score =   122 bits (305),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  714   NCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQL  535
             N QL++A+F DGNIG+FD   LR RC IAP AYLS A +N N  VY +V+ AHPQE NQ 
Sbjct  1007  NSQLVFAAFTDGNIGIFDVENLRLRCRIAPPAYLSSAAINSNPSVYPLVVAAHPQESNQF  1066

Query  534   AFGLTDGSIKVIEPLESGGEWGIS  463
             A GL+DGS+KVIEPLES G+WG +
Sbjct  1067  AVGLSDGSVKVIEPLESEGKWGTT  1090



>ref|XP_009421409.1| PREDICTED: topless-related protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=1134

 Score =   121 bits (304),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAY++ A  + N  VY +VI  HPQEPNQ
Sbjct  1022  CNSQLVYASFCDGNIGVFDADNLRLRCRIAPSAYMTPAAASSNLPVYPLVIAVHPQEPNQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL DG++KV EPLES G+WG
Sbjct  1082  FAVGLADGAVKVFEPLESEGKWG  1104



>ref|NP_001042616.1| Os01g0254100 [Oryza sativa Japonica Group]
 dbj|BAD81067.1| putative CTV.2 [Oryza sativa Japonica Group]
 dbj|BAF04530.1| Os01g0254100 [Oryza sativa Japonica Group]
 gb|EEE54253.1| hypothetical protein OsJ_01134 [Oryza sativa Japonica Group]
 dbj|BAL44268.1| ASPR2 protein [Oryza sativa Japonica Group]
Length=1129

 Score =   121 bits (304),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  714   NCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQL  535
             N QL++A+F DGNIG+FD   LR RC IAP AYLS A +N N  VY +V+ AHPQE NQ 
Sbjct  1018  NSQLVFAAFTDGNIGIFDVENLRLRCRIAPPAYLSSAAINSNPSVYPLVVAAHPQESNQF  1077

Query  534   AFGLTDGSIKVIEPLESGGEWGIS  463
             A GL+DGS+KVIEPLES G+WG +
Sbjct  1078  AVGLSDGSVKVIEPLESEGKWGTT  1101



>ref|XP_010546752.1| PREDICTED: topless-related protein 3 isoform X2 [Tarenaya hassleriana]
Length=1108

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F+DGNIGVFDA  LR RC IAPSAYLSQ     ++G+  +V+ AHP EPNQ
Sbjct  1002  CNSQLIYAAFRDGNIGVFDADSLRLRCRIAPSAYLSQG----SQGLPPLVVAAHPHEPNQ  1057

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GLTDGS+KVIEP E  G+WG+
Sbjct  1058  LAVGLTDGSVKVIEPTEPEGKWGM  1081



>ref|XP_010546750.1| PREDICTED: topless-related protein 3 isoform X1 [Tarenaya hassleriana]
Length=1110

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F+DGNIGVFDA  LR RC IAPSAYLSQ     ++G+  +V+ AHP EPNQ
Sbjct  1004  CNSQLIYAAFRDGNIGVFDADSLRLRCRIAPSAYLSQG----SQGLPPLVVAAHPHEPNQ  1059

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GLTDGS+KVIEP E  G+WG+
Sbjct  1060  LAVGLTDGSVKVIEPTEPEGKWGM  1083



>ref|XP_003566431.1| PREDICTED: topless-related protein 2-like isoform X1 [Brachypodium 
distachyon]
Length=1132

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S    N N  VY  V+ AHPQEPNQ
Sbjct  1020  CNSQLVFAAFTDGNVAIFDAENLRLRCRIASSAYMSSTATNSNPPVYPYVVAAHPQEPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KV+EPLES G+WG S
Sbjct  1080  FAVGLSDGSVKVMEPLESDGKWGTS  1104



>ref|XP_010230707.1| PREDICTED: topless-related protein 2-like isoform X3 [Brachypodium 
distachyon]
Length=1116

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S    N N  VY  V+ AHPQEPNQ
Sbjct  1004  CNSQLVFAAFTDGNVAIFDAENLRLRCRIASSAYMSSTATNSNPPVYPYVVAAHPQEPNQ  1063

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KV+EPLES G+WG S
Sbjct  1064  FAVGLSDGSVKVMEPLESDGKWGTS  1088



>ref|XP_010230706.1| PREDICTED: topless-related protein 2-like isoform X2 [Brachypodium 
distachyon]
Length=1121

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S    N N  VY  V+ AHPQEPNQ
Sbjct  1009  CNSQLVFAAFTDGNVAIFDAENLRLRCRIASSAYMSSTATNSNPPVYPYVVAAHPQEPNQ  1068

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KV+EPLES G+WG S
Sbjct  1069  FAVGLSDGSVKVMEPLESDGKWGTS  1093



>dbj|BAJ96033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ
Sbjct  1018  CNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DGS+KV+EPLES G+WG
Sbjct  1078  FAVGLSDGSVKVMEPLESDGKWG  1100



>dbj|BAJ85297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ
Sbjct  1018  CNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DGS+KV+EPLES G+WG
Sbjct  1078  FAVGLSDGSVKVMEPLESDGKWG  1100



>ref|XP_006606545.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN20263.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score =   121 bits (303),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ
Sbjct  1018  CNSQLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES G+WG S
Sbjct  1078  FAVGLTDGSVKVIEPNESEGKWGTS  1102



>ref|XP_007099669.1| TOPLESS-related 3 [Theobroma cacao]
 gb|EOY20361.1| TOPLESS-related 3 [Theobroma cacao]
Length=238

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q +YA+F DGN+GVF+A  LR RC IA S YLSQA+L   + VY +V+ AHP E NQ
Sbjct  126  CNNQSVYATFLDGNVGVFEADSLRLRCRIASSVYLSQAILKGKQAVYPLVVAAHPMEANQ  185

Query  537  LAFGLTDGSIKVIEPLESGGEWGISR  460
             A GL+DGS+KV+EP ES G+WG+S+
Sbjct  186  FAIGLSDGSVKVMEPTESEGKWGVSQ  211



>ref|XP_004495685.1| PREDICTED: topless-related protein 3-like isoform X2 [Cicer arietinum]
Length=1123

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF D NIGVFDA  L+ RC IAPS  LS A LNR++ VY +VI  HP EPNQ
Sbjct  1016  CNSQLIYASFCDANIGVFDADSLKLRCRIAPSICLSSAALNRSQAVYPLVIATHPLEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A G++DGS+KVIEP ES G+WG S
Sbjct  1076  FAVGMSDGSVKVIEPSESEGKWGSS  1100



>ref|XP_004495684.1| PREDICTED: topless-related protein 3-like isoform X1 [Cicer arietinum]
Length=1124

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF D NIGVFDA  L+ RC IAPS  LS A LNR++ VY +VI  HP EPNQ
Sbjct  1017  CNSQLIYASFCDANIGVFDADSLKLRCRIAPSICLSSAALNRSQAVYPLVIATHPLEPNQ  1076

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A G++DGS+KVIEP ES G+WG S
Sbjct  1077  FAVGMSDGSVKVIEPSESEGKWGSS  1101



>ref|XP_004967836.1| PREDICTED: topless-related protein 2-like [Setaria italica]
Length=1130

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+GVFDA  LR RC IAPS Y+S   +N N  V+ +V+ AHP EPNQ
Sbjct  1018  CNSQLVFAAFADGNVGVFDAENLRLRCRIAPSVYMSLTAINSNPPVHPLVVAAHPNEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DGS+KV+EPLES G+WG
Sbjct  1078  FAVGLSDGSVKVLEPLESEGKWG  1100



>gb|AAB61051.1| Hypothetical protein F2P16.14 [Arabidopsis thaliana]
Length=123

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQ+PNQ
Sbjct  21   CNSQLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQDPNQ  76

Query  537  LAFGLTDGSIKVIEPLESGGEWGI  466
             A GL DGS+K++EP E  G+WG+
Sbjct  77   FAVGLNDGSVKMMEPTEGEGKWGM  100



>dbj|BAJ88304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ
Sbjct  497  CNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQ  556

Query  537  LAFGLTDGSIKVIEPLESGGEWGI  466
             A GL+DGS+KV+EPLES G+WG 
Sbjct  557  FAVGLSDGSVKVMEPLESDGKWGT  580



>gb|KDO71781.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1130

 Score =   120 bits (302),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQ
Sbjct  1019  CNSQLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPN-SQTVFPLVVTSHPQEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP E+  +WG++
Sbjct  1078  LAVGLTDGSVKVIEPSETERKWGVA  1102



>ref|XP_006489019.1| PREDICTED: topless-related protein 2-like isoform X1 [Citrus 
sinensis]
Length=1130

 Score =   120 bits (302),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQ
Sbjct  1019  CNSQLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPN-SQTVFPLVVTSHPQEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP E+  +WG++
Sbjct  1078  LAVGLTDGSVKVIEPSETERKWGVA  1102



>ref|XP_003591186.1| WD repeat-containing protein [Medicago truncatula]
Length=1140

 Score =   120 bits (302),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF D NIGVFDA  LR RC IAP   LS A L+R++ VY +VI AHP EPNQ
Sbjct  1028  CNSQLIYASFCDANIGVFDADSLRLRCRIAPPICLSSAALSRSQAVYPLVIAAHPLEPNQ  1087

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KVIEP ES G+WG S
Sbjct  1088  FAVGLSDGSVKVIEPSESEGKWGSS  1112



>gb|ABD28351.1| Lissencephaly type-1-like homology motif; CTLH, C-terminal to 
LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; 
Quinonprotein alcohol dehydrogenase-like [Medicago truncatula]
 gb|AES61437.2| topless-like protein [Medicago truncatula]
Length=1128

 Score =   120 bits (301),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF D NIGVFDA  LR RC IAP   LS A L+R++ VY +VI AHP EPNQ
Sbjct  1016  CNSQLIYASFCDANIGVFDADSLRLRCRIAPPICLSSAALSRSQAVYPLVIAAHPLEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KVIEP ES G+WG S
Sbjct  1076  FAVGLSDGSVKVIEPSESEGKWGSS  1100



>emb|CDM82632.1| unnamed protein product [Triticum aestivum]
Length=1130

 Score =   120 bits (300),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  VY  V+  HPQEPNQ
Sbjct  1018  CNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPVYPFVVAGHPQEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DGS+KV+EPLES G+WG
Sbjct  1078  FAVGLSDGSVKVMEPLESDGKWG  1100



>ref|XP_006589130.1| PREDICTED: topless-related protein 3-like isoform X1 [Glycine 
max]
Length=1129

 Score =   119 bits (299),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ
Sbjct  1017  CNSQLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQ  1076

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDGS+KVIEP ES G+WG
Sbjct  1077  FAVGLTDGSVKVIEPNESEGKWG  1099



>gb|KHN16088.1| Topless-related protein 3 [Glycine soja]
Length=1121

 Score =   119 bits (299),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ
Sbjct  1009  CNSQLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQ  1068

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDGS+KVIEP ES G+WG
Sbjct  1069  FAVGLTDGSVKVIEPNESEGKWG  1091



>ref|XP_010043204.1| PREDICTED: topless-related protein 3-like [Eucalyptus grandis]
 gb|KCW85231.1| hypothetical protein EUGRSUZ_B02075 [Eucalyptus grandis]
Length=1131

 Score =   119 bits (299),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN  L+YA+F DGNIGVFDA  LR RC IAPS YLS   LN ++ VY  V+  HP EPNQ
Sbjct  1019  CNSLLVYATFCDGNIGVFDADNLRLRCRIAPSTYLSHGALNGSQPVYPFVVATHPVEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KV+EP ES G+WG +
Sbjct  1079  LAVGLTDGSVKVMEPAESDGKWGAT  1103



>ref|XP_006589131.1| PREDICTED: topless-related protein 3-like isoform X2 [Glycine 
max]
Length=1153

 Score =   119 bits (299),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ
Sbjct  1041  CNSQLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQ  1100

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDGS+KVIEP ES G+WG
Sbjct  1101  FAVGLTDGSVKVIEPNESEGKWG  1123



>ref|XP_003626186.1| hypothetical protein MTR_7g112460 [Medicago truncatula]
 gb|AES82404.1| topless-like protein [Medicago truncatula]
Length=1129

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLI+A+F DGN GVFDA  LR RC IAPS Y +   L+ ++ VY  V+ AHP EPNQ
Sbjct  1018  CNSQLIFATFCDGNTGVFDADSLRLRCRIAPSTYFTATTLSGSQAVYPFVVAAHPLEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP+ES G+WG S
Sbjct  1078  FALGLTDGSVKVIEPIESEGKWGSS  1102



>dbj|BAJ91882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ
Sbjct  658  CNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQ  717

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GL+DGS+KV+EPLES G+WG
Sbjct  718  FAVGLSDGSVKVMEPLESDGKWG  740



>gb|EPS69182.1| hypothetical protein M569_05580, partial [Genlisea aurea]
Length=1123

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAV-LNRNEGVYAVVIVAHPQEPN  541
             CN QL++ASF DGN+G+FDA  LR RC IA S+YLSQA  LN ++  Y VVI AHPQEPN
Sbjct  1021  CNSQLVFASFCDGNVGIFDADTLRLRCRIASSSYLSQAAALNGSQPPYPVVIAAHPQEPN  1080

Query  540   QLAFGLTDGSIKVIEPLESGGEWG  469
             Q A GL+DGS+KVIEPLE+  +WG
Sbjct  1081  QFAVGLSDGSVKVIEPLEAENKWG  1104



>emb|CDY25010.1| BnaC02g39980D [Brassica napus]
Length=1112

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ
Sbjct  1009  CNSQLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQ  1064

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+KVIEP E+ G+WG+
Sbjct  1065  FAVGLNDGSVKVIEPTEAEGKWGM  1088



>emb|CDY05552.1| BnaA02g31390D [Brassica napus]
Length=1111

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ
Sbjct  1008  CNSQLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQ  1063

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+KVIEP E+ G+WG+
Sbjct  1064  FAVGLNDGSVKVIEPTEAEGKWGM  1087



>ref|XP_009129893.1| PREDICTED: topless-related protein 3 [Brassica rapa]
Length=1116

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ
Sbjct  1013  CNSQLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQ  1068

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+KVIEP E+ G+WG+
Sbjct  1069  FAVGLNDGSVKVIEPTEAEGKWGM  1092



>ref|XP_010528913.1| PREDICTED: topless-related protein 3-like [Tarenaya hassleriana]
Length=1106

 Score =   118 bits (295),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGN+GVFDA  LR RC IAP+ YLSQA LN    ++  V+ AHP + NQ
Sbjct  996   CNSQLIYATFCDGNVGVFDADSLRLRCRIAPNTYLSQAALNAKPPIHPFVVAAHPHDQNQ  1055

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS+KV+EP ES G+WG+
Sbjct  1056  FAVGLTDGSVKVLEPSESEGKWGV  1079



>ref|XP_006604796.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN43327.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score =   118 bits (295),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 57/86 (66%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLS-QAVLNRNEGVYAVVIVAHPQEPN  541
             CN QLIYA+F DGN GVFDA  LR RC IA S Y S  A L+ N+ VY VV+ AHP EPN
Sbjct  1017  CNSQLIYATFSDGNTGVFDADSLRLRCRIALSTYFSPAAALSGNQSVYPVVVAAHPLEPN  1076

Query  540   QLAFGLTDGSIKVIEPLESGGEWGIS  463
             Q A GLTDGS+KVIEP ES G+WG S
Sbjct  1077  QFAVGLTDGSVKVIEPSESEGKWGTS  1102



>ref|XP_007144973.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
 gb|ESW16967.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
Length=1132

 Score =   118 bits (295),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F D NIGVFDA  LR RC IAPS  LS A LN +  +Y +V+ AHP EPNQ
Sbjct  1020  CNSQLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALNGSPSLYPLVVAAHPLEPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP ES G+WG S
Sbjct  1080  FAVGLTDGSVKVIEPSESEGKWGSS  1104



>ref|XP_010524852.1| PREDICTED: topless-related protein 3-like isoform X2 [Tarenaya 
hassleriana]
Length=1115

 Score =   117 bits (294),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F+DGNIG+FDA  LR RC IAP+AYL +     ++G+  +V+ AHPQEPNQ
Sbjct  1009  CNSQLIYAAFRDGNIGIFDADSLRLRCRIAPTAYLPRG----SQGLAPLVVAAHPQEPNQ  1064

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP E  G+WG++
Sbjct  1065  FAIGLTDGSVKVIEPTEPEGKWGMA  1089



>ref|XP_010524851.1| PREDICTED: topless-related protein 3-like isoform X1 [Tarenaya 
hassleriana]
Length=1117

 Score =   117 bits (294),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F+DGNIG+FDA  LR RC IAP+AYL +     ++G+  +V+ AHPQEPNQ
Sbjct  1011  CNSQLIYAAFRDGNIGIFDADSLRLRCRIAPTAYLPRG----SQGLAPLVVAAHPQEPNQ  1066

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS+KVIEP E  G+WG++
Sbjct  1067  FAIGLTDGSVKVIEPTEPEGKWGMA  1091



>ref|XP_006394928.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
 gb|ESQ32214.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
Length=1136

 Score =   117 bits (292),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+ +  +V+ AHPQEPNQ
Sbjct  1033  CNSQLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQSLSPLVVAAHPQEPNQ  1088

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+KVIEP E+ G+WGI
Sbjct  1089  FAVGLNDGSVKVIEPTEAEGKWGI  1112



>ref|XP_007031067.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY11569.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=1761

 Score =   117 bits (293),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q +YA+F+DGN+GVFDA  L  RC I+ S YLSQA+L  N+ VY +V+ AHP E NQ
Sbjct  1614  CNSQSVYATFRDGNVGVFDADSLILRCRISSSVYLSQAILKGNQVVYPLVVAAHPMEANQ  1673

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KV+EP ES G+WG+S
Sbjct  1674  FAIGLSDGSVKVMEPTESEGKWGVS  1698



>emb|CDX88252.1| BnaA06g28430D [Brassica napus]
Length=1109

 Score =   117 bits (292),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F+DGNIGVFDA  L  RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ
Sbjct  1011  CNSQLIYATFRDGNIGVFDADTLGLRCRISPSAYLPQV----NQGLSPLVVAAHPQEPNQ  1066

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+KVIEP E+ G+WG+
Sbjct  1067  FAVGLNDGSVKVIEPTEAEGKWGM  1090



>ref|XP_007031064.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
 gb|EOY11566.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
Length=1132

 Score =   116 bits (291),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q +YA+F DGN+GVFDA  LR RC I+ S YLSQA+L  N+ VY +V+ AHP E NQ
Sbjct  1020  CNSQSVYATFCDGNVGVFDADSLRLRCRISSSVYLSQAILKGNQAVYPLVVAAHPMEANQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+KV+E  ES G+WG+S
Sbjct  1080  FAIGLSDGSVKVMESTESEGKWGVS  1104



>gb|KJB26374.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1134

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ
Sbjct  1021  CNSQSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQ  1080

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KV+EP ES G+WG+S
Sbjct  1081  FAIGLSDGTVKVLEPSESEGKWGVS  1105



>gb|KJB26372.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1157

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ
Sbjct  1044  CNSQSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQ  1103

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KV+EP ES G+WG+S
Sbjct  1104  FAIGLSDGTVKVLEPSESEGKWGVS  1128



>gb|KJB26373.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1161

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ
Sbjct  1048  CNSQSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQ  1107

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KV+EP ES G+WG+S
Sbjct  1108  FAIGLSDGTVKVLEPSESEGKWGVS  1132



>gb|KHG26583.1| Topless-related 3 -like protein [Gossypium arboreum]
Length=1134

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q IYA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ
Sbjct  1021  CNSQSIYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQ  1080

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A G++DG++KV+EP ES G+WG+S
Sbjct  1081  FAIGVSDGTVKVLEPSESEGKWGVS  1105



>gb|AES91919.2| topless-like protein [Medicago truncatula]
Length=1122

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DG+IGVFD+  LR RC IA SAYL Q+  + ++ +Y  V+ AHPQEPNQ
Sbjct  1016  CNSQLVYAAFTDGSIGVFDSDSLRLRCRIASSAYLHQSS-SISQNIYPFVVAAHPQEPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A G++DGSIKVIEP+E  G WG+S
Sbjct  1075  FAVGMSDGSIKVIEPIEPNGRWGVS  1099



>ref|XP_009151171.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 3 [Brassica 
rapa]
Length=1112

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  L  RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ
Sbjct  1011  CNSQLIYTTFRDGNIGVFDADTLGLRCRISPSAYLPQV----NQGLSPLVVAAHPQEPNQ  1066

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+KVIEP E+ G+WG+
Sbjct  1067  FAVGLNDGSVKVIEPTEAEGKWGM  1090



>ref|XP_002307097.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE94093.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1133

 Score =   114 bits (285),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPS Y      N ++ VY +V+  HP +PNQ
Sbjct  1027  CNSQLIYATFCDGNIGVFDADSLRLRCRIAPSVY------NGSQTVYPLVVATHPLDPNQ  1080

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES G+WG S
Sbjct  1081  LALGLTDGSVKVIEPTESEGKWGTS  1105



>ref|XP_003609722.1| WD repeat-containing protein [Medicago truncatula]
Length=991

 Score =   114 bits (285),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QL+YA+F DG+IGVFD+  LR RC IA SAYL Q+  + ++ +Y  V+ AHPQEPNQ
Sbjct  885  CNSQLVYAAFTDGSIGVFDSDSLRLRCRIASSAYLHQSS-SISQNIYPFVVAAHPQEPNQ  943

Query  537  LAFGLTDGSIKVIEPLESGGEWGIS  463
             A G++DGSIKVIEP+E  G WG+S
Sbjct  944  FAVGMSDGSIKVIEPIEPNGRWGVS  968



>emb|CDX80607.1| BnaC07g28370D [Brassica napus]
Length=1117

 Score =   114 bits (285),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  L  RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ
Sbjct  1014  CNSQLIYTTFRDGNIGVFDADTLGLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQ  1069

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DG++KVIEP E+ G+WG+
Sbjct  1070  FAVGLNDGTVKVIEPTEAEGKWGM  1093



>ref|NP_198055.3| Topless-related protein 3 [Arabidopsis thaliana]
 sp|Q84JM4.1|TPR3_ARATH RecName: Full=Topless-related protein 3 [Arabidopsis thaliana]
 gb|AAO42071.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50698.1| unknown protein [Arabidopsis thaliana]
 gb|AED93642.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1108

 Score =   114 bits (285),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQ+PNQ
Sbjct  1006  CNSQLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQDPNQ  1061

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+K++EP E  G+WG+
Sbjct  1062  FAVGLNDGSVKMMEPTEGEGKWGM  1085



>ref|NP_001190409.1| Topless-related protein 3 [Arabidopsis thaliana]
 gb|AED93643.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1134

 Score =   114 bits (285),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQ+PNQ
Sbjct  1032  CNSQLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQDPNQ  1087

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL DGS+K++EP E  G+WG+
Sbjct  1088  FAVGLNDGSVKMMEPTEGEGKWGM  1111



>ref|XP_011036914.1| PREDICTED: topless-related protein 3 [Populus euphratica]
Length=1127

 Score =   114 bits (285),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPS Y      N ++ VY +V+  HP +PNQ
Sbjct  1021  CNSQLIYATFCDGNIGVFDADSLRLRCRIAPSVY------NGSQTVYPLVVATHPLDPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES G+WG S
Sbjct  1075  LALGLTDGSVKVIEPTESEGKWGTS  1099



>gb|KHN03954.1| Topless-related protein 3 [Glycine soja]
Length=1107

 Score =   114 bits (284),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQ-AVLNRNEGVYAVVIVAHPQEPN  541
             CN QLIYA+F DGN GVFDA  LR RC IA S Y S  A L+ N+  Y V I AHP EPN
Sbjct  994   CNSQLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPPAALSGNQSAYPVAIAAHPLEPN  1053

Query  540   QLAFGLTDGSIKVIEPLESGGEWGIS  463
             Q A GLTDGS+KVIEP ES G+WG S
Sbjct  1054  QFAVGLTDGSVKVIEPSESEGKWGTS  1079



>ref|XP_006577218.1| PREDICTED: topless-related protein 3-like [Glycine max]
Length=1130

 Score =   114 bits (284),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQ-AVLNRNEGVYAVVIVAHPQEPN  541
             CN QLIYA+F DGN GVFDA  LR RC IA S Y S  A L+ N+  Y V I AHP EPN
Sbjct  1017  CNSQLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPPAALSGNQSAYPVAIAAHPLEPN  1076

Query  540   QLAFGLTDGSIKVIEPLESGGEWGIS  463
             Q A GLTDGS+KVIEP ES G+WG S
Sbjct  1077  QFAVGLTDGSVKVIEPSESEGKWGTS  1102



>gb|KHG04331.1| Topless-related 2 -like protein [Gossypium arboreum]
Length=1039

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  L+ RC IAPSAY+S  + N ++ V+ +V+ AHPQE NQ
Sbjct  930   CNSQLVYATFPDGNIGVFDADSLKLRCRIAPSAYISPGMSN-SQIVHPLVVTAHPQEANQ  988

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GLTDG +KVIEPLE+  +WG+
Sbjct  989   LALGLTDGLVKVIEPLETERKWGL  1012



>emb|CDY50502.1| BnaC01g44400D [Brassica napus]
Length=1272

 Score =   113 bits (283),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQ
Sbjct  1157  CNSQLVYASFNDGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEPNQ  1215

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E+   WG+
Sbjct  1216  LAVGLSDGSVKVIEPSEASRRWGV  1239



>dbj|BAA95777.1| unnamed protein product [Arabidopsis thaliana]
Length=1161

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  ++  VI AHPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIFPQVITAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E    WG+
Sbjct  1076  LAVGLSDGSVKVIEPSELSRRWGV  1099



>ref|NP_188306.2| Topless-related 2 protein [Arabidopsis thaliana]
 sp|Q9LRZ0.2|TPR2_ARATH RecName: Full=Topless-related protein 2 [Arabidopsis thaliana]
 gb|AEE75871.1| Topless-related 2 protein [Arabidopsis thaliana]
Length=1131

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  ++  VI AHPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIFPQVITAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E    WG+
Sbjct  1076  LAVGLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_009114175.1| PREDICTED: topless-related protein 2 [Brassica rapa]
Length=1135

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQ
Sbjct  1020  CNSQLVYASFTDGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E+   WG+
Sbjct  1079  LAVGLSDGSVKVIEPSEASRRWGV  1102



>ref|XP_010674104.1| PREDICTED: topless-related protein 3-like [Beta vulgaris subsp. 
vulgaris]
Length=1096

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN  +IYASF DGN+GV+DA  L+ RC IA SA+LS A LN ++ +Y  V+ AHPQEP Q
Sbjct  984   CNSLIIYASFSDGNVGVYDADTLKLRCRIAASAFLSHAQLNGSQILYPQVVAAHPQEPFQ  1043

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL DG++KV+EP ES G+WG+S
Sbjct  1044  FAVGLNDGTVKVVEPTESEGKWGVS  1068



>gb|KJB26371.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1133

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L + + VY +V+ AHP E NQ
Sbjct  1021  CNSQSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVIL-KGQTVYPLVVAAHPIEANQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG++KV+EP ES G+WG+S
Sbjct  1080  FAIGLSDGTVKVLEPSESEGKWGVS  1104



>ref|XP_009382518.1| PREDICTED: topless-related protein 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=1142

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C  +L+YASF DGNIGVFDA  LR RC IAPSAY S A  + N   Y +VI AHPQEPNQ
Sbjct  1031  CFSELVYASFCDGNIGVFDADNLRLRCRIAPSAYTSPAAASSNP-TYPLVIAAHPQEPNQ  1089

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG++KVIEP +S G WG
Sbjct  1090  FAVGLTDGAVKVIEPSKSEGRWG  1112



>ref|XP_009382517.1| PREDICTED: topless-related protein 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1143

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C  +L+YASF DGNIGVFDA  LR RC IAPSAY S A  + N   Y +VI AHPQEPNQ
Sbjct  1032  CFSELVYASFCDGNIGVFDADNLRLRCRIAPSAYTSPAAASSNP-TYPLVIAAHPQEPNQ  1090

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG++KVIEP +S G WG
Sbjct  1091  FAVGLTDGAVKVIEPSKSEGRWG  1113



>ref|XP_006406802.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
 gb|ESQ48255.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
Length=1131

 Score =   112 bits (280),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC I+PSAY+ Q   N +  +   VI AHPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAESLRLRCRISPSAYMPQPTPN-SAPIIPQVITAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP ES   WG+
Sbjct  1076  LAVGLSDGSVKVIEPSESSRRWGM  1099



>ref|XP_006299477.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
 gb|EOA32375.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
Length=1127

 Score =   112 bits (279),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQ
Sbjct  1013  CNSQLVYASFADGNIGVFDAETLRLRCRIAPSAYMPQPTPN-SAPIVPQVITAHPQEPNQ  1071

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+KVIEP E    WG+
Sbjct  1072  FAVGLSDGSVKVIEPSELSRRWGV  1095



>ref|XP_009146056.1| PREDICTED: topless-related protein 2-like [Brassica rapa]
Length=1132

 Score =   112 bits (279),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q + N +  +   VI  HPQEPNQ
Sbjct  1016  CNSQLVYASFADGNIAVFDADSLRLRCRIAPSAYMPQPIPN-SAPIIPQVITTHPQEPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E+   WG+
Sbjct  1075  LAVGLSDGSVKVIEPSEASRRWGV  1098



>ref|XP_007035678.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
 gb|EOY06604.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
Length=1101

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ
Sbjct  992   CNSQLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQ  1050

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS+KVIEP E   + G+
Sbjct  1051  FAVGLTDGSVKVIEPSEMERKLGL  1074



>ref|XP_007035677.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
 gb|EOY06603.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
Length=1107

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ
Sbjct  998   CNSQLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQ  1056

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS+KVIEP E   + G+
Sbjct  1057  FAVGLTDGSVKVIEPSEMERKLGL  1080



>ref|XP_007035675.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
 gb|EOY06601.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
Length=1133

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ
Sbjct  1024  CNSQLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS+KVIEP E   + G+
Sbjct  1083  FAVGLTDGSVKVIEPSEMERKLGL  1106



>ref|XP_007035676.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
 gb|EOY06602.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
Length=1139

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ
Sbjct  1030  CNSQLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQ  1088

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS+KVIEP E   + G+
Sbjct  1089  FAVGLTDGSVKVIEPSEMERKLGL  1112



>gb|KFK39016.1| hypothetical protein AALP_AA3G189500 [Arabis alpina]
Length=1131

 Score =   111 bits (277),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIIPQVITTHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             +A GL+DGS+KVIEP ES   WG+
Sbjct  1076  VAVGLSDGSVKVIEPSESSRRWGV  1099



>ref|XP_004487868.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1122

 Score =   111 bits (277),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRN-EGVYAVVIVAHPQEPN  541
             CN +L+YA+F DGN+GVFDA  L+PRC IA SAY+ Q+    N + VY VV+ AHP EPN
Sbjct  1029  CNGRLVYATFTDGNVGVFDAETLKPRCRIASSAYIHQSQTPSNSQNVYPVVVAAHPHEPN  1088

Query  540   QLAFGLTDGSIKVIEPLESGGEWGI  466
             Q A GL+DGSIKVIEP E+ G  GI
Sbjct  1089  QFAIGLSDGSIKVIEPPETEGWQGI  1113



>ref|XP_008673872.1| PREDICTED: topless-related protein 2 isoform X2 [Zea mays]
Length=1109

 Score =   111 bits (277),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+GVFDA  LR RC IAPS      V+N N  V+ +V+ AHP EPNQ
Sbjct  1002  CNSQLVFAAFTDGNLGVFDAENLRLRCRIAPS------VINSNPPVHPLVVAAHPHEPNQ  1055

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DGS+KV+EPLES G+WG
Sbjct  1056  FAVGLSDGSVKVLEPLESEGKWG  1078



>ref|XP_008673871.1| PREDICTED: topless-related protein 2 isoform X1 [Zea mays]
Length=1125

 Score =   111 bits (277),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++A+F DGN+GVFDA  LR RC IAPS      V+N N  V+ +V+ AHP EPNQ
Sbjct  1018  CNSQLVFAAFTDGNLGVFDAENLRLRCRIAPS------VINSNPPVHPLVVAAHPHEPNQ  1071

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DGS+KV+EPLES G+WG
Sbjct  1072  FAVGLSDGSVKVLEPLESEGKWG  1094



>emb|CDY50500.1| BnaC01g44380D [Brassica napus]
Length=505

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q     +  +   VI AHPQEPNQ
Sbjct  392  CNSQLVYASFTDGNIAVFDAESLRLRCRIAPSAYMPQP---NSAPIIPQVITAHPQEPNQ  448

Query  537  LAFGLTDGSIKVIEPLESGGEWGI  466
            LA GL DGS+KVIEP E+   WG+
Sbjct  449  LAVGLADGSVKVIEPSEASRRWGV  472



>emb|CDX92100.1| BnaA05g23070D [Brassica napus]
Length=1132

 Score =   110 bits (276),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQ
Sbjct  1016  CNSQLVYASFADGNIAVFDADSLRLRCRIAPSAYMPQPTPN-SAPIIPQVITTHPQEPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E+   WG+
Sbjct  1075  LAVGLSDGSVKVIEPSEASRRWGV  1098



>gb|KFK27551.1| hypothetical protein AALP_AA8G398300 [Arabis alpina]
Length=1125

 Score =   110 bits (276),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA +LR RC IAPSAY+ Q   N +  V  +VI +HPQEPNQ
Sbjct  1016  CNSQLVYASFADGNIGVFDAEQLRLRCRIAPSAYMPQPTPN-SAPVMPLVITSHPQEPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGISRK  457
             +A GL+DGS+KV+E  E    WG++ K
Sbjct  1075  IAVGLSDGSVKVLETPEPFRRWGVADK  1101



>ref|XP_010440213.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1115

 Score =   110 bits (276),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +  +VI AHPQEPNQ
Sbjct  1006  CNSQLVYASFADGNIGVFDAEYLRLRCRIAPSAYMPQPTQN-SAPIMPLVITAHPQEPNQ  1064

Query  537   LAFGLTDGSIKVIEPLESGGEWGISRK  457
             +A GL+DGS+KV+E  E    WG++ K
Sbjct  1065  IAVGLSDGSVKVLETPEPFRRWGVAEK  1091



>emb|CDX95900.1| BnaC05g36510D [Brassica napus]
Length=1136

 Score =   110 bits (276),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQ
Sbjct  1021  CNSQLVYASFADGNIAVFDADSLRLRCRIAPSAYMPQPTPN-SAPIIPQVITTHPQEPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KVIEP E+   WG+
Sbjct  1080  LAVGLSDGSVKVIEPSEASRRWGV  1103



>ref|XP_011023731.1| PREDICTED: topless-related protein 3-like [Populus euphratica]
Length=1124

 Score =   110 bits (275),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGNIGVFDA  LR RC IAPSAY      N ++  + +V+  HP +PNQ
Sbjct  1018  CNSQLIYATFSDGNIGVFDADHLRLRCRIAPSAY------NGSQTAHPLVVATHPLDPNQ  1071

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES  +WG S
Sbjct  1072  LAVGLTDGSVKVIEPTESEKKWGTS  1096



>ref|XP_010487553.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAETLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+KVIEP E    WG+
Sbjct  1076  FAVGLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_002319498.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE95421.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1124

 Score =   109 bits (273),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYA+F DGN+GVFDA  LR RC IAPSAY      N ++  + +V+  HP +PNQ
Sbjct  1018  CNSQLIYATFSDGNVGVFDADHLRLRCRIAPSAY------NGSQTAHPLVVATHPLDPNQ  1071

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GLTDGS+KVIEP ES  +WG S
Sbjct  1072  LAVGLTDGSVKVIEPTESEKKWGTS  1096



>ref|XP_001781989.1| predicted protein [Physcomitrella patens]
 gb|EDQ53213.1| predicted protein [Physcomitrella patens]
Length=1102

 Score =   109 bits (272),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYA F DG++GVFDA  LRPRC +APS ++   V      VY +VI AHP EPNQ
Sbjct  993   CDSQLIYAGFVDGSVGVFDAESLRPRCRLAPSVHIPPGV--SGSTVYPLVIAAHPAEPNQ  1050

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DG ++VIEPLES G+WG
Sbjct  1051  FALGLSDGGVQVIEPLESEGKWG  1073



>ref|XP_004495686.1| PREDICTED: topless-related protein 3-like isoform X3 [Cicer arietinum]
Length=1115

 Score =   108 bits (271),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QLIYASF D NIGVFDA  L+ RC IAPS  LSQAV       Y +VI  HP EPNQ
Sbjct  1015  CNSQLIYASFCDANIGVFDADSLKLRCRIAPSICLSQAV-------YPLVIATHPLEPNQ  1067

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A G++DGS+KVIEP ES G+WG S
Sbjct  1068  FAVGMSDGSVKVIEPSESEGKWGSS  1092



>ref|XP_010465706.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score =   108 bits (270),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPS Y+ Q   N +  +   VI AHPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAETLRLRCRIAPSVYMPQPTPN-SAPIIPQVITAHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+KVIEP E    WG+
Sbjct  1076  FAVGLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_010449856.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1125

 Score =   108 bits (270),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +  +VI AHPQEPNQ
Sbjct  1016  CNSQLVYASFADGNIGVFDAEYLRLRCRIAPSAYMPQPTQN-SAPIMPLVITAHPQEPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGISRK  457
             +A GL+DG +KV+E  E    WG++ K
Sbjct  1075  IAVGLSDGLVKVLETPEPFRRWGVAEK  1101



>ref|XP_001768092.1| predicted protein [Physcomitrella patens]
 gb|EDQ67164.1| predicted protein [Physcomitrella patens]
Length=1158

 Score =   108 bits (269),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYA F DG++GVFDA  LRPRC +AP+ ++   V      VY +VI AHP EPNQ
Sbjct  1049  CDSQLIYAGFVDGSVGVFDAESLRPRCRLAPTVHVPSGV--SGSTVYPLVIAAHPAEPNQ  1106

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DG ++VIEPLES G+WG
Sbjct  1107  FALGLSDGGVQVIEPLESEGKWG  1129



>ref|XP_002883029.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59288.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
Length=1131

 Score =   108 bits (269),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SALIIPHVITTHPQEPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GL+DGS+KV+EP E    WG+
Sbjct  1076  LAVGLSDGSVKVLEPSELSRRWGV  1099



>ref|XP_007031068.1| TOPLESS-related 3 [Theobroma cacao]
 gb|EOY11570.1| TOPLESS-related 3 [Theobroma cacao]
Length=715

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q +YA+F DGN+GVFDA  LR  C IA S +LSQA+L   + VY  V+ AHP+E NQ
Sbjct  603  CNSQSVYATFCDGNVGVFDADSLRLICRIASSVHLSQAILKGKQVVYPFVVAAHPKEANQ  662

Query  537  LAFGLTDGSIKVIEPLESGGEWGISR  460
             A GL+DGS+KV+EP ES G+W +S+
Sbjct  663  FAIGLSDGSVKVMEPTESEGKWQVSQ  688



>ref|XP_006285940.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
 gb|EOA18838.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
Length=1107

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +  +VI AHPQEPNQ
Sbjct  998   CNSQLVYASFADGNIGVFDAEYLRLRCRIAPSAYMPQPTPN-SAPLMPLVITAHPQEPNQ  1056

Query  537   LAFGLTDGSIKVIEPLESGGEWGISRK  457
             +A GL+DG +KV+E  E    WG++ K
Sbjct  1057  IAVGLSDGLVKVLETPEPFRRWGVAEK  1083



>gb|KEH37175.1| topless-like protein [Medicago truncatula]
Length=972

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q++YA+F +GNIGVFDA RL+ RC IA SAYL+Q   N ++ VY +   AHP+EPNQ
Sbjct  885  CNGQIVYAAFTNGNIGVFDAVRLQLRCHIASSAYLNQTPSN-SQNVYPLGFTAHPKEPNQ  943

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A  L+DG++KV+EP ES G WG
Sbjct  944  FAIALSDGTVKVLEPTESAGSWG  966



>gb|EMS62858.1| Topless-related protein 2 [Triticum urartu]
Length=1197

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 64/113 (57%), Gaps = 30/113 (27%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNR------------------  592
             CN QL++A+F DGN+ +FDA  LR RC IA SAY+S   +NR                  
Sbjct  1055  CNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTTAINRCKIISVEIAGELPRRFEA  1114

Query  591   ------------NEGVYAVVIVAHPQEPNQLAFGLTDGSIKVIEPLESGGEWG  469
                         N  VY  V+ AHPQEPNQ A GL+DGS+KV+EPLES G+WG
Sbjct  1115  PSHPVKVTINHRNPPVYPFVVAAHPQEPNQFAVGLSDGSVKVMEPLESDGKWG  1167



>ref|XP_010504697.1| PREDICTED: topless-related protein 2 [Camelina sativa]
Length=1131

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQE NQ
Sbjct  1017  CNSQLVYASFADGNIAVFDAETLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEANQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+KVIEP E    WG+
Sbjct  1076  FAVGLSDGSVKVIEPSELSRRWGV  1099



>gb|KJB72745.1| hypothetical protein B456_011G194100 [Gossypium raimondii]
 gb|KJB72746.1| hypothetical protein B456_011G194100 [Gossypium raimondii]
Length=1123

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIGVFDA  L+ RC IAPSAY+S  + N ++ V+ +V+  HPQE NQ
Sbjct  1014  CNSQLVYATFTDGNIGVFDADSLKLRCRIAPSAYISPGMSN-SQIVHPLVVATHPQEANQ  1072

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             LA GLT+G +KVIEP E+  +WG+
Sbjct  1073  LAVGLTNGLVKVIEPSETERKWGL  1096



>ref|XP_004506964.1| PREDICTED: protein TOPLESS-like [Cicer arietinum]
Length=1134

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF+A  LR RC I+PSAYL  +V N N  V  +VI AHPQEPNQ
Sbjct  1025  CDSQLIYASFLDATVCVFNASNLRLRCRISPSAYLPSSVSNSN--VQPLVIAAHPQEPNQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1083  FAIGLSDGGVHVFEPLESEGKWGV  1106



>ref|XP_006414395.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
 gb|ESQ55848.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
Length=1120

 Score =   106 bits (264),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YASF DGNIGVFDA  LR RC I+PSAY+ Q   N +  +  +VI AHPQE NQ
Sbjct  1014  CNSQLVYASFADGNIGVFDAEYLRLRCRISPSAYMPQPTPN-SAPIMPLVITAHPQESNQ  1072

Query  537   LAFGLTDGSIKVIEPLESGGEWGISRK  457
             +A GL+DGS+KVIE  E    WG++ K
Sbjct  1073  VAVGLSDGSVKVIETPEPFRRWGVADK  1099



>ref|XP_008655511.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Zea mays]
Length=1462

 Score =   106 bits (264),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL++++F DGNIGVFDA  LR RC IA      Q+V+N N  V+ +V+ AHP EPNQ
Sbjct  1356  CNSQLVFSAFIDGNIGVFDAENLRLRCRIA------QSVINSNPHVHPLVVAAHPHEPNQ  1409

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GL+DG +KV+EPLES G+WG
Sbjct  1410  FAVGLSDGFVKVLEPLESEGKWG  1432



>ref|XP_010050139.1| PREDICTED: topless-related protein 4-like [Eucalyptus grandis]
Length=1298

 Score =   105 bits (262),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q IYASF+DG+I V  A  LR RCCI P+AY+     N +  VY +VI AHP +PNQ
Sbjct  1195  CNGQSIYASFEDGSISVLSASTLRLRCCINPAAYIPP---NPDLRVYPLVIAAHPSQPNQ  1251

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLT+GS+ V+EPLES GEWG S
Sbjct  1252  FALGLTNGSVYVLEPLESEGEWGGS  1276



>ref|XP_006341391.1| PREDICTED: protein TOPLESS-like [Solanum tuberosum]
Length=1130

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF A  L  RC I PSAYLS ++ N N  ++ VV+ AHPQ+PNQ
Sbjct  1021  CDSQLIYASFLDATVCVFTAGHLHMRCRIIPSAYLSPSISNSN--IHPVVVAAHPQDPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+ V EPLES G+WG+
Sbjct  1079  FALGLSDGSVHVFEPLESEGKWGV  1102



>ref|XP_002960294.1| hypothetical protein SELMODRAFT_163891 [Selaginella moellendorffii]
 gb|EFJ37833.1| hypothetical protein SELMODRAFT_163891 [Selaginella moellendorffii]
Length=1119

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ +L+YA+F DG IGVF+A  LRP C IAP+ YL Q V     G + +V+ AHP EPN 
Sbjct  1011  CDSRLVYAAFLDGAIGVFEAETLRPYCRIAPTVYLPQGV----TGAHPLVVAAHPSEPNL  1066

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS++V+EPLES  +WG++
Sbjct  1067  FALGLTDGSVQVLEPLESEAKWGVA  1091



>ref|XP_010318715.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum lycopersicum]
 ref|XP_010318716.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum lycopersicum]
Length=1130

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF A  L  RC I PSAYLS ++ N N  ++ VV+ AHPQ+PNQ
Sbjct  1021  CDSQLIYASFLDATVCVFTAGHLHMRCRIIPSAYLSPSISNSN--IHPVVVAAHPQDPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+ V EPLES G+WG+
Sbjct  1079  FALGLSDGSVHVFEPLESEGKWGV  1102



>ref|XP_002967419.1| hypothetical protein SELMODRAFT_439915 [Selaginella moellendorffii]
 gb|EFJ32018.1| hypothetical protein SELMODRAFT_439915 [Selaginella moellendorffii]
Length=1111

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ +L+YA+F DG IGVF+A  LRP C IAP+ YL Q V     G + +V+ AHP EPN 
Sbjct  1003  CDSRLVYAAFLDGAIGVFEAETLRPYCRIAPTVYLPQGV----TGAHPLVVAAHPSEPNL  1058

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDGS++V+EPLES  +WG++
Sbjct  1059  FALGLTDGSVQVLEPLESEAKWGVA  1083



>gb|EYU21684.1| hypothetical protein MIMGU_mgv1a000459mg [Erythranthe guttata]
Length=1138

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF A +LR RC I PSAYLS    N +  V+ +VI AHPQEPNQ
Sbjct  1029  CDSQLVYASFLDSTVCVFTAAQLRLRCRINPSAYLSP---NISSNVHPLVIAAHPQEPNQ  1085

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DGS+ V EPLES G+WG++
Sbjct  1086  FALGLSDGSVHVFEPLESEGKWGLT  1110



>ref|XP_002870186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46445.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1125

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN  L+YASF DG+IGVFDA  LR RC I PSAY+ Q   N +  +  +VI AHPQEPNQ
Sbjct  1016  CNSHLVYASFADGSIGVFDAEYLRLRCRIGPSAYMPQPTSN-SAPIMPLVITAHPQEPNQ  1074

Query  537   LAFGLTDGSIKVIEPLESGGEWGISRK  457
             +A GL+DGS+KV+E  E    WG+  K
Sbjct  1075  IAVGLSDGSVKVLETPEPFRRWGVVEK  1101



>gb|KJB34663.1| hypothetical protein B456_006G077300 [Gossypium raimondii]
Length=1114

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F D NIGVFDA  LR RC IAPSAY+S  V + +  ++ +V+ AHPQE NQ
Sbjct  1005  CNSQLVYATFTDDNIGVFDADSLRLRCRIAPSAYIS-PVSSNSPTIHPLVVAAHPQEANQ  1063

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             +A GL++G++KVIEP E+  +WG+
Sbjct  1064  IAVGLSNGAVKVIEPSEAERKWGL  1087



>gb|KJB34661.1| hypothetical protein B456_006G077300 [Gossypium raimondii]
Length=1128

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F D NIGVFDA  LR RC IAPSAY+S  V + +  ++ +V+ AHPQE NQ
Sbjct  1019  CNSQLVYATFTDDNIGVFDADSLRLRCRIAPSAYIS-PVSSNSPTIHPLVVAAHPQEANQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
             +A GL++G++KVIEP E+  +WG+
Sbjct  1078  IAVGLSNGAVKVIEPSEAERKWGL  1101



>ref|XP_011073378.1| PREDICTED: protein TOPLESS [Sesamum indicum]
Length=1132

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + +F A  LR RC I PSAYLS  V   +  V+ +VI AHPQEPNQ
Sbjct  1024  CDSQLVYASFLDATVCIFTAAHLRLRCRINPSAYLSPGV---SSNVHPLVIAAHPQEPNQ  1080

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+ V EPLES G+WG+
Sbjct  1081  FALGLSDGSVHVFEPLESEGKWGV  1104



>ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda]
 gb|ERN16630.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda]
Length=1138

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF DG++GVF A  LR RC I P+AYL     N +   Y +VI AHP EPNQ
Sbjct  1030  CDSQLIYTSFVDGSVGVFSAATLRLRCRINPTAYLPA---NLSSNTYPLVIAAHPSEPNQ  1086

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG + V+EPLES G+WG
Sbjct  1087  FALGLTDGGVHVLEPLESEGKWG  1109



>ref|XP_009405763.1| PREDICTED: protein TOPLESS-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1130

 Score =   103 bits (257),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF D  + +F+A  LR RC I P+AYL  +V   +  VY VVI AHP EPNQ
Sbjct  1021  CDSQLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSV---STTVYPVVIAAHPSEPNQ  1077

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + V+EPLES G+WG+S
Sbjct  1078  FALGLTDGGVHVLEPLESEGKWGVS  1102



>ref|XP_009405760.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1169

 Score =   103 bits (257),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF D  + +F+A  LR RC I P+AYL  +V   +  VY VVI AHP EPNQ
Sbjct  1060  CDSQLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSV---STTVYPVVIAAHPSEPNQ  1116

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + V+EPLES G+WG+S
Sbjct  1117  FALGLTDGGVHVLEPLESEGKWGVS  1141



>ref|XP_002309645.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE93168.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1099

 Score =   103 bits (256),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF DG + VF A  L+ RC I P++YL   V   +  VY + I AHPQEPNQ
Sbjct  989   CDSQLVYASFLDGTLRVFSASNLQVRCQINPNSYLPSDV---SSTVYPLAIAAHPQEPNQ  1045

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS++V EPLES G+WG+
Sbjct  1046  FAIGLTDGSVQVFEPLESDGKWGV  1069



>ref|XP_009405761.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1132

 Score =   103 bits (256),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF D  + +F+A  LR RC I P+AYL  +V   +  VY VVI AHP EPNQ
Sbjct  1023  CDSQLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSV---STTVYPVVIAAHPSEPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + V+EPLES G+WG+S
Sbjct  1080  FALGLTDGGVHVLEPLESEGKWGVS  1104



>ref|XP_009369993.1| PREDICTED: topless-related protein 2-like [Pyrus x bretschneideri]
Length=1140

 Score =   103 bits (256),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -3

Query  708   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  529
             QL+YA+F DGNIGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1038  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLPQASSN-SPSVYPLALTAHLQEPYQFAV  1096

Query  528   GLTDGSIKVIEPLESGGEWGI  466
             GLTDGS+KVIEP ES G+WG+
Sbjct  1097  GLTDGSVKVIEPSESEGKWGV  1117



>ref|XP_008390610.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1146

 Score =   103 bits (256),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -3

Query  708   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  529
             QL+YA+F DGNIGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1044  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLPQASSN-SPSVYPLALTAHLQEPYQFAV  1102

Query  528   GLTDGSIKVIEPLESGGEWGI  466
             GLTDGS+KVIEP ES G+WG+
Sbjct  1103  GLTDGSVKVIEPSESEGKWGV  1123



>ref|XP_002324880.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEF03445.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1114

 Score =   102 bits (255),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF DG + +F A  L+ RC I P+AYL   V      VY + + AHPQEPNQ
Sbjct  1006  CDSQLVYASFVDGTLRIFGASNLQVRCQINPNAYLQSDV---GSSVYPLAVAAHPQEPNQ  1062

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGSI+V EPLES G+WG+
Sbjct  1063  FAIGLTDGSIQVFEPLESEGKWGM  1086



>gb|KCW80100.1| hypothetical protein EUGRSUZ_C014271, partial [Eucalyptus grandis]
Length=177

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN + IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ
Sbjct  80   CNGESIYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQ  136

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLE  GEWG
Sbjct  137  FALGLTDGSVYVLEPLEYEGEWG  159



>ref|XP_007150781.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 ref|XP_007150782.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 gb|ESW22775.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 gb|ESW22776.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
Length=1132

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF A  LR RC I PSAYLS +V   +  V  +VI AHPQEPNQ
Sbjct  1026  CDSQLIYASFLDATVCVFSASNLRLRCRINPSAYLSASV---SSNVQPLVIAAHPQEPNQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1083  FAVGLSDGGVHVFEPLESEGKWGV  1106



>ref|XP_009382516.1| PREDICTED: topless-related protein 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1164

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 61/104 (59%), Gaps = 21/104 (20%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNR------------------  592
             C  +L+YASF DGNIGVFDA  LR RC IAPSAY S A  +                   
Sbjct  1031  CFSELVYASFCDGNIGVFDADNLRLRCRIAPSAYTSPAAASSFSQSIVRIVDSPADQHSF  1090

Query  591   ---NEGVYAVVIVAHPQEPNQLAFGLTDGSIKVIEPLESGGEWG  469
                +   Y +VI AHPQEPNQ A GLTDG++KVIEP +S G WG
Sbjct  1091  SFFSNPTYPLVIAAHPQEPNQFAVGLTDGAVKVIEPSKSEGRWG  1134



>ref|XP_007227035.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
 gb|EMJ28234.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
Length=1125

 Score =   102 bits (254),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -3

Query  708   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  529
             QL+YA+F DGNIGVFDA  L+ RC IA S YLSQA  N ++ VY + + AH  EP Q A 
Sbjct  1024  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLSQASSN-SQTVYPLALTAHLHEPYQFAV  1082

Query  528   GLTDGSIKVIEPLESGGEWGI  466
             GLTDGS+KVIEP E+ G+WG+
Sbjct  1083  GLTDGSVKVIEPSEAEGKWGV  1103



>ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [Cicer arietinum]
Length=1150

 Score =   102 bits (253),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL++ASF D  + VF A  LR RC I PSAYLS  V + N  V+++VI AHPQEPNQ
Sbjct  1043  CDSQLVFASFLDATVCVFSASNLRLRCRINPSAYLSANVSSSN--VHSLVIAAHPQEPNQ  1100

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1101  FAVGLSDGIVHVFEPLESEGKWGV  1124



>ref|XP_009796750.1| PREDICTED: protein TOPLESS-like [Nicotiana sylvestris]
 ref|XP_009796751.1| PREDICTED: protein TOPLESS-like [Nicotiana sylvestris]
Length=1127

 Score =   102 bits (253),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF    L  RC I PSAYLS ++ N N  V+ VV+ AHPQ+PNQ
Sbjct  1018  CDSQLIYASFLDATVCVFTFTPLHMRCRIIPSAYLSPSISNSN--VHPVVVAAHPQDPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+ V EPLES G+WG+
Sbjct  1076  FALGLSDGSVHVFEPLESEGKWGV  1099



>ref|XP_009611336.1| PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis]
 ref|XP_009611337.1| PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis]
Length=1127

 Score =   102 bits (253),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF    L  RC I PSAYLS ++ N N  V+ VV+ AHPQ+PNQ
Sbjct  1018  CDSQLIYASFLDATVCVFTFTPLHMRCRIIPSAYLSPSISNSN--VHPVVVAAHPQDPNQ  1075

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DGS+ V EPLES G+WG+
Sbjct  1076  FALGLSDGSVHVFEPLESEGKWGV  1099



>ref|XP_010318718.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318719.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318720.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318721.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318722.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
Length=405

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            C+ QLIYASF D  + +F A  L  +CCI PSAYLS  + N N  ++ VV+ AHP++PNQ
Sbjct  300  CDSQLIYASFLDATVCIFTAGNLHMQCCIYPSAYLSPGISNLN--IHPVVVAAHPEDPNQ  357

Query  537  LAFGLTDGSIKVIEPLESGGEWGI  466
             A G++DG + V EPLES G+WG+
Sbjct  358  FALGMSDGGVHVFEPLESEGKWGV  381



>gb|KCW80088.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=334

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ
Sbjct  230  CNGQSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPP---TPSLKVYPIVIAAHPSEPNQ  286

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLES G+WG
Sbjct  287  FALGLTDGSVYVLEPLESQGKWG  309



>ref|XP_006341390.1| PREDICTED: protein TOPLESS-like [Solanum tuberosum]
Length=257

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            C+ QLIYASF D  + VF A  L  +CCI P AYLS  + N N  ++ VV+ AHP++PNQ
Sbjct  148  CDSQLIYASFLDATVCVFTAGNLHMQCCIIPFAYLSPGISNSN--IHPVVVAAHPEDPNQ  205

Query  537  LAFGLTDGSIKVIEPLESGGEWGI  466
             A G++DG + V EPLES G+WG+
Sbjct  206  FALGMSDGGVHVFEPLESEGKWGV  229



>ref|XP_011036611.1| PREDICTED: topless-related protein 1-like [Populus euphratica]
Length=1102

 Score =   101 bits (252),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF DG + +F A  L+ RC I P+AYL   V      VY + + AHPQEPNQ
Sbjct  994   CDSQLVYASFVDGTLRIFGASNLQVRCQINPNAYLPSDV---GSSVYPLAVAAHPQEPNQ  1050

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              + GLTDGSI+V EPLES G+WG+
Sbjct  1051  FSIGLTDGSIQVFEPLESEGKWGL  1074



>ref|XP_008337262.1| PREDICTED: topless-related protein 4 [Malus domestica]
 ref|XP_008337263.1| PREDICTED: topless-related protein 4 [Malus domestica]
Length=1131

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ
Sbjct  1027  CDSQLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPS---NPSLRVYPLVVAAHPSEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG + V+EPLES G+WG
Sbjct  1084  FALGLTDGGVHVLEPLESEGKWG  1106



>ref|XP_010047998.1| PREDICTED: topless-related protein 4-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW80087.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=366

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ
Sbjct  262  CNGQSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPP---TPSLKVYPIVIAAHPSEPNQ  318

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLES G+WG
Sbjct  319  FALGLTDGSVYVLEPLESQGKWG  341



>ref|XP_010539522.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
 ref|XP_010539523.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
 ref|XP_010539524.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
Length=1120

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASFKD  + VF +  LR RC + PSAYL   + N N  V+ VVI AHPQEPN 
Sbjct  1026  CDSQLIYASFKDATVCVFTSSNLRLRCRVNPSAYLPSNLSNSN--VHPVVIAAHPQEPNM  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG + + EPLES G WG++
Sbjct  1084  FAEGLSDGGVHIFEPLESEGGWGVA  1108



>ref|XP_008385358.1| PREDICTED: topless-related protein 4-like [Malus domestica]
Length=254

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            C+ QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ
Sbjct  150  CDSQLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQ  206

Query  537  LAFGLTDGSIKVIEPLESGGEWGIS  463
             A GL+DG + V+EPLES G+WG +
Sbjct  207  FALGLSDGGVHVLEPLESEGKWGTN  231



>gb|KCW80072.1| hypothetical protein EUGRSUZ_C01404 [Eucalyptus grandis]
Length=840

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN   IY SF+DG+IGV     LR  CCI P+AY+      R   VY +VIVAHP EPNQ
Sbjct  737  CNGHSIYVSFEDGSIGVLSTSTLRLICCINPAAYILPKPSLR---VYPLVIVAHPSEPNQ  793

Query  537  LAFGLTDGSIKVIEPLESGGEWGIS  463
             A GLTDGS+ V+EPLES GEWG S
Sbjct  794  FALGLTDGSVYVLEPLESEGEWGGS  818



>ref|XP_009363995.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
 ref|XP_009363996.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
Length=1129

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ
Sbjct  1025  CDSQLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG + V+EPLES G+WG
Sbjct  1082  FALGLTDGGVHVLEPLESEGKWG  1104



>ref|XP_009395915.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1133

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  I VF+A   R RC I P+AYL  +V   +  +Y +VI AHP EPNQ
Sbjct  1025  CDSQLIYASFLDATICVFNATNFRLRCRILPAAYLPASV---STTLYPLVIAAHPSEPNQ  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + V+EPLES G+WG++
Sbjct  1082  FALGLTDGGVHVLEPLESEGKWGVN  1106



>gb|KCW80086.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=423

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ
Sbjct  319  CNGQSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPP---TPSLKVYPIVIAAHPSEPNQ  375

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLES G+WG
Sbjct  376  FALGLTDGSVYVLEPLESQGKWG  398



>ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44865.1| WD-repeat protein, putative [Ricinus communis]
Length=1115

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF A  LR RC I PS+YLS    N +  ++ +VI AHPQEPNQ
Sbjct  1007  CDSQLVYASFLDATVCVFSAQNLRLRCRINPSSYLSA---NVSSSLHPLVIAAHPQEPNQ  1063

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1064  FALGLSDGGVHVFEPLESEGKWGV  1087



>ref|XP_002275116.1| PREDICTED: protein TOPLESS isoform X3 [Vitis vinifera]
 emb|CBI26554.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ
Sbjct  1026  CDSMLVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS--SGVYPLVIAAHPSEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G++DG++ V+EP ++  +WG
Sbjct  1084  IALGMSDGAVHVVEPTDTEPKWG  1106



>ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [Cicer arietinum]
Length=1149

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL++ASF D  + VF A  LR RC I PSAYLS    N +  V+++VI AHPQEPNQ
Sbjct  1043  CDSQLVFASFLDATVCVFSASNLRLRCRINPSAYLSA---NVSSNVHSLVIAAHPQEPNQ  1099

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1100  FAVGLSDGIVHVFEPLESEGKWGV  1123



>ref|XP_010662133.1| PREDICTED: protein TOPLESS isoform X1 [Vitis vinifera]
Length=1139

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ
Sbjct  1030  CDSMLVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS--SGVYPLVIAAHPSEPNQ  1087

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G++DG++ V+EP ++  +WG
Sbjct  1088  IALGMSDGAVHVVEPTDTEPKWG  1110



>ref|XP_010048001.1| PREDICTED: topless-related protein 4-like isoform X3 [Eucalyptus 
grandis]
Length=797

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN + IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ
Sbjct  700  CNGESIYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQ  756

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLE  GEWG
Sbjct  757  FALGLTDGSVYVLEPLEYEGEWG  779



>gb|KCW80076.1| hypothetical protein EUGRSUZ_C01409 [Eucalyptus grandis]
Length=800

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN + IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ
Sbjct  703  CNGESIYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQ  759

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLE  GEWG
Sbjct  760  FALGLTDGSVYVLEPLEYEGEWG  782



>tpg|DAA53973.1| TPA: hypothetical protein ZEAMMB73_351755 [Zea mays]
Length=1086

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 63/105 (60%), Gaps = 28/105 (27%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNR------------------  592
             CN QL++A+F DGN+GVFDA  LR RC IAPS      V+NR                  
Sbjct  957   CNSQLVFAAFTDGNLGVFDAENLRLRCRIAPS------VINRSIRSVIELTQGFRQLGCL  1010

Query  591   ----NEGVYAVVIVAHPQEPNQLAFGLTDGSIKVIEPLESGGEWG  469
                 N  V+ +V+ AHP EPNQ A GL+DGS+KV+EPLES G+WG
Sbjct  1011  FCLCNPPVHPLVVAAHPHEPNQFAVGLSDGSVKVLEPLESEGKWG  1055



>ref|XP_010906011.1| PREDICTED: protein TOPLESS [Elaeis guineensis]
Length=1135

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  I +  A  LRPRC I P+AYL     N +  V+ +V+ AHP EPNQ
Sbjct  1027  CDSQLIYASFLDATICILSAANLRPRCRILPAAYLPA---NISTTVHPLVVAAHPSEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG++
Sbjct  1084  FALGLTDGGVHILEPLESEGKWGVA  1108



>ref|XP_008223259.1| PREDICTED: topless-related protein 2 [Prunus mume]
Length=1125

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -3

Query  708   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  529
             QL+YA+F DGNIGVFDA  L+ RC IA S YLSQ   N ++ VY + + AH  EP Q A 
Sbjct  1024  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLSQTSSN-SQTVYPLALTAHLHEPYQFAV  1082

Query  528   GLTDGSIKVIEPLESGGEWGI  466
             GLTDGS+KVIEP E+ G+WG+
Sbjct  1083  GLTDGSVKVIEPSEAEGKWGV  1103



>ref|XP_007135775.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
 ref|XP_007135776.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
 gb|ESW07769.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
 gb|ESW07770.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
Length=1137

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  I VF A  LR RC I PSAYL  +V   +  V  +VI AHPQEPNQ
Sbjct  1031  CDSQLIYASFLDATICVFSASNLRLRCRINPSAYLPASV---SSNVQPLVIAAHPQEPNQ  1087

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1088  FAVGLSDGGVHVFEPLESEGKWGV  1111



>ref|XP_009368882.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
Length=1096

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ
Sbjct  992   CDSQLIYVSFEDGSVGVLTALALRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQ  1048

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG + V+EPLES G+WG
Sbjct  1049  FALGLTDGGVHVLEPLESEGKWG  1071



>ref|XP_010662135.1| PREDICTED: protein TOPLESS isoform X4 [Vitis vinifera]
Length=1134

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ
Sbjct  1026  CDSMLVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS---GVYPLVIAAHPSEPNQ  1082

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G++DG++ V+EP ++  +WG
Sbjct  1083  IALGMSDGAVHVVEPTDTEPKWG  1105



>ref|XP_010662134.1| PREDICTED: protein TOPLESS isoform X2 [Vitis vinifera]
Length=1138

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ
Sbjct  1030  CDSMLVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS---GVYPLVIAAHPSEPNQ  1086

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G++DG++ V+EP ++  +WG
Sbjct  1087  IALGMSDGAVHVVEPTDTEPKWG  1109



>ref|XP_010050598.1| PREDICTED: topless-related protein 4-like [Eucalyptus grandis]
Length=1620

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN Q IY SF+DG+I V  A  LR RCCI P+AY+     N +  VY +VI AHP EPNQ
Sbjct  1516  CNGQSIYVSFEDGSISVLTASTLRLRCCINPAAYVPP---NPSFRVYPLVIAAHPSEPNQ  1572

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDGS+ V+EP E  GEWG
Sbjct  1573  FALGLTDGSVYVLEPWEFEGEWG  1595



>ref|XP_009361201.1| PREDICTED: topless-related protein 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=1133

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ
Sbjct  1025  CDGLLVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G+TDGS+ V+EP E+  +WG
Sbjct  1084  VALGMTDGSVHVVEPSEAELKWG  1106



>ref|XP_009361190.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361191.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361193.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361194.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361195.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361196.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361197.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361198.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361199.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361200.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=1134

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ
Sbjct  1026  CDGLLVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQ  1084

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G+TDGS+ V+EP E+  +WG
Sbjct  1085  VALGMTDGSVHVVEPSEAELKWG  1107



>ref|XP_007138952.1| hypothetical protein PHAVU_009G252100g [Phaseolus vulgaris]
 gb|ESW10946.1| hypothetical protein PHAVU_009G252100g [Phaseolus vulgaris]
Length=1047

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN QL+YA+F DGNIG+FDA+ L+ +C +A SAYL Q  + R + VY  V+ AHP EP+Q
Sbjct  965   CNGQLVYATFTDGNIGIFDANTLKLKCRMASSAYLHQPSIIR-QNVYPTVVAAHPGEPDQ  1023

Query  537   LAFGLTDGSIKVIEPLESGGEW  472
             +A GL+DGSIKVIEP     +W
Sbjct  1024  IAIGLSDGSIKVIEPRGCDRKW  1045



>ref|XP_009346204.1| PREDICTED: topless-related protein 2-like isoform X2 [Pyrus x 
bretschneideri]
Length=1141

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -3

Query  708   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  529
             QL+YA+F DG+IGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1039  QLVYAAFTDGSIGVFDADSLKLRCRIAMSVYLPQASSN-SPTVYPLALTAHLQEPYQFAV  1097

Query  528   GLTDGSIKVIEPLESGGEWGI  466
             GLTDGS+KVIEP ES G+WG+
Sbjct  1098  GLTDGSVKVIEPSESEGKWGV  1118



>ref|XP_009346203.1| PREDICTED: topless-related protein 2-like isoform X1 [Pyrus x 
bretschneideri]
Length=1167

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -3

Query  708   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  529
             QL+YA+F DG+IGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1065  QLVYAAFTDGSIGVFDADSLKLRCRIAMSVYLPQASSN-SPTVYPLALTAHLQEPYQFAV  1123

Query  528   GLTDGSIKVIEPLESGGEWGI  466
             GLTDGS+KVIEP ES G+WG+
Sbjct  1124  GLTDGSVKVIEPSESEGKWGV  1144



>ref|XP_010048000.1| PREDICTED: topless-related protein 4-like isoform X2 [Eucalyptus 
grandis]
Length=1084

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN + IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ
Sbjct  987   CNGESIYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQ  1043

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDGS+ V+EPLE  GEWG
Sbjct  1044  FALGLTDGSVYVLEPLEYEGEWG  1066



>ref|XP_010047999.1| PREDICTED: topless-related protein 4-like isoform X1 [Eucalyptus 
grandis]
Length=1092

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             CN + IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ
Sbjct  995   CNGESIYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQ  1051

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDGS+ V+EPLE  GEWG
Sbjct  1052  FALGLTDGSVYVLEPLEYEGEWG  1074



>ref|XP_010047997.1| PREDICTED: topless-related protein 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW80085.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=463

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ
Sbjct  359  CNGQSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPPT---PSLKVYPIVIAAHPSEPNQ  415

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLES G+WG
Sbjct  416  FALGLTDGSVYVLEPLESQGKWG  438



>emb|CDP10439.1| unnamed protein product [Coffea canephora]
Length=1136

 Score =   100 bits (248),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N N  V+ +VI AHP EPNQ
Sbjct  1033  CDSQSIYVSFEDGSVGVLTASSLRLRCRINPAAYLPT---NPNLRVHPLVIAAHPSEPNQ  1089

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
              A GLTDG I+V EPLES G+WG
Sbjct  1090  FALGLTDGGIQVFEPLESEGKWG  1112



>ref|XP_002268265.1| PREDICTED: protein TOPLESS [Vitis vinifera]
 emb|CBI36431.3| unnamed protein product [Vitis vinifera]
Length=1138

 Score =   100 bits (248),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YASF D  + VF A  LR RC I P+AYL  +V N N  V+ +VI AHPQEPNQ
Sbjct  1029  CDSLLVYASFLDATVCVFSAANLRLRCRINPTAYLPASVSNSN--VHPLVIAAHPQEPNQ  1086

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1087  FALGLSDGGVCVFEPLESEGKWGV  1110



>ref|XP_008363005.1| PREDICTED: topless-related protein 4-like [Malus domestica]
Length=800

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            C+ QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ
Sbjct  696  CDSQLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQ  752

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GL+DG + V+EPLES G+WG
Sbjct  753  FALGLSDGGVHVLEPLESEGKWG  775



>ref|XP_011039630.1| PREDICTED: topless-related protein 1-like isoform X2 [Populus 
euphratica]
Length=1087

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF DG + VF A  L+ RC I P++YL   V   +  VY + I AHPQEPNQ
Sbjct  977   CDSQLVYASFLDGTLRVFSASNLQVRCQINPNSYLPSDV---SSTVYPLAIAAHPQEPNQ  1033

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS++V EPLES  +WG+
Sbjct  1034  FAIGLTDGSVQVFEPLESDCKWGV  1057



>ref|XP_011039629.1| PREDICTED: topless-related protein 1-like isoform X1 [Populus 
euphratica]
Length=1099

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF DG + VF A  L+ RC I P++YL   V   +  VY + I AHPQEPNQ
Sbjct  989   CDSQLVYASFLDGTLRVFSASNLQVRCQINPNSYLPSDV---SSTVYPLAIAAHPQEPNQ  1045

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDGS++V EPLES  +WG+
Sbjct  1046  FAIGLTDGSVQVFEPLESDCKWGV  1069



>ref|XP_006389801.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
 gb|ESQ27087.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
Length=1115

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  I VF +  LR RC I PSAYL  ++ N N  V+ +VI AHPQE N 
Sbjct  1010  CDSQLIYASFMDATICVFSSANLRLRCRINPSAYLPASLSNSN--VHPLVIAAHPQESNM  1067

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GL+DG + + EPLES G+WG++
Sbjct  1068  LAVGLSDGGVHIFEPLESEGKWGVA  1092



>ref|XP_006389802.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
 gb|ESQ27088.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
Length=1116

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  I VF +  LR RC I PSAYL  ++ N N  V+ +VI AHPQE N 
Sbjct  1011  CDSQLIYASFMDATICVFSSANLRLRCRINPSAYLPASLSNSN--VHPLVIAAHPQESNM  1068

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
             LA GL+DG + + EPLES G+WG++
Sbjct  1069  LAVGLSDGGVHIFEPLESEGKWGVA  1093



>gb|KFK25571.1| hypothetical protein AALP_AA8G132300 [Arabis alpina]
Length=568

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 7/83 (8%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN QLIYA+F++GNIGVFD +RLR RC I+P AYL Q       G+  +V+ A+P+E NQ
Sbjct  487  CNGQLIYAAFRNGNIGVFDTYRLRLRCLISPFAYLPQ-------GLSPLVVAANPEEHNQ  539

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GL+DGS KVIEP E   +WG
Sbjct  540  FAVGLSDGSFKVIEPAEGEAKWG  562



>ref|XP_010050137.1| PREDICTED: topless-related protein 1-like [Eucalyptus grandis]
Length=457

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN   IY SF+DG+IGV     LR  CCI P+AY+      R   VY +VIVAHP EPNQ
Sbjct  354  CNGHSIYVSFEDGSIGVLSTSTLRLICCINPAAYILPKPSLR---VYPLVIVAHPSEPNQ  410

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLES GEWG
Sbjct  411  FALGLTDGSVYVLEPLESEGEWG  433



>gb|KHG27106.1| Topless-related 1 -like protein [Gossypium arboreum]
Length=1133

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  I VF A  LRPRC I PSAYL  +V + N  V+ +VI AHP EPN+
Sbjct  1024  CDSQLVYASFLDATICVFVAANLRPRCRINPSAYLPASVSSSN--VHPLVIAAHPSEPNE  1081

Query  537   LAFGLTDGSIKVIEPLESGGEWGISR  460
              A GL+DG + V EPLES   WG+ +
Sbjct  1082  FAVGLSDGGVHVFEPLESENRWGVPQ  1107



>gb|KCW80012.1| hypothetical protein EUGRSUZ_C01349 [Eucalyptus grandis]
Length=411

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            C+ Q IY SF+DG+I V  A  LR RC I P+AY+     N N  VY +VI AHP +PNQ
Sbjct  307  CDGQSIYVSFEDGSINVLSASTLRLRCHINPAAYIPP---NPNLRVYPLVIAAHPSQPNQ  363

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EPLES GEWG
Sbjct  364  FALGLTDGSVYVLEPLESEGEWG  386



>ref|NP_563981.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_849672.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031050.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031051.1| protein TOPLESS [Arabidopsis thaliana]
 sp|Q94AI7.1|TPL_ARATH RecName: Full=Protein TOPLESS; AltName: Full=WUS-interacting 
protein 1 [Arabidopsis thaliana]
 gb|AAK76687.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13188.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29356.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29357.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29358.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29359.1| protein TOPLESS [Arabidopsis thaliana]
Length=1131

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF +  LR RC + PSAYL  ++ N N  V+ +VI AHPQEPN 
Sbjct  1022  CDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSN--VHPLVIAAHPQEPNM  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG + + EPLES G+WG++
Sbjct  1080  FAVGLSDGGVHIFEPLESEGKWGVA  1104



>ref|XP_007013512.1| Transducin family protein / WD-40 repeat family protein isoform 
7 [Theobroma cacao]
 gb|EOY31131.1| Transducin family protein / WD-40 repeat family protein isoform 
7 [Theobroma cacao]
Length=1057

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  953   CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1009

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1010  FALGLTDGGVHILEPLESEGKWGTS  1034



>ref|XP_007013513.1| Transducin family protein / WD-40 repeat family protein isoform 
8 [Theobroma cacao]
 gb|EOY31132.1| Transducin family protein / WD-40 repeat family protein isoform 
8 [Theobroma cacao]
Length=1055

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  951   CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1007

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1008  FALGLTDGGVHILEPLESEGKWGTS  1032



>gb|KJB64729.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
Length=1135

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I+P+AYL     N +  V+ +VI AHP +PNQ
Sbjct  1031  CDSQSIYVSFEDGSVGVLTASTLRLRCRISPAAYLPP---NPSLRVFPLVIAAHPSDPNQ  1087

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG ++++EPLES G+WG S
Sbjct  1088  FALGLTDGGVQIVEPLESEGKWGTS  1112



>gb|KJB64727.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
 gb|KJB64728.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
 gb|KJB64730.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
Length=1134

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I+P+AYL     N +  V+ +VI AHP +PNQ
Sbjct  1030  CDSQSIYVSFEDGSVGVLTASTLRLRCRISPAAYLPP---NPSLRVFPLVIAAHPSDPNQ  1086

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG ++++EPLES G+WG S
Sbjct  1087  FALGLTDGGVQIVEPLESEGKWGTS  1111



>ref|XP_004296880.1| PREDICTED: topless-related protein 2 [Fragaria vesca subsp. vesca]
Length=1124

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  714   NCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQL  535
             N QL+YA F DGNIGVFDA  L+ RC IA S YL+QA  + +  VY + + AH QEP Q 
Sbjct  1020  NSQLVYAGFTDGNIGVFDADSLKLRCRIAMSVYLAQASPSSHT-VYPLALTAHLQEPYQF  1078

Query  534   AFGLTDGSIKVIEPLESGGEWGIS  463
             A GL+DGS+KVIEP ++ G+WG++
Sbjct  1079  AVGLSDGSVKVIEPSDAEGKWGVT  1102



>gb|AAF82145.1|AC034256_9 Strong similarity to an unknown protein T21F11.18 gi|6730738 
from Arabidopsis thaliana BAC T21F11 gb|AC018849 and contains 
multiple WD PF|00400 domains. ESTs gb|Z34157, gb|AA006273, 
gb|AA605431, gb|W43588, gb|W43605, gb|Z34559, gb|R90037, gb|AI994125 
come from this gene [Arabidopsis thaliana]
Length=1153

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF +  LR RC + PSAYL  ++ N N  V+ +VI AHPQEPN 
Sbjct  1044  CDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSN--VHPLVIAAHPQEPNM  1101

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG + + EPLES G+WG++
Sbjct  1102  FAVGLSDGGVHIFEPLESEGKWGVA  1126



>ref|XP_007013508.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 ref|XP_007013511.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31127.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31130.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
Length=1135

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  1031  CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1087

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1088  FALGLTDGGVHILEPLESEGKWGTS  1112



>ref|XP_007013506.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
 gb|EOY31125.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
Length=1137

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  1033  CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1089

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1090  FALGLTDGGVHILEPLESEGKWGTS  1114



>ref|XP_007013509.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
 gb|EOY31128.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
Length=1132

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  1028  CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1084

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1085  FALGLTDGGVHILEPLESEGKWGTS  1109



>ref|XP_007013510.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
 gb|EOY31129.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
Length=1136

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  1032  CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1088

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1089  FALGLTDGGVHILEPLESEGKWGTS  1113



>ref|XP_007013507.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
 gb|EOY31126.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
Length=1144

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ
Sbjct  1040  CDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQ  1096

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + ++EPLES G+WG S
Sbjct  1097  FALGLTDGGVHILEPLESEGKWGTS  1121



>ref|XP_008813124.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813126.1| PREDICTED: protein TOPLESS-like isoform X2 [Phoenix dactylifera]
 ref|XP_008813127.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813128.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813129.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
Length=1136

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  I +F+A  L  RC I P AYL  +V   +  VY +V+ AHP EPNQ
Sbjct  1028  CDSQLIYASFLDATICIFNAANLTLRCRILPVAYLPASV---STTVYPLVVAAHPSEPNQ  1084

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GLTDG + V+EPLES G+WG++
Sbjct  1085  FALGLTDGGVHVLEPLESEGKWGVA  1109



>ref|XP_006597113.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max]
 ref|XP_006597114.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max]
Length=1130

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF    LR +C I PSAYLS +V   +  V  +VI AHPQEPNQ
Sbjct  1024  CDSQLIYASFLDATVCVFSVSNLRLQCRINPSAYLSASV---SSNVQPLVIAAHPQEPNQ  1080

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1081  FAVGLSDGGVHVFEPLESEGKWGV  1104



>emb|CDO98186.1| unnamed protein product [Coffea canephora]
Length=1130

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF A  L+ RC I+P AYL  ++ N N  V  +VI AHPQ+PNQ
Sbjct  1022  CDSQLVYASFLDAAVCVFTATHLQMRCRISPPAYLPNSISNSN--VQPLVIAAHPQDPNQ  1079

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG++ V EPLES G WG+
Sbjct  1080  FAIGLSDGAVHVFEPLESDGRWGV  1103



>gb|KHN22427.1| Topless-related protein 1 [Glycine soja]
Length=1128

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QLIYASF D  + VF    LR +C I PSAYLS +V   +  V  +VI AHPQEPNQ
Sbjct  1022  CDSQLIYASFLDATVCVFSVSNLRLQCRINPSAYLSASV---SSNVQPLVIAAHPQEPNQ  1078

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG + V EPLES G+WG+
Sbjct  1079  FAVGLSDGGVHVFEPLESEGKWGV  1102



>gb|KCW80002.1| hypothetical protein EUGRSUZ_C01336 [Eucalyptus grandis]
Length=485

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  717  CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
            CN Q IY SF+DG+I V  A  LR RCCI P+AY+     N +  VY +VI AHP EPNQ
Sbjct  381  CNGQSIYVSFEDGSISVLTASTLRLRCCINPAAYVPP---NPSFRVYPLVIAAHPSEPNQ  437

Query  537  LAFGLTDGSIKVIEPLESGGEWG  469
             A GLTDGS+ V+EP E  GEWG
Sbjct  438  FALGLTDGSVYVLEPWEFEGEWG  460



>ref|XP_010241551.1| PREDICTED: topless-related protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=1134

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  714   NCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQL  535
             + Q IY SF+DG++GVF A  LR RC I P+AYL     N +  VY +VI AHP EPNQ 
Sbjct  1031  DSQSIYTSFEDGSVGVFTATTLRLRCRINPTAYLPS---NPSVRVYPLVIAAHPSEPNQF  1087

Query  534   AFGLTDGSIKVIEPLESGGEWGIS  463
             A GLTDG + V+EPLES G+WG S
Sbjct  1088  AVGLTDGGVYVLEPLESEGKWGTS  1111



>ref|XP_010241550.1| PREDICTED: topless-related protein 4-like isoform X1 [Nelumbo 
nucifera]
Length=1135

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  714   NCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQL  535
             + Q IY SF+DG++GVF A  LR RC I P+AYL     N +  VY +VI AHP EPNQ 
Sbjct  1032  DSQSIYTSFEDGSVGVFTATTLRLRCRINPTAYLPS---NPSVRVYPLVIAAHPSEPNQF  1088

Query  534   AFGLTDGSIKVIEPLESGGEWGIS  463
             A GLTDG + V+EPLES G+WG S
Sbjct  1089  AVGLTDGGVYVLEPLESEGKWGTS  1112



>ref|XP_008376897.1| PREDICTED: topless-related protein 1-like isoform X2 [Malus domestica]
Length=1133

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ
Sbjct  1025  CDGLLVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G+TDGS+ V+EP ++  +WG
Sbjct  1084  IALGMTDGSVHVVEPSDAELKWG  1106



>ref|XP_008376892.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
 ref|XP_008376893.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
 ref|XP_008376895.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
 ref|XP_008376896.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
Length=1134

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+  L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ
Sbjct  1026  CDGLLVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQ  1084

Query  537   LAFGLTDGSIKVIEPLESGGEWG  469
             +A G+TDGS+ V+EP ++  +WG
Sbjct  1085  IALGMTDGSVHVVEPSDAELKWG  1107



>ref|XP_008228737.1| PREDICTED: protein TOPLESS [Prunus mume]
Length=1139

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF A  LR RC I PS YL   V N    V  +VI AHPQEPNQ
Sbjct  1032  CDSQLVYASFLDATVCVFSAANLRLRCRINPSVYLPANVSNN---VQPLVIAAHPQEPNQ  1088

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG++ V EPLES G+WG+
Sbjct  1089  FALGLSDGAVHVFEPLESEGKWGV  1112



>ref|XP_007214907.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica]
 gb|EMJ16106.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica]
Length=1139

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + VF A  LR RC I PS YL   V N    V  +VI AHPQEPNQ
Sbjct  1032  CDSQLVYASFLDATVCVFSAANLRLRCRINPSVYLPANVSNN---VQPLVIAAHPQEPNQ  1088

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GL+DG++ V EPLES G+WG+
Sbjct  1089  FALGLSDGAVHVFEPLESEGKWGV  1112



>emb|CDY33387.1| BnaC05g11960D [Brassica napus]
Length=1118

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  I VF +  LR RC + PSAYL  ++ N N  V+ +VI AHPQEPN 
Sbjct  1009  CDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSN--VHPLVIAAHPQEPNM  1066

Query  537   LAFGLTDGSIKVIEPLESGGEWGIS  463
              A GL+DG + + EP+ES G+WG++
Sbjct  1067  FAVGLSDGGVHIFEPVESEGKWGVA  1091



>ref|XP_010250289.1| PREDICTED: protein TOPLESS-like isoform X3 [Nelumbo nucifera]
Length=1135

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -3

Query  717   CNCQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQ  538
             C+ QL+YASF D  + +F A  LR RC I  SAYL    +N +  VY +V+ AHP EPNQ
Sbjct  1027  CDSQLVYASFLDATVCIFSAANLRLRCHINSSAYLP---VNVSSNVYPLVVAAHPSEPNQ  1083

Query  537   LAFGLTDGSIKVIEPLESGGEWGI  466
              A GLTDG + V EPLES G+WGI
Sbjct  1084  FAMGLTDGGVHVFEPLESEGKWGI  1107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410