BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034O13

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN14569.1|  Eukaryotic translation initiation factor 3 subunit I    316   1e-105   Glycine soja [wild soybean]
ref|XP_008443373.1|  PREDICTED: eukaryotic translation initiation...    318   8e-105   Cucumis melo [Oriental melon]
ref|XP_007222666.1|  hypothetical protein PRUPE_ppa008567mg             318   1e-104   Prunus persica
ref|XP_008220972.1|  PREDICTED: eukaryotic translation initiation...    317   1e-104   Prunus mume [ume]
gb|KDP38201.1|  hypothetical protein JCGZ_04844                         317   2e-104   Jatropha curcas
ref|XP_003517705.1|  PREDICTED: eukaryotic translation initiation...    316   6e-104   Glycine max [soybeans]
ref|XP_002521889.1|  eukaryotic translation initiation factor 3 s...    315   9e-104   Ricinus communis
ref|XP_004136687.1|  PREDICTED: eukaryotic translation initiation...    315   9e-104   Cucumis sativus [cucumbers]
ref|XP_006351166.1|  PREDICTED: eukaryotic translation initiation...    315   1e-103   Solanum tuberosum [potatoes]
gb|KDO58633.1|  hypothetical protein CISIN_1g020461mg                   313   1e-103   Citrus sinensis [apfelsine]
ref|XP_007157442.1|  hypothetical protein PHAVU_002G070400g             315   1e-103   Phaseolus vulgaris [French bean]
ref|XP_010062244.1|  PREDICTED: eukaryotic translation initiation...    314   2e-103   Eucalyptus grandis [rose gum]
ref|XP_007016708.1|  Transducin/WD40 repeat-like superfamily prot...    314   2e-103   
ref|XP_004250371.1|  PREDICTED: eukaryotic translation initiation...    314   3e-103   Solanum lycopersicum
gb|ABK94219.1|  unknown                                                 313   4e-103   Populus trichocarpa [western balsam poplar]
ref|XP_009777665.1|  PREDICTED: eukaryotic translation initiation...    313   4e-103   Nicotiana sylvestris
gb|KHN32457.1|  Eukaryotic translation initiation factor 3 subunit I    309   6e-103   Glycine soja [wild soybean]
ref|XP_009629813.1|  PREDICTED: eukaryotic translation initiation...    313   6e-103   Nicotiana tomentosiformis
ref|XP_009777666.1|  PREDICTED: eukaryotic translation initiation...    313   6e-103   Nicotiana sylvestris
gb|KJB56103.1|  hypothetical protein B456_009G106100                    311   7e-103   Gossypium raimondii
gb|KJB56101.1|  hypothetical protein B456_009G106100                    310   1e-102   Gossypium raimondii
ref|XP_003534423.1|  PREDICTED: eukaryotic translation initiation...    312   1e-102   Glycine max [soybeans]
gb|AES67165.2|  eukaryotic translation initiation factor 3 subunit I    312   2e-102   Medicago truncatula
ref|XP_003596914.1|  Eukaryotic translation initiation factor 3 s...    311   2e-102   
gb|KJB56100.1|  hypothetical protein B456_009G106100                    311   2e-102   Gossypium raimondii
ref|XP_002285281.1|  PREDICTED: eukaryotic translation initiation...    311   3e-102   Vitis vinifera
ref|XP_004492932.1|  PREDICTED: eukaryotic translation initiation...    311   3e-102   Cicer arietinum [garbanzo]
ref|XP_011095354.1|  PREDICTED: eukaryotic translation initiation...    311   3e-102   Sesamum indicum [beniseed]
ref|XP_006448047.1|  hypothetical protein CICLE_v10015917mg             311   3e-102   Citrus clementina [clementine]
ref|XP_008389128.1|  PREDICTED: eukaryotic translation initiation...    311   5e-102   
ref|XP_010557463.1|  PREDICTED: eukaryotic translation initiation...    311   5e-102   Tarenaya hassleriana [spider flower]
ref|XP_011021700.1|  PREDICTED: eukaryotic translation initiation...    311   5e-102   Populus euphratica
gb|KJB26172.1|  hypothetical protein B456_004G228300                    311   5e-102   Gossypium raimondii
ref|XP_008340535.1|  PREDICTED: eukaryotic translation initiation...    310   6e-102   Malus domestica [apple tree]
gb|KHG16392.1|  Eukaryotic translation initiation factor 3 subuni...    310   7e-102   Gossypium arboreum [tree cotton]
ref|XP_009351622.1|  PREDICTED: eukaryotic translation initiation...    310   1e-101   Pyrus x bretschneideri [bai li]
gb|EYU22708.1|  hypothetical protein MIMGU_mgv1a009949mg                309   2e-101   Erythranthe guttata [common monkey flower]
ref|XP_006591952.1|  PREDICTED: eukaryotic translation initiation...    309   3e-101   Glycine max [soybeans]
ref|XP_002311556.2|  TGF-beta receptor-interacting protein 1            307   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_004489218.1|  PREDICTED: eukaryotic translation initiation...    307   2e-100   Cicer arietinum [garbanzo]
ref|XP_009129412.1|  PREDICTED: eukaryotic translation initiation...    306   4e-100   Brassica rapa
ref|XP_011024978.1|  PREDICTED: eukaryotic translation initiation...    305   7e-100   Populus euphratica
ref|XP_010521568.1|  PREDICTED: eukaryotic translation initiation...    305   8e-100   Tarenaya hassleriana [spider flower]
gb|EYU22777.1|  hypothetical protein MIMGU_mgv1a009964mg                305   1e-99    Erythranthe guttata [common monkey flower]
ref|XP_008350825.1|  PREDICTED: eukaryotic translation initiation...    304   2e-99    
gb|EPS73291.1|  hypothetical protein M569_01462                         303   4e-99    Genlisea aurea
ref|XP_010926275.1|  PREDICTED: eukaryotic translation initiation...    303   7e-99    Elaeis guineensis
ref|XP_010111947.1|  Eukaryotic translation initiation factor 3 s...    305   2e-98    
gb|KFK37423.1|  hypothetical protein AALP_AA4G255300                    301   3e-98    Arabis alpina [alpine rockcress]
ref|XP_010514644.1|  PREDICTED: eukaryotic translation initiation...    301   3e-98    Camelina sativa [gold-of-pleasure]
emb|CDY34145.1|  BnaA02g28950D                                          301   3e-98    Brassica napus [oilseed rape]
gb|EPS65969.1|  hypothetical protein M569_08807                         301   4e-98    Genlisea aurea
emb|CDP11515.1|  unnamed protein product                                296   6e-98    Coffea canephora [robusta coffee]
ref|XP_009151956.1|  PREDICTED: eukaryotic translation initiation...    300   6e-98    Brassica rapa
ref|XP_010502959.1|  PREDICTED: eukaryotic translation initiation...    300   8e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010425732.1|  PREDICTED: eukaryotic translation initiation...    300   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006395439.1|  hypothetical protein EUTSA_v10004580mg             299   2e-97    Eutrema salsugineum [saltwater cress]
gb|ABR18068.1|  unknown                                                 299   2e-97    Picea sitchensis
gb|ABK26793.1|  unknown                                                 298   4e-97    Picea sitchensis
emb|CDP20306.1|  unnamed protein product                                297   8e-97    Coffea canephora [robusta coffee]
ref|XP_008782131.1|  PREDICTED: eukaryotic translation initiation...    296   2e-96    Phoenix dactylifera
ref|XP_010937470.1|  PREDICTED: eukaryotic translation initiation...    296   2e-96    Elaeis guineensis
ref|XP_006854979.1|  hypothetical protein AMTR_s00052p00194740          292   6e-96    
emb|CDY03970.1|  BnaC02g36850D                                          304   2e-95    
ref|XP_004297796.1|  PREDICTED: eukaryotic translation initiation...    294   2e-95    Fragaria vesca subsp. vesca
ref|XP_010249002.1|  PREDICTED: eukaryotic translation initiation...    293   3e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008808070.1|  PREDICTED: eukaryotic translation initiation...    290   6e-95    Phoenix dactylifera
ref|XP_002882056.1|  TGF-beta receptor interacting protein 1            293   6e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_002315834.2|  TGF-beta receptor-interacting protein 1            293   7e-95    
ref|XP_010275011.1|  PREDICTED: eukaryotic translation initiation...    292   1e-94    Nelumbo nucifera [Indian lotus]
ref|XP_009389562.1|  PREDICTED: eukaryotic translation initiation...    291   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008808069.1|  PREDICTED: eukaryotic translation initiation...    291   2e-94    Phoenix dactylifera
ref|NP_182152.2|  transducin/WD40 repeat-like superfamily protein       291   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAC62877.1|  eukaryotic translation initiation factor 3 delta ...    291   4e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43524.1|  putative eukaryotic translation initiation facto...    291   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506629.1|  PREDICTED: eukaryotic translation initiation...    291   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010508042.1|  PREDICTED: eukaryotic translation initiation...    291   4e-94    Camelina sativa [gold-of-pleasure]
emb|CDY71621.1|  BnaAnng38210D                                          290   7e-94    Brassica napus [oilseed rape]
gb|AIZ68198.1|  eukaryotic translation initiation factor 3 subuni...    289   1e-93    Ornithogalum longebracteatum [sea-onion]
emb|CDY13713.1|  BnaA06g32100D                                          290   2e-93    Brassica napus [oilseed rape]
gb|ACF82853.1|  unknown                                                 284   3e-93    Zea mays [maize]
ref|XP_002862549.1|  eukaryotic translation initiation factor 3 d...    288   4e-93    
ref|NP_001061508.1|  Os08g0308100                                       288   5e-93    
ref|XP_006663589.1|  PREDICTED: eukaryotic translation initiation...    287   7e-93    
gb|EMS51995.1|  Eukaryotic translation initiation factor 3 subunit I    288   8e-93    Triticum urartu
ref|XP_006294579.1|  hypothetical protein CARUB_v10023615mg             286   3e-92    Capsella rubella
ref|NP_001055036.1|  Os05g0256000                                       285   5e-92    
ref|XP_003577379.1|  PREDICTED: eukaryotic translation initiation...    285   6e-92    Brachypodium distachyon [annual false brome]
ref|XP_008670966.1|  PREDICTED: eukaryotic translation initiation...    285   1e-91    Zea mays [maize]
ref|XP_002461510.1|  hypothetical protein SORBIDRAFT_02g003760          285   1e-91    Sorghum bicolor [broomcorn]
ref|NP_001147501.1|  eukaryotic translation initiation factor 3 s...    284   1e-91    Zea mays [maize]
gb|AFM95335.1|  eukaryotic translation initiation factor 3 subunit i    284   2e-91    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85385.1|  predicted protein                                      284   2e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955547.1|  PREDICTED: eukaryotic translation initiation...    284   2e-91    Setaria italica
ref|XP_002882057.1|  hypothetical protein ARALYDRAFT_322284             285   3e-91    
ref|XP_001758941.1|  predicted protein                                  283   5e-91    
ref|NP_182151.1|  TGF-beta receptor interacting protein 1               281   2e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAG53616.1|AF285835_1  eukaryotic initiation factor 3I1 subunit      281   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001757566.1|  predicted protein                                  281   2e-90    
ref|XP_001763986.1|  predicted protein                                  281   3e-90    
gb|AAK43862.1|AF370485_1  eukaryotic translation initiation facto...    279   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678072.1|  PREDICTED: eukaryotic translation initiation...    276   2e-88    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAH19940.1|  AT2G46280                                              275   6e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AAC49079.1|  TGF-beta receptor interacting protein 1 homolog         271   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988251.1|  hypothetical protein SELMODRAFT_269383             270   5e-86    Selaginella moellendorffii
gb|KDO58631.1|  hypothetical protein CISIN_1g020461mg                   266   1e-84    Citrus sinensis [apfelsine]
ref|XP_006448046.1|  hypothetical protein CICLE_v10015917mg             266   2e-84    
gb|EAZ42270.1|  hypothetical protein OsJ_26838                          244   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007215753.1|  hypothetical protein PRUPE_ppa009367mg             241   3e-75    
ref|XP_002500789.1|  predicted protein                                  229   2e-70    Micromonas commoda
ref|XP_001418365.1|  predicted protein                                  221   3e-67    Ostreococcus lucimarinus CCE9901
ref|XP_003079673.1|  TGF-beta receptor-interacting protein 1 (ISS)      219   2e-66    Ostreococcus tauri
ref|XP_003059370.1|  predicted protein                                  220   2e-66    Micromonas pusilla CCMP1545
gb|KCW69348.1|  hypothetical protein EUGRSUZ_F02830                     215   2e-65    Eucalyptus grandis [rose gum]
ref|XP_007512918.1|  predicted protein                                  214   3e-64    Bathycoccus prasinos
gb|EMT33770.1|  hypothetical protein F775_29343                         216   3e-64    
gb|KJB56102.1|  hypothetical protein B456_009G106100                    212   2e-63    Gossypium raimondii
ref|XP_011401093.1|  Eukaryotic translation initiation factor 3 s...    210   1e-62    Auxenochlorella protothecoides
gb|KDD75202.1|  hypothetical protein H632_c812p0                        202   1e-59    Helicosporidium sp. ATCC 50920
ref|XP_006395438.1|  hypothetical protein EUTSA_v10004580mg             198   1e-58    
gb|KIZ03352.1|  Eukaryotic translation initiation factor 3 subunit I    194   9e-57    Monoraphidium neglectum
ref|XP_008549768.1|  PREDICTED: eukaryotic translation initiation...    194   2e-56    Microplitis demolitor
ref|XP_008553489.1|  PREDICTED: eukaryotic translation initiation...    192   5e-56    Microplitis demolitor
ref|XP_001693266.1|  eukaryotic initiation factor                       191   3e-55    Chlamydomonas reinhardtii
ref|XP_011314062.1|  PREDICTED: eukaryotic translation initiation...    191   3e-55    Fopius arisanus
ref|NP_001040433.1|  eukaryotic translation initiation factor 3 s...    189   9e-55    Bombyx mori [silk moth]
ref|XP_011337589.1|  PREDICTED: eukaryotic translation initiation...    189   9e-55    Ooceraea biroi
ref|XP_005647023.1|  TGF-beta receptor-interacting protein 1            189   9e-55    Coccomyxa subellipsoidea C-169
ref|XP_011254946.1|  PREDICTED: eukaryotic translation initiation...    189   1e-54    Camponotus floridanus
ref|XP_011160448.1|  PREDICTED: eukaryotic translation initiation...    188   2e-54    Solenopsis invicta [imported red fire ant]
gb|EFZ22632.1|  hypothetical protein SINV_00160                         188   2e-54    
gb|EGI64611.1|  Eukaryotic translation initiation factor 3 subunit I    188   2e-54    Acromyrmex echinatior
ref|XP_011055583.1|  PREDICTED: eukaryotic translation initiation...    188   3e-54    Acromyrmex echinatior
gb|KJE92223.1|  Trip1-PA                                                186   1e-53    Capsaspora owczarzaki ATCC 30864
ref|XP_004364074.2|  Trip1-PA                                           186   1e-53    Capsaspora owczarzaki ATCC 30864
ref|XP_002957235.1|  eukaryotic translation initiation factor 3i        186   1e-53    Volvox carteri f. nagariensis
gb|EHJ63876.1|  eukaryotic translation initiation factor 3 subunit I    186   2e-53    
ref|XP_002021487.1|  GL26537                                            186   2e-53    Drosophila persimilis
dbj|BAM18089.1|  eukaryotic translation initiation factor 3 subun...    186   2e-53    Papilio xuthus [Chinese swallowtail]
ref|XP_002001737.1|  GI15375                                            185   4e-53    
ref|XP_392780.2|  PREDICTED: eukaryotic translation initiation fa...    185   4e-53    Apis mellifera [bee]
sp|B3MVL6.2|EIF3I_DROAN  RecName: Full=Eukaryotic translation ini...    185   5e-53    Drosophila ananassae
ref|XP_001965147.1|  GF23646                                            185   5e-53    
ref|XP_002051937.1|  GJ17275                                            184   7e-53    
gb|EFX80147.1|  hypothetical protein DAPPUDRAFT_304176                  184   7e-53    Daphnia pulex
gb|EFN69223.1|  Eukaryotic translation initiation factor 3 subunit I    184   7e-53    Camponotus floridanus
sp|B4LUA5.2|EIF3I_DROVI  RecName: Full=Eukaryotic translation ini...    184   7e-53    Drosophila virilis
ref|XP_011145247.1|  PREDICTED: eukaryotic translation initiation...    184   8e-53    Harpegnathos saltator
ref|XP_005707349.1|  translation initiation factor eIF-3 subunit 2      184   8e-53    Galdieria sulphuraria
ref|XP_003707661.1|  PREDICTED: eukaryotic translation initiation...    184   9e-53    Megachile rotundata
ref|XP_002078185.1|  GD22675                                            184   1e-52    Drosophila simulans
ref|XP_011180318.1|  PREDICTED: eukaryotic translation initiation...    184   1e-52    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011198986.1|  PREDICTED: eukaryotic translation initiation...    184   2e-52    Bactrocera dorsalis [papaya fruit fly]
emb|CCA18540.1|  eukaryotic translation initiation factor 3 subun...    184   2e-52    Albugo laibachii Nc14
ref|NP_523478.1|  Trip1                                                 183   2e-52    Drosophila melanogaster
ref|XP_004531427.1|  PREDICTED: eukaryotic translation initiation...    183   2e-52    Ceratitis capitata [medfly]
ref|XP_001968738.1|  GG24335                                            183   2e-52    Drosophila erecta
ref|XP_001989068.1|  GH10244                                            183   2e-52    Drosophila grimshawi
gb|ETN60290.1|  eukaryotic translation initiation factor 3 subunit      183   2e-52    Anopheles darlingi [American malaria mosquito]
ref|XP_002088703.1|  Trip1                                              183   3e-52    
ref|XP_316636.4|  AGAP006607-PA                                         183   3e-52    Anopheles gambiae str. PEST
sp|B4NW98.2|EIF3I_DROYA  RecName: Full=Eukaryotic translation ini...    182   3e-52    Drosophila yakuba
ref|XP_003396808.1|  PREDICTED: eukaryotic translation initiation...    182   3e-52    
gb|KDR14214.1|  hypothetical protein L798_11754                         183   4e-52    Zootermopsis nevadensis
ref|XP_002066637.1|  GK24461                                            182   4e-52    
ref|XP_003487069.1|  PREDICTED: eukaryotic translation initiation...    182   4e-52    Bombus impatiens
ref|XP_005535289.1|  eukaryotic translation initiation factor eIF...    182   4e-52    Cyanidioschyzon merolae strain 10D
gb|KFO76878.1|  Eukaryotic translation initiation factor 3 subunit I    180   6e-52    Cuculus canorus
ref|XP_008188704.1|  PREDICTED: eukaryotic translation initiation...    178   6e-52    
gb|ETO77218.1|  hypothetical protein F444_07544                         182   7e-52    Phytophthora parasitica P1976
ref|XP_009560176.1|  PREDICTED: eukaryotic translation initiation...    180   7e-52    Cuculus canorus
gb|ABK92672.1|  unknown                                                 174   8e-52    Populus trichocarpa [western balsam poplar]
gb|AEE62555.1|  unknown                                                 182   8e-52    Dendroctonus ponderosae
gb|KFQ29136.1|  Eukaryotic translation initiation factor 3 subunit I    179   8e-52    Merops nubicus
ref|XP_005427180.1|  PREDICTED: eukaryotic translation initiation...    179   9e-52    
ref|XP_007363750.1|  WD40 repeat-like protein                           182   9e-52    Dichomitus squalens LYAD-421 SS1
ref|XP_002431936.1|  eukaryotic translation initiation factor 3 s...    181   1e-51    Pediculus humanus corporis [human body lice]
ref|XP_010731470.1|  PREDICTED: eukaryotic translation initiation...    181   1e-51    
ref|XP_002400973.1|  translation initiation factor 3 and TGF-beta...    177   1e-51    
ref|XP_008904158.1|  hypothetical protein PPTG_10533                    181   1e-51    Phytophthora parasitica INRA-310
ref|XP_010083431.1|  PREDICTED: eukaryotic translation initiation...    179   1e-51    Pterocles gutturalis
gb|AFK47032.1|  unknown                                                 174   1e-51    Medicago truncatula
ref|XP_008937943.1|  PREDICTED: eukaryotic translation initiation...    179   1e-51    Merops nubicus
ref|XP_967415.1|  PREDICTED: eukaryotic translation initiation fa...    181   1e-51    Tribolium castaneum [rust-red flour beetle]
ref|XP_009538303.1|  hypothetical protein PHYSODRAFT_551045             181   2e-51    Phytophthora sojae
ref|XP_008613397.1|  translation initiation factor 3 subunit I          181   2e-51    Saprolegnia diclina VS20
ref|XP_010012332.1|  PREDICTED: eukaryotic translation initiation...    179   2e-51    Nestor notabilis
ref|XP_009330494.1|  PREDICTED: eukaryotic translation initiation...    179   2e-51    Pygoscelis adeliae
ref|XP_006676014.1|  hypothetical protein BATDEDRAFT_84729              181   3e-51    Batrachochytrium dendrobatidis JAM81
gb|EJU03377.1|  WD40 repeat-like protein                                181   3e-51    Dacryopinax primogenitus
ref|XP_009482861.1|  PREDICTED: eukaryotic translation initiation...    179   3e-51    Pelecanus crispus
ref|XP_005823889.1|  translation initiation factor 3, subunit I         179   5e-51    Guillardia theta CCMP2712
gb|KFP30991.1|  Eukaryotic translation initiation factor 3 subunit I    179   6e-51    Colius striatus
emb|CCI46504.1|  unnamed protein product                                179   6e-51    Albugo candida
ref|XP_006806095.1|  PREDICTED: eukaryotic translation initiation...    179   7e-51    Neolamprologus brichardi [lyretail cichlid]
gb|KFB49333.1|  AGAP006607-PA-like protein                              180   7e-51    Anopheles sinensis
ref|XP_003443814.1|  PREDICTED: eukaryotic translation initiation...    179   7e-51    Oreochromis niloticus
gb|EFN80705.1|  Eukaryotic translation initiation factor 3 subunit I    179   7e-51    Harpegnathos saltator
ref|XP_009814792.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    178   8e-51    Gavia stellata
gb|EFN80704.1|  Eukaryotic translation initiation factor 3 subunit I    179   8e-51    Harpegnathos saltator
gb|EMC82690.1|  Eukaryotic translation initiation factor 3 subunit I    178   8e-51    
ref|XP_010221644.1|  PREDICTED: eukaryotic translation initiation...    174   9e-51    Tinamus guttatus
ref|XP_005509744.1|  PREDICTED: eukaryotic translation initiation...    178   9e-51    Columba livia [carrier pigeon]
ref|XP_007067631.1|  PREDICTED: eukaryotic translation initiation...    176   9e-51    Chelonia mydas [green seaturtle]
gb|ACD65081.1|  eukaryotic translation initiation factor                179   1e-50    Forcipomyia taiwana
ref|XP_010198429.1|  PREDICTED: eukaryotic translation initiation...    178   1e-50    Colius striatus
ref|XP_002899797.1|  eukaryotic translation initiation factor 3 s...    179   1e-50    Phytophthora infestans T30-4
ref|XP_009283047.1|  PREDICTED: eukaryotic translation initiation...    179   1e-50    Aptenodytes forsteri
ref|XP_009927166.1|  PREDICTED: eukaryotic translation initiation...    178   1e-50    Haliaeetus albicilla
ref|XP_003844805.1|  similar to eukaryotic translation initiation...    179   1e-50    Leptosphaeria maculans JN3
ref|XP_008024458.1|  hypothetical protein SETTUDRAFT_168745             179   1e-50    Exserohilum turcica Et28A
ref|XP_003969003.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    Takifugu rubripes [tiger puffer]
ref|XP_009977243.1|  PREDICTED: eukaryotic translation initiation...    179   2e-50    Tauraco erythrolophus
ref|XP_009579506.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    Fulmarus glacialis
gb|KFP00122.1|  Eukaryotic translation initiation factor 3 subunit I    178   2e-50    Calypte anna
ref|XP_009679337.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    Struthio camelus australis
ref|XP_005239876.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    
ref|XP_010168387.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    Antrostomus carolinensis
ref|XP_007680736.1|  hypothetical protein BAUCODRAFT_286498             179   2e-50    Baudoinia panamericana UAMH 10762
gb|KFP52286.1|  Eukaryotic translation initiation factor 3 subunit I    176   2e-50    Cathartes aura
gb|EOB00694.1|  Eukaryotic translation initiation factor 3 subunit I    178   2e-50    Anas platyrhynchos [duck]
gb|KFV75063.1|  Eukaryotic translation initiation factor 3 subunit I    178   2e-50    Picoides pubescens
ref|NP_001157867.1|  eukaryotic translation initiation factor 3 s...    178   2e-50    Gallus gallus [bantam]
ref|XP_009882825.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    Charadrius vociferus
ref|XP_010574326.1|  PREDICTED: eukaryotic translation initiation...    178   2e-50    Haliaeetus leucocephalus
ref|XP_009646824.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    178   2e-50    Egretta garzetta
ref|XP_009708532.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    178   3e-50    Cariama cristata
ref|XP_010574327.1|  PREDICTED: eukaryotic translation initiation...    178   3e-50    Haliaeetus leucocephalus
ref|XP_005181692.1|  PREDICTED: eukaryotic translation initiation...    177   3e-50    Musca domestica
gb|KEQ62058.1|  putative eukaryotic translation initiation factor...    178   3e-50    Aureobasidium melanogenum CBS 110374
ref|XP_002167671.1|  PREDICTED: eukaryotic translation initiation...    177   3e-50    Hydra vulgaris
ref|XP_009964403.1|  PREDICTED: eukaryotic translation initiation...    177   3e-50    Tyto alba [Schleiereule]
ref|XP_008294825.1|  PREDICTED: eukaryotic translation initiation...    177   3e-50    Stegastes partitus
ref|XP_009068306.1|  PREDICTED: eukaryotic translation initiation...    177   3e-50    Acanthisitta chloris
emb|CAF99511.1|  unnamed protein product                                177   3e-50    Tetraodon nigroviridis
ref|XP_010280277.1|  PREDICTED: eukaryotic translation initiation...    178   3e-50    Phaethon lepturus
gb|KFQ49075.1|  Eukaryotic translation initiation factor 3 subunit I    176   3e-50    Nestor notabilis
ref|XP_008491107.1|  PREDICTED: eukaryotic translation initiation...    178   3e-50    
ref|XP_005058303.1|  PREDICTED: eukaryotic translation initiation...    177   3e-50    Ficedula albicollis
gb|KFP75614.1|  Eukaryotic translation initiation factor 3 subunit I    177   3e-50    Acanthisitta chloris
ref|NP_001157823.1|  eukaryotic translation initiation factor 3 s...    177   3e-50    Taeniopygia guttata
ref|XP_010721802.1|  PREDICTED: eukaryotic translation initiation...    178   3e-50    Meleagris gallopavo [common turkey]
ref|XP_009906815.1|  PREDICTED: eukaryotic translation initiation...    178   4e-50    Picoides pubescens
ref|XP_005020506.1|  PREDICTED: eukaryotic translation initiation...    178   4e-50    
ref|XP_009821601.1|  hypothetical protein H257_00561                    177   4e-50    Aphanomyces astaci
ref|XP_010295903.1|  PREDICTED: eukaryotic translation initiation...    177   4e-50    Balearica regulorum gibbericeps
gb|KFW72870.1|  Eukaryotic translation initiation factor 3 subunit I    176   4e-50    Pygoscelis adeliae
gb|ACQ58286.1|  Eukaryotic translation initiation factor 3 subunit I    177   5e-50    Anoplopoma fimbria
ref|XP_007692855.1|  hypothetical protein COCMIDRAFT_108319             177   5e-50    Bipolaris oryzae ATCC 44560
ref|NP_001133273.1|  Eukaryotic translation initiation factor 3 s...    177   5e-50    Salmo salar
ref|XP_005142501.1|  PREDICTED: eukaryotic translation initiation...    177   6e-50    
gb|KEQ86784.1|  putative eukaryotic translation initiation factor...    177   6e-50    Aureobasidium pullulans EXF-150
emb|CDQ91911.1|  unnamed protein product                                177   6e-50    Oncorhynchus mykiss
ref|XP_011501372.1|  PREDICTED: eukaryotic translation initiation...    177   6e-50    Ceratosolen solmsi marchali
ref|NP_001156064.1|  eukaryotic translation initiation factor 3 s...    177   6e-50    Acyrthosiphon pisum
ref|NP_998155.1|  eukaryotic translation initiation factor 3 subu...    177   6e-50    Danio rerio [leopard danio]
gb|KFO60217.1|  Eukaryotic translation initiation factor 3 subunit I    177   7e-50    Corvus brachyrhynchos
ref|XP_008862518.1|  hypothetical protein H310_01239                    177   7e-50    Aphanomyces invadans
ref|XP_003228758.1|  PREDICTED: eukaryotic translation initiation...    177   7e-50    Anolis carolinensis [Carolina anole]
ref|XP_008633416.1|  PREDICTED: eukaryotic translation initiation...    177   7e-50    Corvus brachyrhynchos
ref|XP_001933019.1|  eukaryotic translation initiation factor 3 s...    177   8e-50    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_009451208.1|  PREDICTED: eukaryotic translation initiation...    174   8e-50    
ref|XP_002115720.1|  expressed hypothetical protein                     176   8e-50    Trichoplax adhaerens
ref|NP_001279068.1|  eukaryotic translation initiation factor 3, ...    176   8e-50    Callorhinchus milii [Australian ghost shark]
dbj|BAE01324.1|  unnamed protein product                                172   9e-50    Macaca fascicularis [crab eating macaque]
gb|KEQ92579.1|  hypothetical protein AUEXF2481DRAFT_423089              177   9e-50    Aureobasidium subglaciale EXF-2481
ref|XP_010902262.1|  PREDICTED: eukaryotic translation initiation...    176   1e-49    Esox lucius
gb|KIO29603.1|  hypothetical protein M407DRAFT_167483                   176   1e-49    Tulasnella calospora MUT 4182
gb|KFQ11963.1|  Eukaryotic translation initiation factor 3 subunit I    175   2e-49    Haliaeetus albicilla
gb|KEQ76375.1|  eukaryotic translation initiation factor 3 subunit I    176   2e-49    Aureobasidium namibiae CBS 147.97
ref|XP_006019466.1|  PREDICTED: eukaryotic translation initiation...    176   2e-49    Alligator sinensis
gb|KFV10110.1|  Eukaryotic translation initiation factor 3 subunit I    176   2e-49    Tauraco erythrolophus
ref|XP_006274867.1|  PREDICTED: eukaryotic translation initiation...    176   2e-49    Alligator mississippiensis
gb|KFM11279.1|  Eukaryotic translation initiation factor 3 subunit I    176   2e-49    Aptenodytes forsteri
ref|NP_001280295.1|  uncharacterized protein LOC100162604               175   2e-49    Acyrthosiphon pisum
gb|KFQ71196.1|  Eukaryotic translation initiation factor 3 subunit I    175   2e-49    Phaethon lepturus
dbj|BAE90204.1|  unnamed protein product                                174   2e-49    Macaca fascicularis [crab eating macaque]
gb|ACO13175.1|  Eukaryotic translation initiation factor 3 subunit I    175   2e-49    Lepeophtheirus salmonis
ref|XP_003387873.1|  PREDICTED: eukaryotic translation initiation...    175   3e-49    
gb|KGL92853.1|  Eukaryotic translation initiation factor 3 subunit I    175   3e-49    
gb|AHH54970.1|  eukaryotic translation initiation factor 3 subunit I    172   3e-49    
gb|KFW07927.1|  Eukaryotic translation initiation factor 3 subunit I    175   3e-49    
gb|KFZ50593.1|  Eukaryotic translation initiation factor 3 subunit I    175   3e-49    
gb|ELU14583.1|  hypothetical protein CAPTEDRAFT_180537                  175   3e-49    
gb|KFQ08008.1|  Eukaryotic translation initiation factor 3 subunit I    175   4e-49    
gb|KFP10887.1|  Eukaryotic translation initiation factor 3 subunit I    175   4e-49    
ref|XP_007563815.1|  PREDICTED: eukaryotic translation initiation...    175   4e-49    
ref|XP_005102454.1|  PREDICTED: eukaryotic translation initiation...    175   4e-49    
ref|XP_004074467.1|  PREDICTED: eukaryotic translation initiation...    175   4e-49    
gb|ACO15193.1|  Eukaryotic translation initiation factor 3 subunit I    174   4e-49    
ref|XP_007399384.1|  hypothetical protein PHACADRAFT_261788             175   4e-49    
ref|XP_007492943.1|  PREDICTED: eukaryotic translation initiation...    174   4e-49    
ref|XP_003937672.1|  PREDICTED: eukaryotic translation initiation...    173   4e-49    
gb|KHJ35878.1|  putative eukaryotic translation initiation factor 3     175   4e-49    
gb|ACO14914.1|  Eukaryotic translation initiation factor 3 subunit I    174   4e-49    
ref|XP_001656392.1|  AAEL013144-PA                                      174   5e-49    
ref|XP_005102453.1|  PREDICTED: eukaryotic translation initiation...    174   6e-49    
emb|CDO77164.1|  hypothetical protein BN946_scf184657.g40               173   7e-49    
gb|KIW02168.1|  eukaryotic translation initiation factor 3 subunit I    175   7e-49    
ref|XP_005812506.1|  PREDICTED: eukaryotic translation initiation...    174   7e-49    
ref|XP_008419625.1|  PREDICTED: eukaryotic translation initiation...    174   7e-49    
gb|KFO08490.1|  Eukaryotic translation initiation factor 3 subunit I    174   7e-49    
ref|XP_008918903.1|  PREDICTED: eukaryotic translation initiation...    177   7e-49    
ref|XP_005302240.1|  PREDICTED: eukaryotic translation initiation...    174   8e-49    
ref|XP_001509369.3|  PREDICTED: eukaryotic translation initiation...    173   9e-49    
ref|XP_007350612.1|  WD40 repeat-like protein                           174   9e-49    
gb|KIJ36634.1|  hypothetical protein M422DRAFT_61136                    175   1e-48    
ref|XP_010352245.1|  PREDICTED: eukaryotic translation initiation...    172   1e-48    
gb|AFR92732.1|  translation initiation factor 3 subunit I               174   1e-48    
gb|KJE03072.1|  eukaryotic translation initiation factor 3 subunit I    174   1e-48    
ref|XP_003191596.1|  hypothetical protein CGB_A6310C                    174   1e-48    
gb|KIR53699.1|  eukaryotic translation initiation factor 3 subunit I    174   1e-48    
ref|XP_009230695.1|  PREDICTED: eukaryotic translation initiation...    172   1e-48    
gb|KIR86604.1|  eukaryotic translation initiation factor 3 subunit I    174   1e-48    
ref|XP_003765492.1|  PREDICTED: eukaryotic translation initiation...    175   1e-48    
gb|ACH44280.1|  putative eukaryotic translation initiation factor...    173   1e-48    
gb|KDQ15156.1|  hypothetical protein BOTBODRAFT_55005                   174   1e-48    
gb|KIR48380.1|  eukaryotic translation initiation factor 3 subunit I    174   2e-48    
ref|NP_001015781.1|  eukaryotic translation initiation factor 3 s...    173   2e-48    
ref|XP_008330273.1|  PREDICTED: eukaryotic translation initiation...    174   2e-48    
gb|KIR69157.1|  eukaryotic translation initiation factor 3 subunit I    173   2e-48    
ref|XP_567255.1|  hypothetical protein                                  173   2e-48    
ref|XP_008330275.1|  PREDICTED: eukaryotic translation initiation...    173   2e-48    
ref|XP_777869.1|  hypothetical protein CNBA5660                         174   2e-48    
gb|EPQ15220.1|  Eukaryotic translation initiation factor 3 subunit I    173   2e-48    
ref|XP_008330274.1|  PREDICTED: eukaryotic translation initiation...    173   2e-48    
ref|XP_002556539.1|  KLTH0H15752p                                       173   2e-48    
ref|XP_011356138.1|  PREDICTED: eukaryotic translation initiation...    172   2e-48    
ref|XP_007270677.1|  WD40 repeat-like protein                           175   2e-48    
ref|XP_007249463.1|  PREDICTED: eukaryotic translation initiation...    172   2e-48    
gb|ACO09379.1|  Eukaryotic translation initiation factor 3 subunit 2    172   2e-48    
ref|XP_003276408.2|  PREDICTED: eukaryotic translation initiation...    172   3e-48    
ref|XP_003801293.1|  PREDICTED: eukaryotic translation initiation...    172   3e-48    
ref|XP_001868509.1|  eukaryotic translation initiation factor 3 s...    172   3e-48    
ref|NP_001087664.1|  eukaryotic translation initiation factor 3 s...    172   3e-48    
gb|EDL80550.1|  rCG30571, isoform CRA_b                                 171   3e-48    
ref|XP_007432017.1|  PREDICTED: eukaryotic translation initiation...    172   3e-48    
ref|XP_004603791.1|  PREDICTED: eukaryotic translation initiation...    172   3e-48    
ref|XP_001557202.1|  eukaryotic translation initiation factor 3         172   4e-48    
ref|XP_001639587.1|  predicted protein                                  172   4e-48    
ref|XP_002802333.1|  PREDICTED: eukaryotic translation initiation...    172   4e-48    
ref|XP_007197322.1|  PREDICTED: eukaryotic translation initiation...    170   4e-48    
dbj|BAD96203.1|  eukaryotic translation initiation factor 3, subu...    172   4e-48    
ref|XP_005718524.1|  Translation initiation factor eIF3, subunit I      172   4e-48    
ref|NP_003748.1|  eukaryotic translation initiation factor 3 subu...    172   4e-48    
ref|XP_004591787.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
gb|AAX36269.1|  eukaryotic translation initiation factor 3 subuni...    172   5e-48    
ref|XP_006094311.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
gb|AAV38402.1|  eukaryotic translation initiation factor 3, subun...    172   5e-48    
ref|XP_008155232.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
gb|EKC38588.1|  Eukaryotic translation initiation factor 3 subunit I    172   5e-48    
ref|XP_002122597.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
ref|XP_011445956.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
ref|XP_008064944.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
ref|XP_004679476.1|  PREDICTED: eukaryotic translation initiation...    172   6e-48    
gb|KFW78228.1|  Eukaryotic translation initiation factor 3 subunit I    171   6e-48    
ref|XP_005878403.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    172   6e-48    
ref|XP_010593652.1|  PREDICTED: eukaryotic translation initiation...    172   7e-48    
gb|KGG49952.1|  subunit I of eukaryotic translation initiation fa...    172   7e-48    
gb|EDL30181.1|  eukaryotic translation initiation factor 3, subun...    171   8e-48    
ref|XP_007170666.1|  PREDICTED: eukaryotic translation initiation...    171   8e-48    
gb|ADO28015.1|  eukaryotic translation initiation factor 3 subunit i    171   8e-48    
emb|CBY20744.1|  unnamed protein product                                171   8e-48    
gb|ELR48735.1|  Eukaryotic translation initiation factor 3 subunit I    171   8e-48    
ref|XP_004406473.1|  PREDICTED: eukaryotic translation initiation...    171   8e-48    
emb|CDS04160.1|  hypothetical protein LRAMOSA07115                      171   8e-48    
ref|NP_001187527.1|  eukaryotic translation initiation factor 3 s...    171   8e-48    
gb|EFB27372.1|  hypothetical protein PANDA_010855                       171   8e-48    
ref|NP_061269.1|  eukaryotic translation initiation factor 3 subu...    171   8e-48    
ref|XP_002840508.1|  hypothetical protein                               171   8e-48    
ref|NP_001015628.1|  eukaryotic translation initiation factor 3 s...    171   8e-48    
ref|XP_005317802.1|  PREDICTED: eukaryotic translation initiation...    171   9e-48    
ref|NP_001231553.1|  eukaryotic translation initiation factor 3, ...    171   9e-48    
ref|XP_006117620.1|  PREDICTED: eukaryotic translation initiation...    171   1e-47    
ref|XP_010619869.1|  PREDICTED: eukaryotic translation initiation...    171   1e-47    
ref|XP_006895022.1|  PREDICTED: eukaryotic translation initiation...    171   1e-47    
ref|XP_007125162.1|  PREDICTED: eukaryotic translation initiation...    171   1e-47    
ref|XP_007948641.1|  PREDICTED: eukaryotic translation initiation...    171   1e-47    
ref|NP_001108507.1|  eukaryotic translation initiation factor 3 s...    171   2e-47    
ref|XP_008210954.1|  PREDICTED: eukaryotic translation initiation...    170   2e-47    
ref|XP_001595804.1|  eukaryotic translation initiation factor 3         171   2e-47    
ref|XP_001603140.1|  PREDICTED: eukaryotic translation initiation...    170   2e-47    
ref|XP_004372060.1|  PREDICTED: eukaryotic translation initiation...    172   2e-47    
ref|XP_006862226.1|  PREDICTED: eukaryotic translation initiation...    170   2e-47    
ref|XP_002921914.2|  PREDICTED: eukaryotic translation initiation...    171   2e-47    
ref|XP_003500685.1|  PREDICTED: eukaryotic translation initiation...    170   2e-47    
ref|XP_005395112.1|  PREDICTED: eukaryotic translation initiation...    171   2e-47    
ref|XP_004705070.1|  PREDICTED: eukaryotic translation initiation...    170   2e-47    
ref|XP_006963216.1|  predicted protein                                  170   2e-47    
dbj|GAA27675.2|  translation initiation factor 3 subunit I              166   2e-47    
emb|CDK24887.1|  unnamed protein product                                171   2e-47    
ref|XP_004266574.1|  PREDICTED: eukaryotic translation initiation...    170   3e-47    
gb|EHK41282.1|  hypothetical protein TRIATDRAFT_301894                  170   3e-47    
ref|XP_007873769.1|  hypothetical protein PNEG_01801                    170   3e-47    
gb|EHB12852.1|  Eukaryotic translation initiation factor 3 subunit I    171   3e-47    
gb|EMD39788.1|  hypothetical protein CERSUDRAFT_112055                  170   3e-47    
emb|CDH49815.1|  eukaryotic translation initiation factor 3subunit      170   3e-47    
ref|XP_006054762.1|  PREDICTED: eukaryotic translation initiation...    171   3e-47    
gb|ACO10455.1|  Eukaryotic translation initiation factor 3 subunit I    169   4e-47    
ref|XP_001208970.1|  eukaryotic translation initiation factor 3 s...    170   4e-47    
gb|ERE85417.1|  eukaryotic translation initiation factor 3 subuni...    171   4e-47    
gb|AAX41399.1|  eukaryotic translation initiation factor 3 subuni...    169   4e-47    
gb|KDQ25934.1|  hypothetical protein PLEOSDRAFT_1066937                 170   4e-47    
gb|ERZ95383.1|  hypothetical protein GLOINDRAFT_341253                  169   4e-47    
ref|XP_005139430.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    170   4e-47    
ref|XP_007380240.1|  WD40 repeat-like protein                           169   5e-47    
gb|EHH14557.1|  hypothetical protein EGK_00504                          169   5e-47    
gb|KIW69713.1|  eukaryotic translation initiation factor 3 subunit I    169   5e-47    
ref|XP_007304716.1|  WD40 repeat-like protein                           169   5e-47    
gb|EMP28420.1|  Alpha-taxilin                                           178   5e-47    
ref|XP_008079360.1|  WD40 repeat-like protein                           169   5e-47    
gb|EJT48020.1|  hypothetical protein A1Q1_02936                         169   5e-47    
emb|CEP61303.1|  LALA0S02e11386g1_1                                     170   6e-47    
gb|KIM93051.1|  hypothetical protein OIDMADRAFT_107011                  169   6e-47    
gb|KIX06858.1|  eukaryotic translation initiation factor 3 subunit I    169   7e-47    
gb|KIJ17571.1|  hypothetical protein PAXINDRAFT_167576                  169   7e-47    
ref|XP_007092475.1|  PREDICTED: eukaryotic translation initiation...    169   7e-47    
gb|KIM30962.1|  hypothetical protein M408DRAFT_327876                   169   8e-47    
gb|ELK02020.1|  Eukaryotic translation initiation factor 3 subunit I    173   8e-47    
ref|XP_004900249.1|  PREDICTED: eukaryotic translation initiation...    171   9e-47    
gb|AAI27353.1|  eif3s2 protein                                          168   1e-46    
ref|XP_660601.1|  hypothetical protein AN2997.2                         168   1e-46    
ref|XP_008723623.1|  eukaryotic translation initiation factor 3 s...    168   1e-46    
sp|A2QEV8.1|EIF3I_ASPNC  RecName: Full=Eukaryotic translation ini...    168   1e-46    
gb|EHA23450.1|  hypothetical protein ASPNIDRAFT_207376                  168   1e-46    
dbj|BAE42882.1|  unnamed protein product                                168   1e-46    
dbj|GAM85611.1|  hypothetical protein ANO11243_036180                   168   1e-46    
ref|XP_001818333.1|  eukaryotic translation initiation factor 3 s...    168   2e-46    
emb|CEJ88530.1|  Putative Eukaryotic translation initiation facto...    168   2e-46    
ref|XP_004341724.1|  eTGF-beta receptor-interacting protein, puta...    168   2e-46    
ref|XP_003686526.1|  hypothetical protein TPHA_0G02570                  168   2e-46    
gb|KIK83562.1|  hypothetical protein PAXRUDRAFT_832048                  168   2e-46    
ref|XP_003686473.1|  hypothetical protein TPHA_0G02030                  168   2e-46    
gb|KFM68458.1|  Eukaryotic translation initiation factor 3 subunit I    167   2e-46    
ref|NP_001126286.1|  eukaryotic translation initiation factor 3 s...    167   2e-46    
ref|XP_006777450.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    168   2e-46    
ref|XP_004485231.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    169   2e-46    
ref|XP_007797965.1|  putative eukaryotic translation initiation f...    168   2e-46    
ref|XP_007755968.1|  eukaryotic translation initiation factor 3 s...    168   2e-46    
ref|XP_004665214.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    168   2e-46    
ref|XP_001503867.4|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    168   3e-46    
ref|XP_003051107.1|  predicted protein                                  167   3e-46    
gb|EIE88790.1|  hypothetical protein RO3G_13501                         168   3e-46    
gb|EME46937.1|  hypothetical protein DOTSEDRAFT_70767                   167   3e-46    
ref|XP_001263576.1|  eukaryotic translation initiation factor 3 s...    167   3e-46    
ref|XP_754751.1|  eukaryotic translation initiation factor 3 subu...    167   3e-46    
ref|XP_003647153.1|  hypothetical protein Ecym_5599                     168   3e-46    
gb|KIY51537.1|  WD40 repeat-like protein                                168   3e-46    
dbj|GAA84383.1|  eukaryotic translation initiation factor 3 subun...    167   3e-46    
ref|XP_009013860.1|  hypothetical protein HELRODRAFT_185422             167   4e-46    
ref|XP_009047818.1|  hypothetical protein LOTGIDRAFT_200332             167   4e-46    
ref|XP_006994436.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   4e-46    
gb|EIF45267.1|  eukaryotic translation initiation factor 3 subunit      168   4e-46    
emb|CDO95669.1|  unnamed protein product                                167   4e-46    
gb|EIE82800.1|  hypothetical protein RO3G_07505                         167   4e-46    
gb|KIW74742.1|  eukaryotic translation initiation factor 3 subunit I    167   4e-46    
emb|CEP16495.1|  hypothetical protein                                   167   4e-46    
dbj|BAO38834.1|  eukaryotic translation initiation factor 3 subun...    167   5e-46    
ref|XP_007468733.1|  PREDICTED: eukaryotic translation initiation...    170   5e-46    
ref|XP_535328.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic tran...    167   5e-46    
gb|KDQ62747.1|  hypothetical protein JAAARDRAFT_30657                   167   5e-46    
gb|EHK16486.1|  hypothetical protein TRIVIDRAFT_82783                   167   6e-46    
ref|XP_009254997.1|  hypothetical protein FPSE_03603                    167   6e-46    
ref|XP_006901315.1|  PREDICTED: eukaryotic translation initiation...    166   6e-46    
ref|XP_009546467.1|  hypothetical protein HETIRDRAFT_147751             166   7e-46    
gb|KIJ64562.1|  hypothetical protein HYDPIDRAFT_175511                  166   7e-46    
gb|EPX75306.1|  translation initiation factor eIF3i                     166   7e-46    
gb|EPT05074.1|  hypothetical protein FOMPIDRAFT_111378                  167   7e-46    
gb|KII90659.1|  hypothetical protein PLICRDRAFT_157916                  166   7e-46    
ref|XP_009167677.1|  hypothetical protein T265_04631                    164   8e-46    
gb|ESZ97118.1|  eukaryotic translation initiation factor 3 subunit 2    166   8e-46    
ref|XP_007584752.1|  putative eukaryotic translation initiation f...    166   8e-46    
ref|XP_007925842.1|  hypothetical protein MYCFIDRAFT_51295              166   8e-46    
emb|CCG84178.1|  protein of unknown function                            166   8e-46    
emb|CCX32511.1|  Similar to Eukaryotic translation initiation fac...    166   8e-46    
gb|EKG12028.1|  hypothetical protein MPH_10851                          166   9e-46    
emb|CDS27796.1|  eukaryotic translation initiation factor 3             166   9e-46    
gb|EPY53170.1|  translation initiation factor eIF3i                     166   1e-45    
emb|CCA68444.1|  probable TIF34-translation initiation factor eIF...    166   1e-45    
ref|XP_004850898.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   1e-45    
gb|EWG40623.1|  eukaryotic translation initiation factor 3 subunit I    166   1e-45    
gb|KIO05317.1|  hypothetical protein M404DRAFT_15355                    166   1e-45    
ref|XP_007007848.1|  hypothetical protein TREMEDRAFT_72409              167   1e-45    
ref|XP_455416.1|  hypothetical protein                                  166   1e-45    
ref|XP_002488027.1|  eukaryotic translation initiation factor 3 s...    166   1e-45    
gb|KEF62513.1|  eukaryotic translation initiation factor 3 subunit I    166   1e-45    
ref|XP_001270884.1|  eukaryotic translation initiation factor 3 s...    166   1e-45    
gb|KFX89447.1|  hypothetical protein V490_07014                         166   2e-45    
gb|KIP10178.1|  hypothetical protein PHLGIDRAFT_101502                  166   2e-45    
ref|XP_007814077.1|  eukaryotic translation initiation factor 3 s...    166   2e-45    
gb|KDB12673.1|  eukaryotic translation initiation factor 3 subunit 2    165   2e-45    
dbj|GAD97183.1|  conserved hypothetical protein                         167   2e-45    
gb|EPZ33787.1|  hypothetical protein O9G_004435                         165   2e-45    
gb|EYE99281.1|  eukaryotic translation initiation factor 3 subunit I    165   2e-45    
gb|ELR06011.1|  eukaryotic translation initiation factor 3 subunit I    165   3e-45    
gb|AAY32924.1|  TGF-beta receptor interacting protein 1                 165   3e-45    
ref|XP_007866595.1|  hypothetical protein GLOTRDRAFT_9627               165   3e-45    
gb|KIW28535.1|  eukaryotic translation initiation factor 3 subunit I    165   3e-45    
ref|XP_003034029.1|  hypothetical protein SCHCODRAFT_66951              165   3e-45    
gb|AGO12732.1|  AaceriADR264Cp                                          165   3e-45    



>gb|KHN14569.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   316 bits (809),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LW
Sbjct  44   RTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLW  103

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  104  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  163

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  164  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  211



>ref|XP_008443373.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis melo]
Length=326

 Score =   318 bits (814),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIISGGED+V+RIWD+ETGKLLKESD+E+GHKK ITSL K+ DGSHFITGSLDKSAKLW
Sbjct  159  KTIISGGEDAVVRIWDSETGKLLKESDKETGHKKTITSLTKASDGSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWYADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L ++  + P  AV  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGQQLFSFNFDSPARAVDFS-------VG---DKLAVITTDPFVELPSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  K+  SGGED  VR+
Sbjct  132  SEQTGESVLLLKGPQGRINRAVWGPLNKTIISGGEDAVVRI  172



>ref|XP_007222666.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
 gb|EMJ23865.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
Length=326

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D+E GHKK ITSLAKS+DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKTITSLAKSVDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQ
Sbjct  219  DIRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+  + P  AV +S       +G   D  AV TTD       A    +I  + 
Sbjct  82   QTGQQLFTFNFDSPARAVDLS-------VG---DRLAVITTDPFMELSSAIHVKRIANDP  131

Query  323  IGGV-------KGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               V       KG  G IN   + P  ++  S GED  +R+
Sbjct  132  ADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_008220972.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Prunus mume]
Length=326

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D+E GHKK ITSLAKS+DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKTITSLAKSVDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQ
Sbjct  219  DIRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+  + P  AV  S       +G   D  AV TTD       A    +I  + 
Sbjct  82   QTGQQLFTFNFDSPARAVDFS-------VG---DRLAVITTDPFMELSSAIHVKRIANDP  131

Query  323  IGGV-------KGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               V       KG  G IN   + P  ++  S GED  +R+
Sbjct  132  ADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>gb|KDP38201.1| hypothetical protein JCGZ_04844 [Jatropha curcas]
Length=326

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKESD+E GHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKESDKEVGHKKTITSLTKSSDGSHFVTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L ++  + P  AV  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGTQLYSFNFDSPARAVDFS-------VG---DKLAVITTDPFMELPSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  ADQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_003517705.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   316 bits (809),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSGRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+  + P  +V  +       +G   D  AV TTD       A    +I    
Sbjct  82   QTGQQLFTFNFDSPARSVDFA-------VG---DKLAVITTDPFMELPSAIHVKRIANDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  AEQTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRI  172



>ref|XP_002521889.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF40525.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=326

 Score =   315 bits (807),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTI+S GED+V+RIWD+ETGKLLKESD+E GHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTILSAGEDAVIRIWDSETGKLLKESDREIGHKKTITSLTKSSDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE+GGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEVGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L ++  + P  AV +S       +G   D  AV TTD       A    +I +  
Sbjct  82   KTGTQLYSFNFDSPARAVDLS-------VG---DKLAVITTDPFMELPSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  DNQTGESVLVLKGPQGRINRAVWGPLNKTILSAGEDAVIRI  172



>ref|XP_004136687.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 ref|XP_004159618.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 gb|KGN59537.1| hypothetical protein Csa_3G824820 [Cucumis sativus]
Length=326

 Score =   315 bits (807),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETGKLLKESD+E GHKK +TSL KS DGSHFITGSLDKSAKLW
Sbjct  159  KTIISAGEDAVVRIWDSETGKLLKESDKEIGHKKTVTSLTKSSDGSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWYADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L ++  + P  AV  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGQQLFSFNFDSPARAVDFS-------VG---DKLAVITTDPFMELPSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  K+  S GED  VR+
Sbjct  132  SEQTGESVLLLKGPQGRINRAVWGPLNKTIISAGEDAVVRI  172



>ref|XP_006351166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum tuberosum]
Length=326

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWDAETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLW
Sbjct  159  KTIISAGEDAVIRIWDAETGKILKESDKEIGHKKGITSLQKSVDGSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDQDYFNIKI  326


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++A LWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAMLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T T L T+  + P  +V  S       +G   D  AV TTD   G   A    +I    
Sbjct  82   QTGTQLHTFTFDSPARSVDFS-------VG---DKLAVITTDPFMGLTSAIHVKRISEDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               + E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  SEQISESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRI  172



>gb|KDO58633.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=268

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+++RIWD ETGKLLKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLW
Sbjct  101  RTIISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLW  160

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  161  DARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  220

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  221  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  268



>ref|XP_007157442.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
 gb|AAK49947.1|AF335551_1 TGF-beta receptor-interacting protein 1 [Phaseolus vulgaris]
 gb|ESW29436.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
Length=326

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKL+KESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLIKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSGRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+  + P  +V  S       +G   D  AV TTD       A    +I    
Sbjct  82   QTGQQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELPSAIHVKRIANDP  131

Query  329  -EEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             E+ G     +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  TEQTGDSVVLIKGPQGRINRAIWGPLNRTIISAGEDAVIRI  172



>ref|XP_010062244.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Eucalyptus grandis]
 gb|KCW69347.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=326

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETGKLL+ESD+E+GHKK +TSL KS+DGSHF+TGS DKSAKLW
Sbjct  159  KTIISAGEDAVIRIWDSETGKLLRESDKETGHKKAVTSLMKSVDGSHFVTGSQDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVT TDHRAGKFEAKF+DKILQ
Sbjct  219  DIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTMTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D +AKLW +
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADTTAKLWSV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +  T L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QNGTQLFTFNFDSPARSVDFS-------IG---DKLAVITTDPFMELPSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  ++GH G I    + P  K+  S GED  +R+
Sbjct  132  ADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRI  172



>ref|XP_007016708.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016709.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34327.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34328.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=326

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  686  TIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWD  507
            TIIS GED+V+RIWD+ETGKLL+E+D+ESGHKK ITSLAKS DGSHF+TGSLDKSAKLWD
Sbjct  160  TIISAGEDAVIRIWDSETGKLLREADKESGHKKPITSLAKSADGSHFLTGSLDKSAKLWD  219

Query  506  IRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  327
            +RTLTL+KTYVTERPVNAV +SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQE
Sbjct  220  VRTLTLIKTYVTERPVNAVALSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  279

Query  326  EIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  280  EIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWSCDVSRDSTRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L T+  + P  +V  +       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGTQLFTFNFDSPARSVDFA-------IG---DKLAVITTDPFMELTSAIHVKRITRDA  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P   +  S GED  +R+
Sbjct  132  TEQTGESVLVIKGPQGRINRAIWGPLNSTIISAGEDAVIRI  172



>ref|XP_004250371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum lycopersicum]
Length=326

 Score =   314 bits (804),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWDAETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLW
Sbjct  159  KTIISAGEDAVIRIWDAETGKVLKESDKEIGHKKGITSLQKSVDGSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIR+LTL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DIRSLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD DYF+I+I
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDQDYFNIRI  326


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++A LWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAMLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T   L T+  + P  +V  S       +G   D  AV TTD   G   A     I    
Sbjct  82   QTGAQLHTFTFDSPARSVDFS-------VG---DKLAVITTDPFMGLTSAIHIKNISKDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               + E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  SEQMSESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRI  172



>gb|ABK94219.1| unknown [Populus trichocarpa]
Length=326

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GEDSV+RIWD+ETGKLLKESD E GHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDSVVRIWDSETGKLLKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDK+LQ
Sbjct  219  DTRTLTLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_009777665.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nicotiana sylvestris]
Length=331

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD ETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLW
Sbjct  164  RTIISAGEDAVIRIWDVETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLW  223

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  224  DIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  283

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            +EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  284  QEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDHDYFNIKI  331


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 75/166 (45%), Gaps = 25/166 (15%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D+SAKLWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSARLITGSADQSAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG--------KFEAKF  348
            +T T L T+  + P  +V  S       +G   D  AV TTD   G        +     
Sbjct  82   QTGTQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMGLPSAIHVKRISKDP  131

Query  347  YDKILQEEIG----GVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             D+IL  E+G     +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  SDRILCTEVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRI  177



>gb|KHN32457.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   309 bits (791),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  686  TIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWD  507
            TIIS GED+V+RIWD+ETGKLL+ESD+ESGHKK +TSLAKS D SHF+TGSLDKSA+LWD
Sbjct  45   TIISAGEDAVIRIWDSETGKLLQESDKESGHKKTVTSLAKSADDSHFLTGSLDKSARLWD  104

Query  506  IRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  327
             R+LTL+KTYVTERPVNAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQE
Sbjct  105  TRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQE  164

Query  326  EIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  165  EIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  211



>ref|XP_009629813.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Nicotiana tomentosiformis]
Length=326

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD ETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDVETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            +EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  QEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDHDYFNIKI  326


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D+SAKLWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQSAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T T L T+  + P  +V  S       +G   D  AV TTD   G   A    +I    
Sbjct  82   QTGTQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMGLPSAIHVKRISRDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               + E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  SDQIGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_009777666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nicotiana sylvestris]
Length=326

 Score =   313 bits (802),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD ETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDVETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            +EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  QEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDHDYFNIKI  326


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D+SAKLWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSARLITGSADQSAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T T L T+  + P  +V  S       +G   D  AV TTD   G   A    +I    
Sbjct  82   QTGTQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMGLPSAIHVKRISKDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               + E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  SDQVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>gb|KJB56103.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=264

 Score =   311 bits (796),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  97   RTIVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLW  156

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  157  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  216

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  217  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  264



>gb|KJB56101.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=272

 Score =   310 bits (795),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  105  RTIVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLW  164

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  165  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  224

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  225  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  272


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 66/154 (43%), Gaps = 15/154 (10%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D    ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDVSRDSMRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+    P  AV   P L+  ++  G+DA  +   D   GK         L  E
Sbjct  82   QTGAQLYTFNFGSPARAV-WGP-LNRTIVSAGEDA-VIRIWDSETGK---------LLRE  129

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 GH   I +L  + DG  F +G  D   +L
Sbjct  130  ADKESGHKKTITSLTKSADGSHFLTGSLDKSAKL  163



>ref|XP_003534423.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  686  TIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWD  507
            TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LWD
Sbjct  160  TIISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLWD  219

Query  506  IRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  327
             R+LTL+KTYVTERPVNAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQE
Sbjct  220  TRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQE  279

Query  326  EIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  280  EIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + +   S D    ITGS D++AKLWD+
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWTCDVSRDSVRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            ++   L T+  + P  +V  S       +G   D  AV TTD       A    +I    
Sbjct  82   QSGLQLYTFNFDSPARSVDFS-------VG---DRLAVITTDPFMELSSAIHVKRIADDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P   +  S GED  +R+
Sbjct  132  TEQSGESLLLIKGPLGRINRAIWGPLNSTIISAGEDAVIRI  172



>gb|AES67165.2| eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=326

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETGKLLKESD+E GHKK ITSLAKS DGSHF TGSLDKSAK+W
Sbjct  159  KTIISAGEDAVIRIWDSETGKLLKESDKELGHKKTITSLAKSADGSHFCTGSLDKSAKIW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL+L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DSRTLSLVKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSGRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGQQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELSSAIHVKRIAKDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  SDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRI  172



>ref|XP_003596914.1| Eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=321

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETGKLLKESD+E GHKK ITSLAKS DGSHF TGSLDKSAK+W
Sbjct  154  KTIISAGEDAVIRIWDSETGKLLKESDKELGHKKTITSLAKSADGSHFCTGSLDKSAKIW  213

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL+L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  214  DSRTLSLVKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  273

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  274  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  321


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  20   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSGRLITGSADQTAKLWNV  76

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  77   QTGQQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELSSAIHVKRIAKDP  126

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  127  SDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRI  167



>gb|KJB56100.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=326

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D    ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDVSRDSMRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+    P  +V  S       +G   D  AV TTD       A    +I ++ 
Sbjct  82   QTGAQLYTFNFGSPARSVDFS-------VG---DKLAVITTDPFMELTSAIHVKRIARDP  131

Query  323  IGG-------VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  TEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRI  172



>ref|XP_002285281.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Vitis vinifera]
 emb|CAN80198.1| hypothetical protein VITISV_030908 [Vitis vinifera]
 emb|CBI26753.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   311 bits (798),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+++RIWD+ETGKLLKESD+E+GHKK +TSL+K++DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAIVRIWDSETGKLLKESDKETGHKKTVTSLSKAVDGSHFVTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY+TERPVNAVTMSPLLDH+VLGGGQDAS VTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DSRTLTLIKTYLTERPVNAVTMSPLLDHVVLGGGQDASHVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF++KI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNVKI  326


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + +   S D    ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDVSRDSMRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
             T   L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   ETGAQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELTSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E    +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  SQQTAESALVIKGPQGRINRAIWGPLNRTIISAGEDAIVRI  172



>ref|XP_004492932.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   311 bits (798),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GEDSV+RIWD+ETGKLLKESD+ESGHKK +TSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDSVVRIWDSETGKLLKESDKESGHKKTVTSLVKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL+L+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DARTLSLVKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++ KLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSGRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            ++   L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QSGQQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELTSAIHVKRIAKDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  ADQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRI  172



>ref|XP_011095354.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Sesamum indicum]
Length=326

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GEDSV+RIWD+ETGKLLKESD+E GHKK ITSL+KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDSVIRIWDSETGKLLKESDKEDGHKKPITSLSKSTDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTL L+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DIRTLKLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 74/161 (46%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWSCDISRDSTRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L T+  + P  +V  +       +G   D  AV TTD   G   A    +I +  
Sbjct  82   KTGTPLYTFNFDSPARSVDFA-------VG---DRLAVITTDPFMGLPSAIHIKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  EDQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDSVIRI  172



>ref|XP_006448047.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 ref|XP_006492275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
 gb|ESR61287.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|KDO58630.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=326

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+++RIWD ETGKLLKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSMTLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
             T   L T+  + P  +V  +       +G   D  AV TTD       A    +I +  
Sbjct  82   ETGAQLFTFNFDSPARSVDFA-------VG---DKLAVITTDPFMELNSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  ADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRI  172



>ref|XP_008389128.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D E GHKK ITSLAKS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAKSXDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASTVTTTDHRSGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYFHIKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFHIKI  326


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            +T   L T+  + P  AV  S       +G   D  AV TTD       A    +I    
Sbjct  82   QTGQQLFTFNFDSPARAVDFS-------VG---DKLAVITTDPFMDVTSAIHVKRIAGDP  131

Query  332  QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            +++IG     +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  EDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_010557463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKESD+E+GHKK ITSL K+ D SHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVVRIWDSETGKLLKESDKEAGHKKTITSLCKAADSSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+L 
Sbjct  219  DTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKLLL  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYFHIK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDQDYFHIKV  326


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++ KLWD+
Sbjct  25   LFSCAKDHTPTVWYADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTVKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T   L T+    P  +V  +       +G   D  AV TTD       A    +I    
Sbjct  82   QTGKPLYTFNFGSPARSVDFA-------VG---DKLAVITTDPFMDLSSAIHVKRIARDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               + E +  +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  EDQVAESVLVLKGVQGRINRAVWGPLNRTIISAGEDAVVRI  172



>ref|XP_011021700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GEDSV+RIWD+ETGKLLKESD E GHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDSVIRIWDSETGKLLKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D R LTL+KTY TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDK+LQ
Sbjct  219  DTRNLTLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGESFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 65/161 (40%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    IT S D+S KLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSMLLITASADQSVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+    P  +V  S       +G   D  AV TTD   G   A     I    
Sbjct  82   QTGAQLYTFSFNSPARSVDFS-------VG---DKFAVITTDPFMGVTSAINVKNIADDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  + G  G IN   + P  K+  S GED  +R+
Sbjct  132  SQQSGESMLTITGPTGRINRAVWGPLNKTIISAGEDSVIRI  172



>gb|KJB26172.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=326

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK ITSL K+ DGSHF++GSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYSTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + +   S D    ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDVSRDSMRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +  T L T+    P  +V  +       +G   D  AV TTD       A    +I    
Sbjct  82   QKGTQLYTFNFGSPARSVEFA-------IG---DKLAVITTDPFMELTSAIHVKRIAGDS  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                +E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  TEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_008340535.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D E GHKK ITSLAKS+DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAKSVDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASMVTTTDHRSGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            +T   L T+  + P  AV  S       +G   D  AV TTD       A    +I    
Sbjct  82   QTGQQLFTFNFDSPARAVDFS-------VG---DKLAVITTDPFMDVTSAIHVKRIASDP  131

Query  332  QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            ++++G     +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  EDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>gb|KHG16392.1| Eukaryotic translation initiation factor 3 subunit I -like protein 
[Gossypium arboreum]
Length=326

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK ITSL K+ DGSHF++GSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYSTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + +   S D +  ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDVSRDSTRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +  T L T+    P  +V  +       +G   D  AV TTD       A    +I    
Sbjct  82   QKGTQLYTFNFGSPARSVEFA-------IG---DKLAVITTDPFMELTSAIHVKRIAGDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                +E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  TEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_009351622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pyrus x bretschneideri]
Length=326

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D E GHKK ITSLAKS+DG+HF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAKSVDGTHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASMVTTTDHRSGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            +T   L T+  + P  AV  S       +G   D  AV TTD       A    +I    
Sbjct  82   QTGQQLFTFNFDSPARAVDFS-------VG---DKLAVITTDPFMDVTSAIHVKRIASDP  131

Query  332  QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            ++++G     +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  EDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>gb|EYU22708.1| hypothetical protein MIMGU_mgv1a009949mg [Erythranthe guttata]
Length=326

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GEDSV+RIWD+ETGKLLKESD+E GHKK ITSL+K+ DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDSVIRIWDSETGKLLKESDKEDGHKKPITSLSKATDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DSRTLTLMKTYVTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDQDYFNIKI  326


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D +  ITGS D++AK+WD+
Sbjct  25   LFSCAKDHNPTLWFADNGERLG---TYRGHNGAVWSCDISRDSTTLITGSADQTAKIWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
            +T T L T+  + P  +V  +       +G   D   V TTD   G       K  A   
Sbjct  82   KTGTPLFTFNFDSPARSVDFA-------VG---DKLVVITTDPFMGLSSAIHIKHVAADP  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            D    E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  DDQTGESVLVLKGPQGRINRAVWGPLNKTIISAGEDSVIRI  172



>ref|XP_006591952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
 gb|ACU23631.1| unknown [Glycine max]
Length=326

 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  686  TIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWD  507
            TIIS GED+V+RIWD+ETGKLL+ESD+ESGHKK +TSLAKS D SHF+TGSLDKSA+LWD
Sbjct  160  TIISAGEDAVIRIWDSETGKLLQESDKESGHKKTVTSLAKSADDSHFLTGSLDKSARLWD  219

Query  506  IRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  327
             R+LTL+KTYVTERPVNAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQE
Sbjct  220  TRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQE  279

Query  326  EIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  280  EIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + +   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWTCDVSRDSARLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            ++   L T+  + P  +V  S       +G   D  AV TTD       A    +I    
Sbjct  82   QSGLQLYTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELPSAIHVKRIANDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
               + E +  +KG  G IN   + P   +  S GED  +R+
Sbjct  132  SQQIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVIRI  172



>ref|XP_002311556.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEE88923.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=326

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED V+RIWD+ETGKLLKES+ E GHKK I+SL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDCVVRIWDSETGKLLKESEPEVGHKKPISSLTKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+K Y TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DSRTLTLIKNYTTERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 66/161 (41%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    IT S D+S KLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSMQLITASADQSVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+    P  +V  S       +G   D  AV TTD   G   A    +I    
Sbjct  82   QTGAQLYTFSFNSPARSVDFS-------VG---DKLAVITTDPFMGVTSAINVKRIADDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  + G  G IN   + P  ++  S GED  VR+
Sbjct  132  SQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRI  172



>ref|XP_004489218.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GEDSV+RIWD+ETGKLLKESD+ESGHKK ITSLAKS DGSHF+TGSLDKS+KLW
Sbjct  159  RTIISAGEDSVVRIWDSETGKLLKESDKESGHKKTITSLAKSADGSHFLTGSLDKSSKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL+L+KTYVTERPVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DARTLSLVKTYVTERPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR+HHFD +Y++IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRVHHFDQEYYNIKI  326


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLWD+
Sbjct  25   LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSGRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            ++   L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QSGQQLFTFNFDSPARSVDFS-------VG---DKLAVITTDPFMELTSAIHVKRIAKDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  KDQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRI  172



>ref|XP_009129412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brassica rapa]
Length=328

 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+VLRIWDAETGKLLKESD E GHK  ITSL KS D SHFITGSLDK+AKLW
Sbjct  161  QTIVSGGEDAVLRIWDAETGKLLKESDSEVGHKNTITSLTKSADDSHFITGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTYV+  PVNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIRI  328



>ref|XP_011024978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   305 bits (782),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED V+RIWD+ETGKLLKES+ E GHKK I+SL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDCVVRIWDSETGKLLKESEPEVGHKKPISSLTKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+K Y TERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKILQ
Sbjct  219  DSRTLTLIKNYTTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  326


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 65/161 (40%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    IT S D+S KLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMQLITASADQSVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L T+    P  +V  S       +G   D  AV TTD       A    +I    
Sbjct  82   QTGAQLYTFSFNSPARSVDFS-------VG---DKLAVITTDPFMEVTSAINVKRIADDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  + G  G IN   + P  ++  S GED  VR+
Sbjct  132  SQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRI  172



>ref|XP_010521568.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   305 bits (781),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWDAETGKLL ESD+E GHKK ITSL K+ D SHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDAETGKLLNESDKEVGHKKAITSLCKAADSSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DTRTLTLIKTYGTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILL  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDQDYFSIKI  326


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 67/156 (43%), Gaps = 10/156 (6%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWYADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTVKLWEV  81

Query  503  RTLTLLKTYVTERPVNAVTMS--PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            +T   L T+    P  +V  S    L  I      D S+     H A   E +  D +L 
Sbjct  82   QTGKQLYTFNFGSPARSVDFSVGDKLAVITTDPFMDLSSAIHVKHIARDPEDQVADSVLV  141

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 +KG  G IN   + P  ++  S GED  +R+
Sbjct  142  -----LKGVQGRINRAVWGPLNRTIISAGEDAVIRI  172



>gb|EYU22777.1| hypothetical protein MIMGU_mgv1a009964mg [Erythranthe guttata]
Length=326

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GEDS++R+WD+ETGKLLKESD+E GHKK ITSL+K+ D SHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDSIIRVWDSETGKLLKESDKEDGHKKPITSLSKATDVSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DSRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDQDYFNIKI  326


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D S  ITGS D++AK+WD+
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWSCDISRDSSTLITGSADQTAKIWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
            +T T L T+  + P  +V  +       +G   D   V TTD   G       K  A   
Sbjct  82   KTGTPLFTFNFDSPARSVDFA-------VG---DKLVVITTDPFMGLSSAIHIKPVAADP  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            D    E I  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  DDQTGESILVLKGPQGRINRAVWGPLNKTIISAGEDSIIRV  172



>ref|XP_008350825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=328

 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D E GHKK ITSLAKS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAKSXDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASTVTTTDHRSGKFEAKFYDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKS--FASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGK   F+SGGEDGYVRLHHFD+DYFHIKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKKVYFSSGGEDGYVRLHHFDSDYFHIKI  328


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSRDSARLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            +T   L T+  + P  AV  S       +G   D  AV TTD       A    +I    
Sbjct  82   QTGQQLFTFNFDSPARAVDFS-------VG---DKLAVITTDPFMDVTSAIHVKRIAGDP  131

Query  332  QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            +++IG     +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  EDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRI  172



>gb|EPS73291.1| hypothetical protein M569_01462 [Genlisea aurea]
Length=326

 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+R WDAETGKLL+E+D+E  HKK ITSL+KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIVSAGEDAVIRRWDAETGKLLQETDKEESHKKPITSLSKSTDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL L+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DTRTLKLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 69/160 (43%), Gaps = 20/160 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D     W A+ G+ L       GH   + S   S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHNPTAWFADNGERLG---TYRGHNGAVWSCDISRDSGRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T T L T+  + P  +V  +       +G   D  AV TTD       A    +I    
Sbjct  82   KTGTPLYTFNFDSPARSVDFA-------IG---DNLAVITTDPFMELTSAIHIKRISGDP  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  225
                 E +  +KG  G IN   + P  ++  S GED  +R
Sbjct  132  ADQTGESVLVLKGPQGRINRAVWGPLNRTIVSAGEDAVIR  171



>ref|XP_010926275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
 ref|XP_010926276.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   303 bits (775),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIISGGED+V+RIWDAETG+LLKESD+E+GH+K ITSL+KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISGGEDAVVRIWDAETGQLLKESDKETGHQKTITSLSKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNA  +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DIRTLTLIKTYVTERPVNACAISPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVRLHHFD DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRLHHFDPDYFNIKM  326


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D+S KLW +
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSGLLITGSADQSVKLWSV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
            +T   L ++  + P  AV  S       +G   D  A+ TTD   G       K  A+  
Sbjct  82   QTGAQLYSFNFDSPAKAVDFS-------IG---DKLAIITTDPFMGLPSTIQVKRIARDP  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             +   E +  +KG  G IN   + P  K+  SGGED  VR+
Sbjct  132  SEQTSESVLTIKGPQGRINRAVWGPLNKTIISGGEDAVVRI  172



>ref|XP_010111947.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
 gb|EXC32128.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
Length=429

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIISGGED+++RIWD+ETGKLL ESD+E  HKK ITSLAKS+DGSHF+TGS DKSAKLW
Sbjct  262  QTIISGGEDTIIRIWDSETGKLLNESDKEVSHKKNITSLAKSVDGSHFLTGSHDKSAKLW  321

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF+DKILQ
Sbjct  322  DTRTLTLIKTYTTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFFDKILQ  381

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  382  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  429


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D    ITGS D+SAKLWD+
Sbjct  128  LFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWSCDVSRDSIRLITGSADQSAKLWDV  184

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            RT   L T+  + P  +V  S       +G   D  AV TTD   G   A    +I    
Sbjct  185  RTGHQLHTFNFDSPARSVDFS-------VG---DKLAVITTDPFMGHTSAIHVKRIADDP  234

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  SGGED  +R+
Sbjct  235  DDQTSESVLVIKGPQGRINRAVWGPLNQTIISGGEDTIIRI  275



>gb|KFK37423.1| hypothetical protein AALP_AA4G255300 [Arabis alpina]
Length=328

 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+RIWDAETGKLLKES++E GHKK ITSL+KS D SHFITGSLDK+AKLW
Sbjct  161  QTIVSGGEDAVIRIWDAETGKLLKESNEEDGHKKPITSLSKSADDSHFITGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY +  PVNAV++SPLLDH+V+GGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLIKTYTSNVPVNAVSISPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  281  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIRI  328



>ref|XP_010514644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Camelina sativa]
 ref|XP_010514645.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Camelina sativa]
Length=328

 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+RIWD+ETGKLLKESD E GHKK ITSLAK+ D SHFITGSLDK+AKLW
Sbjct  161  QTIVSGGEDAVIRIWDSETGKLLKESDGEVGHKKPITSLAKAADDSHFITGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHH D DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHLDPDYFNIKI  328


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 70/163 (43%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWYADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            ++   L T+    P  +V  S + DH+         AV TTD    +  A    +I ++ 
Sbjct  82   QSGQELFTFKFGSPTRSVDFS-VGDHL---------AVITTDPFMERTSAIHVKRIAEDP  131

Query  323  IGGVKGHF----GP-----INALAFNPDGKSFASGGEDGYVRL  222
               V         P     IN   + P  ++  SGGED  +R+
Sbjct  132  QDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRI  174



>emb|CDY34145.1| BnaA02g28950D [Brassica napus]
Length=330

 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--  516
            +TI+SGGED+VLRIWDAETGKLLKESD E GHK  ITSL KS D SHFITGSLDK+AK  
Sbjct  161  QTIVSGGEDAVLRIWDAETGKLLKESDSEVGHKNTITSLTKSADDSHFITGSLDKTAKAC  220

Query  515  LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  336
            LWD+RTLTLLKTYV+  PVNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKI
Sbjct  221  LWDMRTLTLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKI  280

Query  335  LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  281  LQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIRI  330



>gb|EPS65969.1| hypothetical protein M569_08807 [Genlisea aurea]
Length=326

 Score =   301 bits (770),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+RIWD ETGKLLK+SD+E  HKK ITSL+KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIVSAGEDAVIRIWDTETGKLLKQSDKEESHKKPITSLSKSTDGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RT+ L+KTYVTERPVNAV +SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL 
Sbjct  219  DTRTIKLIKTYVTERPVNAVAISPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFSIKI  326


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 71/154 (46%), Gaps = 6/154 (4%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D    ITGS D++AKLWD+
Sbjct  25   LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWSCDISRDSKRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+  + P  +V  + + D  V+        +++  H   K  A   D+   E 
Sbjct  82   KTGKPLYTFEFDSPARSVDFA-VGDKFVVITTDTFMELSSAIHI--KRIASDPDEQTGES  138

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  139  LLTLKGPQGRINRAIWGPLNRTIVSAGEDAVIRI  172



>emb|CDP11515.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   296 bits (758),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIISGGEDSV+RIWD+ETGKLLKESD+E+GHKKGITSL+KS D +HFI+GSLDKSAKLW
Sbjct  44   KTIISGGEDSVIRIWDSETGKLLKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLW  103

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY TERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQ
Sbjct  104  DMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQ  163

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSFA GGEDGYVRLHHFD DYF+IKI
Sbjct  164  EEIGGVKGHFGPINALAFNPDGKSFARGGEDGYVRLHHFDPDYFNIKI  211



>ref|XP_009151956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151957.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
Length=328

 Score =   300 bits (769),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+VLRIWDAETGKLLKE+D+E GHK+ ITSL KS D SHF+TGSLDK+AKLW
Sbjct  161  QTIVSGGEDAVLRIWDAETGKLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKFYDKILQ
Sbjct  221  DMRTLTLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  328


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+         GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWYADNGE---RHGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            +T T L ++    P  +V  S       +G   D  AV TTD    +  A    +I    
Sbjct  82   KTGTQLFSFKFSSPARSVDFS-------VG---DKLAVITTDPFMARTSAIHVKRIADDP  131

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            Q++ G  V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  QDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRI  174



>ref|XP_010502959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=328

 Score =   300 bits (768),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+RIWD+ETGKLLKESD E GHKK ITSLAK+ D SHFITGSLDK+AKLW
Sbjct  161  QTIVSGGEDAVIRIWDSETGKLLKESDGEVGHKKPITSLAKAADDSHFITGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLIKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHH D DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHLDPDYFNIKI  328


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 70/163 (43%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWYADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            ++   L T+    P  +V  S + DH+         AV TTD    +  A    +I ++ 
Sbjct  82   QSGQELFTFKFGSPTRSVDFS-VGDHL---------AVITTDPFMERTSAIHVKRIAEDP  131

Query  323  IGGVKGHF----GP-----INALAFNPDGKSFASGGEDGYVRL  222
               V         P     IN   + P  ++  SGGED  +R+
Sbjct  132  QDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRI  174



>ref|XP_010425732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camelina sativa]
Length=356

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+RIWD+ETGKLLKESD E GHKK ITSL K+ D SHFITGSLDK+AKLW
Sbjct  189  QTIVSGGEDAVIRIWDSETGKLLKESDGEVGHKKPITSLCKAADDSHFITGSLDKTAKLW  248

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  249  DMRTLTLIKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  308

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHH D+DYF+IKI
Sbjct  309  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHLDSDYFNIKI  356


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 70/163 (43%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  53   LFSCAKDHTPTLWYADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  109

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            ++   L T+    P  +V  + + DH+         AV TTD    +  A    +I ++ 
Sbjct  110  QSGQELFTFKFGSPTRSVDFA-VGDHL---------AVITTDPFMERTSAIHVKRIAEDP  159

Query  323  IGGVKGHF----GP-----INALAFNPDGKSFASGGEDGYVRL  222
               V         P     IN   + P  ++  SGGED  +R+
Sbjct  160  QDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRI  202



>ref|XP_006395439.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32725.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=328

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+R+WD ETGKL+KES++E GHKK ITSL K+ D SHFITGSLDK+AKLW
Sbjct  161  ETIVSGGEDAVIRVWDTETGKLIKESNEEEGHKKTITSLCKAADDSHFITGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  328



>gb|ABR18068.1| unknown [Picea sitchensis]
Length=326

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIISGGED+V+RIWD+ETGKLL+ES++E+GH+K ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISGGEDAVVRIWDSETGKLLRESEKETGHQKPITSLFKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KIL+
Sbjct  219  DIRTLTLIKTYVTERPVNAVAISPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVRLHHFD DYFHIK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRLHHFDNDYFHIKM  326


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 67/164 (41%), Gaps = 26/164 (16%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W    G+ L       GH   +     S D +  IT S D++ KLW++
Sbjct  25   LFSCAKDHTPTVWYGHNGERL---GTYRGHNGAVWCCDVSRDSTRLITSSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD---HRAGKFEAKFYDKIL  333
             T T L ++  E P  AV ++            D   V TTD           K  +K L
Sbjct  82   ETGTQLFSFNFESPARAVDLAE----------GDKLVVITTDPFMELPSAIHIKRIEKDL  131

Query  332  QEE-------IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             ++       I G+KG    IN   + P  ++  SGGED  VR+
Sbjct  132  SKQSADSILTITGIKGR---INRAVWGPLNRTIISGGEDAVVRI  172



>gb|ABK26793.1| unknown [Picea sitchensis]
Length=326

 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIISGGED+V+RIWD+ETGKLL+ES++E+GH+K ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISGGEDAVVRIWDSETGKLLRESEKETGHQKPITSLFKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KIL+
Sbjct  219  DIRTLTLIKTYVTERPVNAVAISPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVRLHHFD++YFHIK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRLHHFDSEYFHIKM  326


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 67/164 (41%), Gaps = 26/164 (16%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W    G+ L       GH   +     S D +  IT S D++ KLW++
Sbjct  25   LFSCAKDHTPTVWYGHNGERL---GTYRGHNGAVWCCDVSRDSTRLITSSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD---HRAGKFEAKFYDKIL  333
             T T L ++  E P  AV ++            D   V TTD           K  +K L
Sbjct  82   ETGTQLFSFNFESPARAVDLAE----------GDKLVVITTDPFMELPSAIHIKRIEKDL  131

Query  332  QEE-------IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             ++       I G+KG    IN   + P  ++  SGGED  VR+
Sbjct  132  SKQSADSILTITGIKGR---INRAVWGPLNRTIISGGEDAVVRI  172



>emb|CDP20306.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   297 bits (761),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIISGGEDSV+RIWD+ETGKLLKESD+E+GHKKGITSL+KS D +HFI+GSLDKSAKLW
Sbjct  159  KTIISGGEDSVIRIWDSETGKLLKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY TERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQ
Sbjct  219  DMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDPDYFNIKI  326


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D     W A+ G+ L       GH   +     S D S  +TGS D++AKLW++
Sbjct  25   LFSCAKDHTPTGWFADNGERLG---TYRGHNGAVWCCDVSRDSSLLLTGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L T+  + P  +V            G  D  AV TTD   G   A    +I +  
Sbjct  82   KTGTQLYTFNFDSPTRSVDF----------GVGDKLAVITTDPFMGLPSAIQVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E I  +KG  G IN   + P  K+  SGGED  +R+
Sbjct  132  ADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRI  172



>ref|XP_008782131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Phoenix dactylifera]
Length=326

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K +TSL+KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDAVVRIWDSETGQLLKESDKETGHQKTVTSLSKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNA  +SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DIRTLTLIKTYVTERPVNACAISPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPEYFNIKM  326


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D+S KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSHDSGLLITGSADQSVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
            +T   L T+    P  AV  S       +G   D  AV TTD   G       K  A+  
Sbjct  82   QTGAQLYTFNFGSPARAVDFS-------VG---DKLAVITTDPFMGLPSTIQVKQIARDP  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             +   E +  +KG  G IN   + P  K+  S GED  VR+
Sbjct  132  SEQTSESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVVRI  172



>ref|XP_010937470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K +TSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDAVIRIWDSETGQLLKESDKETGHQKTVTSLLKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNA  +SPLLDH+VLGGGQDAS VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DSRTLTLIKTYVTERPVNACAISPLLDHVVLGGGQDASHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYFNIKM  326


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++ KLWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSTRLITGSADQTVKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T   L ++  + P  AV  S       +G   D  AV TTD   G        +I++  
Sbjct  82   QTGVQLYSFNFDSPARAVDFS-------VG---DKFAVITTDPFMGLPSTIQVKRIVRDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  SQQTGESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVIRI  172



>ref|XP_006854979.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
 gb|ERN16446.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
Length=238

 Score =   292 bits (747),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIISGGED+V+R+WD+ETGKLLKE+D+E GH+K ITSL+KS DGSHF+TGSLDKSAKLW
Sbjct  71   RTIISGGEDAVIRMWDSETGKLLKETDKEIGHQKTITSLSKSSDGSHFLTGSLDKSAKLW  130

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTYVTERPVNA  +SPL DH+V+GGGQ+AS VTTTD RAGKFEAKF+ +IL+
Sbjct  131  DVRTLTLIKTYVTERPVNACAISPLHDHVVIGGGQEASHVTTTDRRAGKFEAKFFHQILE  190

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFDADYF+IK+
Sbjct  191  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDADYFNIKM  238



>emb|CDY03970.1| BnaC02g36850D [Brassica napus]
Length=680

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--  516
            +TI+SGGED+VLRIWDAETGKLLKESD E GHK  ITSL KS D SHFITGSLDK+AK  
Sbjct  511  QTIVSGGEDAVLRIWDAETGKLLKESDAEVGHKNTITSLTKSADDSHFITGSLDKTAKAC  570

Query  515  LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  336
            LWD+RTLTLLKTYV+  PVNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKI
Sbjct  571  LWDMRTLTLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKI  630

Query  335  LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  631  LQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIRI  680



>ref|XP_004297796.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+++RIWD+ETGKLL+E+ +E GH K ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  162  RTIISAGEDAIIRIWDSETGKLLQENQKEDGHTKTITSLVKSPDGSHFLTGSLDKSAKLW  221

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TE PVNAV MSPLL+H+VLGGGQDA  VTTTDHRAGKFEAKFYDKILQ
Sbjct  222  DTRTLTLIKTYRTESPVNAVAMSPLLNHVVLGGGQDAINVTTTDHRAGKFEAKFYDKILQ  281

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY+RLHHFD DYF+IKI
Sbjct  282  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYIRLHHFDHDYFNIKI  329



>ref|XP_010249002.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Nelumbo nucifera]
Length=326

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V R+WD ETGKL+ ESD+ESGH+K +TSLAKS D SHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVTRVWDTETGKLINESDKESGHQKTVTSLAKSADWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DTRTLTLVKTYVTERPVNAVAMSPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYFNIKM  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSTRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L T+    P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGTQLYTFNFGSPTRSVDFS-------IG---DKLAVITTDPFMELTSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED   R+
Sbjct  132  SDQTGESVLTIKGPQGRINRAIWGPLNRTIISAGEDAVTRV  172



>ref|XP_008808070.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Phoenix dactylifera]
Length=254

 Score =   290 bits (742),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K ITSL+KS  GSHF++GSLDKSAKLW
Sbjct  87   KTIISAGEDAVIRIWDSETGQLLKESDKETGHQKPITSLSKSAKGSHFLSGSLDKSAKLW  146

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+K YVTERPVNA  +SPLLDH+V+GGGQDAS VTTTD RAGKFEAKF+ KILQ
Sbjct  147  DARTLTLIKAYVTERPVNACAISPLLDHVVIGGGQDASHVTTTDRRAGKFEAKFFHKILQ  206

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF SGGEDGYVRLHHFD DYF+IK+
Sbjct  207  EEIGGVKGHFGPINALAFNPDGRSFTSGGEDGYVRLHHFDPDYFNIKM  254



>ref|XP_002882056.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58315.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   293 bits (749),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+RIWD ETGKLL E+++E GHKK ITSL K+ D SHF+TGS DK+AKLW
Sbjct  161  QTIVSAGEDTVIRIWDTETGKLLNETNEEVGHKKAITSLCKAADDSHFLTGSHDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  328


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 70/163 (43%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            ++   L T+    P  +V  + L DH+         AV TTDH   +  A    +I ++ 
Sbjct  82   KSGKELFTFKFGSPTRSVDFA-LGDHL---------AVITTDHFVDRMAAIHVKRIAEDP  131

Query  323  IGGVKGHF----GP-----INALAFNPDGKSFASGGEDGYVRL  222
               V         P     IN   + P  ++  S GED  +R+
Sbjct  132  EDQVSDSVLVLQCPDGKKRINRAVWGPLNQTIVSAGEDTVIRI  174



>ref|XP_002315834.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEF02005.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=328

 Score =   293 bits (749),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GEDS+    +  TGKLLKESD E GHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  161  KTIISAGEDSMGFRGNWLTGKLLKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTY TERPVNAVTMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDK+LQ
Sbjct  221  DTRTLTLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  328



>ref|XP_010275011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nelumbo nucifera]
Length=326

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+R+WD ETGKL+ ESD+ESGH+K +TSLAKS D S+F+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAVIRVWDTETGKLINESDKESGHQKTVTSLAKSADWSNFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+K YVTERPVNAV MSPLLDH+VLGGGQ+AS VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DARTLTLIKAYVTERPVNAVAMSPLLDHVVLGGGQEASHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYFNIKM  326


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSTRLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +T T L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QTGTQLYTFNFDSPTRSVDFS-------IG---DKLAVITTDPFMELTSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  ++G  G IN   + P  ++  S GED  +R+
Sbjct  132  SDQSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVIRV  172



>ref|XP_009389562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389563.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+R+WD ETG+LLKESD+E+GH+K +TSL+KS DGSHF+TGSLDKSAKLW
Sbjct  159  KTIISAGEDAVVRVWDTETGQLLKESDKETGHQKTVTSLSKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNA  +SPLLDH+V+GGGQ+A  VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DARTLTLIKTYVTERPVNACAISPLLDHVVIGGGQEAVHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYFTIKM  326


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D+S KLW++
Sbjct  25   LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADQSVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
            +T   L ++  + P  +V  S       +G   D  AV TTD   G       K  A+  
Sbjct  82   QTGAQLYSFNFDSPARSVDFS-------VG---DKLAVITTDPFMGLPSTIQVKRIARDP  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            ++   E +  +KG  G IN   + P  K+  S GED  VR+
Sbjct  132  NEQSSESVLTIKGPQGRINRAIWGPLNKTIISAGEDAVVRV  172



>ref|XP_008808069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Phoenix dactylifera]
Length=326

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K ITSL+KS  GSHF++GSLDKSAKLW
Sbjct  159  KTIISAGEDAVIRIWDSETGQLLKESDKETGHQKPITSLSKSAKGSHFLSGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+K YVTERPVNA  +SPLLDH+V+GGGQDAS VTTTD RAGKFEAKF+ KILQ
Sbjct  219  DARTLTLIKAYVTERPVNACAISPLLDHVVIGGGQDASHVTTTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF SGGEDGYVRLHHFD DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFTSGGEDGYVRLHHFDPDYFNIKM  326


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D +  ITGS D+S KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYKGHNGAVWCCDVSRDSTRLITGSADQSVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
            +T   L ++  + P  AV  S       +G   D  AV TTD   G       K  A+  
Sbjct  82   QTGVQLYSFNFDSPARAVDFS-------VG---DKLAVITTDPFMGLPSTIQVKRIARDP  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             +   E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  132  SQQTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVIRI  172



>ref|NP_182152.2| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEC10672.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+ +RIWDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS DK+AKLW
Sbjct  188  QTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLW  247

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD ILQ
Sbjct  248  DMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQ  307

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAF+PDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  308  EEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  355


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 71/168 (42%), Gaps = 32/168 (19%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  52   LFSCAKDHTPTVWFADNGERL---GTYRGHSGAVWCCDISRDSSRLITGSADQTAKLWDV  108

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            ++   L T+    P  +V  S + DH+         AV TTDH  G   A    +I    
Sbjct  109  KSGKELFTFKFGAPARSVDFS-VGDHL---------AVITTDHFVGTSSAIHVKRIAEDP  158

Query  335  ----------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      LQ   G  K     IN   + P  ++  SGGED  +R+
Sbjct  159  EDQVGDSVLVLQSPDGKKK-----INRAVWGPLNQTIVSGGEDAAIRI  201



>gb|AAC62877.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   291 bits (744),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+ +RIWDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS DK+AKLW
Sbjct  161  QTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD ILQ
Sbjct  221  DMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAF+PDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  328


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 71/168 (42%), Gaps = 32/168 (19%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTVWFADNGERLG---TYRGHSGAVWCCDISRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            ++   L T+    P  +V  S + DH+         AV TTDH  G   A    +I    
Sbjct  82   KSGKELFTFKFGAPARSVDFS-VGDHL---------AVITTDHFVGTSSAIHVKRIAEDP  131

Query  335  ----------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      LQ   G  K     IN   + P  ++  SGGED  +R+
Sbjct  132  EDQVGDSVLVLQSPDGKKK-----INRAVWGPLNQTIVSGGEDAAIRI  174



>dbj|BAC43524.1| putative eukaryotic translation initiation factor 3 delta subunit 
[Arabidopsis thaliana]
Length=355

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+ +RIWDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS DK+AKLW
Sbjct  188  QTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLW  247

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD ILQ
Sbjct  248  DMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQ  307

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAF+PDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  308  EEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  355


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 74/163 (45%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  52   LFSCAKDHTPTVWFADNGERLG---TYRGHSGAVWCCDISRDSSRLITGSADQTAKLWDV  108

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+    P  +V  S + DH+         AV TTDH  G   A    +I    
Sbjct  109  KSGKELFTFKFGAPARSVDFS-VDDHL---------AVITTDHFVGTSSAIHVKRIAEDP  158

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            ++++G  V     P     IN   + P  ++  SGGED  +R+
Sbjct  159  EDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRI  201



>ref|XP_010506629.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=361

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTI+S GED+V+RIWD ETG LLKESD+E GHKK ITSL K+ D SHF+TGSLDK+AKLW
Sbjct  194  KTIVSAGEDAVIRIWDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLDKTAKLW  253

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+K+Y T  PVNAV MSPLL+H++LGGGQDASAVTTTDHRAGKFEAKFYD IL+
Sbjct  254  DMRTLTLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGKFEAKFYDTILE  313

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD++YF IKI
Sbjct  314  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSNYFDIKI  361



>ref|XP_010508042.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=360

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTI+S GED+V+RIWD ETG LLKESD+E GHKK ITSL K+ D SHF+TGSLD +AKLW
Sbjct  193  KTIVSAGEDAVIRIWDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLDNTAKLW  252

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTL+K+Y T  PVNAV MSPLL+H++LGGGQDASAVTTTDHRAG FEAKFYD ILQ
Sbjct  253  DMRTLTLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGNFEAKFYDTILQ  312

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  313  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  360



>emb|CDY71621.1| BnaAnng38210D [Brassica napus]
Length=344

 Score =   290 bits (743),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 16/184 (9%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--  516
            +TI+SGGED+VLRIWDAETGKLLKE+D+E GHK+ ITSL KS D SHF+TGSLDK+AK  
Sbjct  161  QTIVSGGEDAVLRIWDAETGKLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKAC  220

Query  515  --------------LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD  378
                          LWD+RTLTL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTD
Sbjct  221  LPRLSSLSIACFKVLWDMRTLTLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTD  280

Query  377  HRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            HRAG FEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF
Sbjct  281  HRAGNFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYF  340

Query  197  HIKI  186
            +IKI
Sbjct  341  NIKI  344


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D +  +W A+ G+         GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHIPTLWYADNGE---RHGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD---HRAGKFEAKFYDKIL  333
            +T T L ++    P  +V  S       +G   D  AV TTD    R      K   +  
Sbjct  82   KTETQLFSFKFSSPARSVDFS-------VG---DKLAVITTDPFMERTSAIHVKRIAEDP  131

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            Q++ G  V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  QDQDGDSVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRI  174



>gb|AIZ68198.1| eukaryotic translation initiation factor 3 subunit I-like isoform 
X1 [Ornithogalum saundersiae]
Length=328

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIISGGED +LR WD ETG LL ESD+E+GH+K ITSL+KS DGSHF+T SLDKSAKLW
Sbjct  161  KTIISGGEDGILRTWDTETGSLLMESDKETGHQKRITSLSKSADGSHFLTSSLDKSAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTLLKTYVT  PVNA  +SPLLDH+V+GGGQDA  VT TDHRAGKFEAKF+ KILQ
Sbjct  221  DTRTLTLLKTYVTSAPVNACAISPLLDHVVMGGGQDAVNVTMTDHRAGKFEAKFFHKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVRLHHFD DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRLHHFDPDYFNIKI  328



>emb|CDY13713.1| BnaA06g32100D [Brassica napus]
Length=344

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 16/184 (9%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--  516
            +TI+SGGED+VLRIWDAETGKLLKE+D+E GHK+ ITSL KS D SHF+TGSLDK+AK  
Sbjct  161  QTIVSGGEDAVLRIWDAETGKLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKAC  220

Query  515  --------------LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD  378
                          LWD+RTLTL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTD
Sbjct  221  LPFLLYLLFHNPPVLWDMRTLTLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTD  280

Query  377  HRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            HRAG FEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF
Sbjct  281  HRAGNFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYF  340

Query  197  HIKI  186
            +IKI
Sbjct  341  NIKI  344


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 69/163 (42%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+         GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWYADNGE---RHGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD---HRAGKFEAKFYDKIL  333
            +T T L ++    P  +V  S       +G   D  AV TTD    R      K      
Sbjct  82   KTGTQLFSFKFSSPARSVDFS-------VG---DKLAVITTDPFMERTSAIHVKRIADDP  131

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            Q++ G  V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  QDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRI  174



>gb|ACF82853.1| unknown [Zea mays]
Length=211

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETG+LLKESD+ESGH+K I+SL+KS+D SHFITGSLDKSAKLW
Sbjct  44   RTIITAGEDATVRIWDSETGQLLKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLW  103

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQ
Sbjct  104  DTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ  163

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF IK+
Sbjct  164  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFSIKM  211



>ref|XP_002862549.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38807.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=328

 Score =   288 bits (737),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+RIWD ETGKLLK+SD E GHK+ ITSL K+ D SHF+TGS DK+AKLW
Sbjct  161  QTIVSGGEDTVIRIWDTETGKLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+R+LTL+K+Y T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD IL+
Sbjct  221  DMRSLTLIKSYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILE  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  328


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 73/163 (45%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A  G+ L       GH   ++    S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWLAHNGERLG---TYRGHNGAVSCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+       +V  S + DH+         AV TTDH  G   A    +I    
Sbjct  82   KSGKQLFTFNFGSSARSVDFS-VGDHL---------AVITTDHFMGVSSAIHVKRIAEDP  131

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            Q+++G  V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  QDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRI  174



>ref|NP_001061508.1| Os08g0308100 [Oryza sativa Japonica Group]
 gb|AAQ56413.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Japonica Group]
 gb|AAQ56424.1| TGF-beta receptor-interacting protein-like protein [Oryza sativa 
Japonica Group]
 dbj|BAC92643.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAC92579.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF23422.1| Os08g0308100 [Oryza sativa Japonica Group]
 dbj|BAI39771.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
 dbj|BAI39984.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
Length=326

 Score =   288 bits (736),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD ETG+ LKESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDTETGQCLKESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 26/164 (16%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + S   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPNVWFADNGDRLGTY---RGHNGAVWSCDVSRDSTRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+  + P  +V  +       +G   D  AV TTD+           +I ++ 
Sbjct  82   QTGRELFTFRFDAPARSVEFA-------IG---DGLAVITTDNFMENVPTAQVKRIAEDP  131

Query  323  ----------IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      I G+KG    IN   + P  ++  + GED  +R+
Sbjct  132  DDQSEESLLVITGIKGR---INRAVWGPLNRTIITAGEDATIRI  172



>ref|XP_006663589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oryza brachyantha]
Length=310

 Score =   287 bits (734),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +R+WD ETGK LKESD+E GH+K I+SL+KS D SHF+TGSLDKSAKLW
Sbjct  143  RTIITAGEDATVRLWDTETGKCLKESDKEQGHQKTISSLSKSADWSHFLTGSLDKSAKLW  202

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQ
Sbjct  203  DTRTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ  262

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  263  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  310


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 61/136 (45%), Gaps = 23/136 (17%)
 Frame = -3

Query  599  GHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIV  420
            GH   + S   S D +  ITGS D++AKLWD++T   L T+  + P  +V  +       
Sbjct  34   GHNGAVWSCDVSRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFA-------  86

Query  419  LGGGQDASAVTTTDHRAGKFEAKFYDKILQEE----------IGGVKGHFGPINALAFNP  270
            +G   D  AV TTD+           +I ++           I G+KG    IN   + P
Sbjct  87   IG---DGLAVITTDNFMDNAPTAQVKRIAEDPDDQSEESLLVITGIKGR---INRAVWGP  140

Query  269  DGKSFASGGEDGYVRL  222
              ++  + GED  VRL
Sbjct  141  LNRTIITAGEDATVRL  156



>gb|EMS51995.1| Eukaryotic translation initiation factor 3 subunit I [Triticum 
urartu]
Length=341

 Score =   288 bits (736),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETGKLLKESD+E+GH+K I+SL+KS+D SHF+TGSLDKSAKLW
Sbjct  125  RTIITAGEDATIRIWDSETGKLLKESDKEAGHQKAISSLSKSLDWSHFLTGSLDKSAKLW  184

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV MSP LD++V+GGGQDA  VT TD RAGKFEAKF+ KILQ
Sbjct  185  DARTLTLIKTYVTERPVNAVDMSPTLDNVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ  244

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  245  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPEYFNIKM  292



>ref|XP_006294579.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
 gb|EOA27477.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
Length=328

 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+RIWD ETG+LLKESD+E GHKK ITSL+K+ D SHFITGSLDKSAKLW
Sbjct  161  QTIVSGGEDAVIRIWDTETGQLLKESDEEVGHKKAITSLSKAADDSHFITGSLDKSAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAVTMSPLL+HIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYTTVVPVNAVTMSPLLNHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  328


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 71/164 (43%), Gaps = 24/164 (15%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            ++   L T+    P  +V  + + DH+         AV TTD    +  A    +I ++ 
Sbjct  82   QSGQQLFTFKFGSPARSVDFA-VGDHL---------AVITTDPFMERNSAIHVKRIAEDP  131

Query  323  ----------IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      +   +G    IN   + P  ++  SGGED  +R+
Sbjct  132  EDQVDESVLVLPSAEGR-KRINRAVWGPLNQTIVSGGEDAVIRI  174



>ref|NP_001055036.1| Os05g0256000 [Oryza sativa Japonica Group]
 gb|AAV31388.1| putative TGF-beta receptor interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF16950.1| Os05g0256000 [Oryza sativa Japonica Group]
 dbj|BAG97027.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78857.1| hypothetical protein OsI_19205 [Oryza sativa Indica Group]
 gb|EEE63021.1| hypothetical protein OsJ_17829 [Oryza sativa Japonica Group]
Length=326

 Score =   285 bits (729),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD ETG  L ESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDTETGTCLNESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  326


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L      SGH   + S   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPNVWFADNGDRLG---TYSGHNGAVWSCDVSRDSTRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            +T   L T+  + P  +V  +       +G   D  AV TTD+  G        +I    
Sbjct  82   QTGAELFTFRFDAPARSVEFA-------IG---DGLAVITTDNFMGNVPTAQVKRIADDP  131

Query  332  ----QEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                +E +  + G  G IN   + P  ++  + GED  +R+
Sbjct  132  DDQSEESLLVISGIKGRINRAVWGPLNRTIITAGEDATIRI  172



>ref|XP_003577379.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brachypodium distachyon]
Length=326

 Score =   285 bits (729),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETGKLL ESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDSETGKLLNESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQ
Sbjct  219  DARTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYFNIKM  326


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 71/162 (44%), Gaps = 22/162 (14%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S   +  +TGS D++AKLWD+
Sbjct  25   LFSCAKDHAPNVWYADNGERLG---TYKGHNGAVWSCDVSRHSTRLLTGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+  + P  +V  +       +G   D  AV TTD   G  +     K + E+
Sbjct  82   KTGKELFTFRFDAPARSVDFA-------IG---DRLAVITTDSFMGN-QPTAQVKRIAED  130

Query  323  IGG--------VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            I          + G  G IN   + P  ++  + GED  +R+
Sbjct  131  IEDQTEDSALVISGITGRINRAVWGPGNRTIITAGEDATIRI  172



>ref|XP_008670966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 ref|XP_008670967.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 tpg|DAA42586.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42587.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42588.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
Length=326

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETG+LLKESD+ESGH+K I+SL+KS+D SHFITGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDSETGQLLKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFSIKM  326


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + +   S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWTCDVSRDSARLITGSADQTAKLWEV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
             T   L ++  + P  +V  +       +G   DA AV TTD+          K  A+  
Sbjct  82   STGKELFSFRFDAPARSVEFA-------IG---DALAVVTTDNFMDHVPTVQVKRIAEDI  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            D   +E    + G  G IN   + P  ++  + GED  +R+
Sbjct  132  DDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATIRI  172



>ref|XP_002461510.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
 gb|EER98031.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
Length=326

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETGKLLKESD+ESGH+K ITSL+KS+D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDSETGKLLKESDKESGHQKTITSLSKSLDWSHFVTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD++YF IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSEYFSIKM  326


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 72/166 (43%), Gaps = 30/166 (18%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + +   S D +  ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWTCDVSRDSARLITGSADQTAKLWEV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD------------HRAGKF  360
             T   L ++  + P  +V  +       +G   DA AV TTD            H A   
Sbjct  82   STGKELFSFRFDAPARSVEFA-------IG---DALAVVTTDNFMDHVPTVQVKHIAEDI  131

Query  359  EAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            + +  D  L   I G+KG    IN   + P  ++  + GED  +R+
Sbjct  132  DDQTEDSALV--ITGIKGR---INRAVWGPLNRTIITAGEDATIRI  172



>ref|NP_001147501.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 gb|ACG27749.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 tpg|DAA59664.1| TPA: eukaryotic translation initiation factor 3 subunit 2 [Zea 
mays]
Length=326

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETG+LLKESD+ESGH+K I+SL+KS+D SHFITGSLDKSAKLW
Sbjct  159  RTIITAGEDATVRIWDSETGQLLKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQ
Sbjct  219  DTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFSIKM  326


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + +   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWTCDVSRDSARLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
             T   L ++  + P  +V  +       +G   DA AV TTD+          K  A+  
Sbjct  82   STGKELFSFRFDAPARSVEFA-------IG---DALAVVTTDNFMDHVPTVQVKRIAEDI  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            D   +E    + G  G IN   + P  ++  + GED  VR+
Sbjct  132  DDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATVRI  172



>gb|AFM95335.1| eukaryotic translation initiation factor 3 subunit i [Triticum 
aestivum]
Length=326

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETGKLLKESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDSETGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KIL+
Sbjct  219  DARTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPEYFNIKM  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + S   S   +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWSCDVSRHSARLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T   L T+  + P  +V ++ + DH+         AV TTD   G        +I    
Sbjct  82   KTGKELFTFRFDAPARSVDLA-IGDHL---------AVITTDSFMGNMPTAQVKRIAEDL  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                +E    + G  G IN   + P  ++  + GED  +R+
Sbjct  132  QDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRI  172



>dbj|BAJ85385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD+ETGKLLKESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDSETGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KIL+
Sbjct  219  DARTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPEYFNIKM  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + S   S   +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWSCDVSRHSTRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
            +T   L T+  + P  +V ++ + DH+         AV TTD   G        +I    
Sbjct  82   KTGKELFTFRFDAPARSVDLA-IGDHL---------AVITTDSFMGNMPTAQVKRIAEDL  131

Query  335  ---LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                +E    + G  G IN   + P  ++  + GED  +R+
Sbjct  132  QDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRI  172



>ref|XP_004955547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Setaria italica]
Length=326

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD ETGKLLKESD+ESGH+K I+SL+KS D SHFITGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDTETGKLLKESDKESGHQKTISSLSKSADWSHFITGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTL+KTYVTERPVNAV +SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQ
Sbjct  219  DSRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKM  326


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + S   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWSCDVSRDSARLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG-------KFEAKFY  345
             T   L ++  + P  +V  +       +G   DA AV TTD+          K  A+  
Sbjct  82   STGRELFSFRFDAPARSVEFA-------IG---DALAVITTDNFMDHVPTVQVKHIAEDL  131

Query  344  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
            D    E    + G  G IN   + P  ++  + GED  +R+
Sbjct  132  DDQTDESALVITGIKGRINRAVWGPLNRTIITAGEDATIRI  172



>ref|XP_002882057.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58316.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 155/170 (91%), Gaps = 2/170 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--  516
            +TI+SGGED+V+RIWD ETGKLLK+SD E GHK+ ITSL K+ D SHF+TGS DK+AK  
Sbjct  190  QTIVSGGEDTVIRIWDTETGKLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHDKTAKAC  249

Query  515  LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  336
            LWD+R+LTL+K+Y T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD I
Sbjct  250  LWDMRSLTLIKSYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTI  309

Query  335  LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            L+EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  310  LEEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  359


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 73/163 (45%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A  G+ L       GH   ++    S D S  ITGS D++AKLWD+
Sbjct  54   LFSCAKDHTPTLWLAHNGERLG---TYRGHNGAVSCCDVSRDSSRLITGSADQTAKLWDV  110

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+       +V  S + DH+         AV TTDH  G   A    +I    
Sbjct  111  KSGKQLFTFNFGSSARSVDFS-VGDHL---------AVITTDHFMGVSSAIHVKRIAEDP  160

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            Q+++G  V     P     IN   + P  ++  SGGED  +R+
Sbjct  161  QDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRI  203



>ref|XP_001758941.1| predicted protein [Physcomitrella patens]
 gb|EDQ76447.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   283 bits (723),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+ +RIWDAETGK L ESD E+GH+K ITS+AKS DGSHFITGS DKSAKLW
Sbjct  159  KTIISAGEDATIRIWDAETGKCLIESDPETGHQKVITSMAKSADGSHFITGSQDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLT+LKTY TERPVNA  +SPLLDH+V+GGGQ+AS VT T  RAGKFEAKF+ KI +
Sbjct  219  DIRTLTVLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR+H FDADY+HIK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRVHFFDADYYHIKV  326


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A  G+ L       GH   +     S D +  +T S D++ KLWD 
Sbjct  25   LFSCAKDHTPTVWYASNGERL---GTYRGHNGAVWCCDVSRDSTRLVTSSADQTVKLWDC  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFY-----DK  339
             T  LL T+  + P  AV+ S            D   V +TD    K  A        D+
Sbjct  82   ETGVLLDTFYFDAPARAVSFSE----------GDKMVVISTDPFMEKQSAIHVKMINSDR  131

Query  338  ILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             LQ  E++  + G  G IN + + P  K+  S GED  +R+
Sbjct  132  SLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRI  172



>ref|NP_182151.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 ref|NP_850450.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 sp|Q38884.2|EIF3I_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TGF-beta receptor-interacting 
protein 1; Short=TRIP-1; AltName: Full=eIF-3-beta; 
AltName: Full=eIF3 p36 [Arabidopsis thaliana]
 gb|AAC62878.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 dbj|BAE98705.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AEC10670.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10671.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=328

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED V+RIWDAETGKLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLW
Sbjct  161  QTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  328


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+    P  +V  +       +G   D  AV TTDH   +  A    +I    
Sbjct  82   KSGKELFTFKFNAPTRSVDFA-------VG---DRLAVITTDHFVDRTAAIHVKRIAEDP  131

Query  332  -QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
             +++   V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  EEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRI  174



>gb|AAG53616.1|AF285835_1 eukaryotic initiation factor 3I1 subunit [Arabidopsis thaliana]
Length=328

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED V+RIWDAETGKLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLW
Sbjct  161  QTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI  328


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+    P  +V  +       +G   D  AV TTDH   +  A    +I    
Sbjct  82   KSGKELFTFKFNAPTRSVDFA-------VG---DRFAVITTDHFVDRTAAIHVKRIAEDP  131

Query  332  -QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
             +++   V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  EEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRI  174



>ref|XP_001757566.1| predicted protein [Physcomitrella patens]
 gb|EDQ77623.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+ +RIWDAETGKLLKESD E+GH+K IT++AKS DGSHFITGS DKSAKLW
Sbjct  159  KTIISAGEDATIRIWDAETGKLLKESDPETGHQKVITAMAKSADGSHFITGSHDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTL +LKTY TERPVNA  +SPLLDH+V+GGGQ+AS VT T  RAGKFEAKF+ KI +
Sbjct  219  DIRTLQMLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINAL FNPDG+SF+SGGEDGYVR+H FD+DY+HIK+
Sbjct  279  EEIGGVKGHFGPINALVFNPDGRSFSSGGEDGYVRVHFFDSDYYHIKV  326


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 66/161 (41%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A  G+ L       GH   +     S D +  +T S D++ KLWD 
Sbjct  25   LFSCAKDHTPTVWYASNGERL---GTYKGHNGAVWCCDVSRDSTRLVTSSADQTVKLWDC  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTD-----HRAGKFEAKFYDK  339
             T   L ++  + P  AV+ +            D   V TTD       A   +    D+
Sbjct  82   ETGVQLHSFNFDAPARAVSFAE----------GDKMVVITTDPFMEQQSAIHVKRIESDR  131

Query  338  ILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             LQ  E++  + G  G IN   + P  K+  S GED  +R+
Sbjct  132  SLQSSEDVLTITGPQGRINRAMWGPLNKTIISAGEDATIRI  172



>ref|XP_001763986.1| predicted protein [Physcomitrella patens]
 gb|EDQ71125.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+ +RIWDAETGK LKESD E+GH+K IT+++KS DGSHFITGS DKSAKLW
Sbjct  159  KTIISAGEDATIRIWDAETGKCLKESDPETGHQKVITAMSKSADGSHFITGSHDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLT+LKTY TERPVNA  +SPLLDH+V+GGGQ+AS VT T  R GKFEAKF+ KI +
Sbjct  219  DIRTLTVLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRVGKFEAKFFHKIFE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR+H FDADY+HIK+
Sbjct  279  EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRVHFFDADYYHIKV  326


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A  G+ L       GH   +     S D +  +T S D++ KLW+ 
Sbjct  25   LFSCAKDHTPTVWYASNGERL---GTYKGHNGAVWCCDVSRDSTRLVTSSADQTVKLWEC  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFY-----DK  339
             T  LL T+  + P  AV+ S            D   V +TD    K  A        D+
Sbjct  82   ETGVLLHTFNFDAPARAVSFSE----------GDKMVVISTDPFMEKQSAIHVKRIESDR  131

Query  338  ILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
             LQ  E++  + G  G IN + + P  K+  S GED  +R+
Sbjct  132  FLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRI  172



>gb|AAK43862.1|AF370485_1 eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AAL47346.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED V+RIWDAETGKLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLW
Sbjct  161  QTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGK F+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKGFSSGGEDGYVRLHHFDSDYFNIKI  328


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+    P  +V  +       +G   D  AV TTDH   +  A    +I    
Sbjct  82   KSGKELFTFKFNAPTRSVDFA-------VG---DRLAVITTDHFVDRTAAIHVKRIAEDP  131

Query  332  -QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
             +++   V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  EEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRI  174



>ref|XP_010678072.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGK-LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKL  513
            K IIS GED+++R+WD  TG+ ++   D E+GH   ITSL  S D SHF+TGSLDKSAKL
Sbjct  159  KNIISCGEDAIIRVWDPVTGQEIMSTKDHENGHNNAITSLCFSADKSHFLTGSLDKSAKL  218

Query  512  WDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL  333
            WD R+LTL+KTY+T RPVNAVTMSPLLDH+VLGGGQDAS VTT+DHRAGKFEAKF+DKIL
Sbjct  219  WDTRSLTLIKTYITGRPVNAVTMSPLLDHVVLGGGQDASTVTTSDHRAGKFEAKFFDKIL  278

Query  332  QEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            +EEIGGVKGHFGPINALAFNPDGKSFASGGEDGY RLHHFD DYF IKI
Sbjct  279  EEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYARLHHFDPDYFTIKI  327


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D S  ITGS D++ KLWD+
Sbjct  25   LFSCAKDHNPTVWYADNGERLG---TYRGHNGAVWSCDISWDSSRLITGSADQTVKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +    L T+  + P  +V  S       +G   D  AV TTD    K  A    +I +  
Sbjct  82   KKGEQLYTFNFDAPARSVNFS-------VG---DKLAVITTDPFMEKTSAIHVKRIAEDI  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E    ++G  G IN   +    K+  S GED  +R+
Sbjct  132  DEQTNESALVMRGPSGRINRAVWGLLNKNIISCGEDAIIRV  172



>dbj|BAH19940.1| AT2G46280 [Arabidopsis thaliana]
Length=328

 Score =   275 bits (703),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED V+RIWDAETGKLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLW
Sbjct  161  QTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAV++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ
Sbjct  221  DMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            E IGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD+ YF+IKI
Sbjct  281  EGIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSGYFNIKI  328


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL---  333
            ++   L T+    P  +V  +       +G   D  AV TTDH   +  A    +I    
Sbjct  82   KSGKELFTFKFNAPTRSVDFA-------VG---DRLAVITTDHFVDRTAAIHVKRIAEDP  131

Query  332  -QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
             +++   V     P     IN   + P  ++  SGGED  +R+
Sbjct  132  EEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRI  174



>gb|AAC49079.1| TGF-beta receptor interacting protein 1 homolog [Arabidopsis 
thaliana]
Length=328

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED V+RIWDAETGKLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLW
Sbjct  161  QTIVSCGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+RTLTLLKTY T  PVNAV++SPLL+H+VLGGG+DASAVTTTDHRAGKFEAKF DKILQ
Sbjct  221  DMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGEDASAVTTTDHRAGKFEAKFCDKILQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIGGVKGHFGPINALAFNPDGKSF+SGGE GYVRLHHFD+DYF+IKI
Sbjct  281  EEIGGVKGHFGPINALAFNPDGKSFSSGGEGGYVRLHHFDSDYFNIKI  328


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 70/163 (43%), Gaps = 22/163 (13%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDH---RAGKFEAKFYDKIL  333
            ++   L T+    P  +V  +       +G   D  AV TTDH   R      K Y +  
Sbjct  82   KSGKELFTFKFNAPTRSVDFA-------VG---DRLAVITTDHFVDRTAAIHVKAYCEDP  131

Query  332  QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDGYVRL  222
            +E+    V     P     IN   + P  ++  S GED  +R+
Sbjct  132  EEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSCGEDKVIRI  174



>ref|XP_002988251.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
 ref|XP_002991383.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ07495.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ10670.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
Length=323

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD ETG+++K++D+E+GH + ITSL+ S DGSHFITGS DK+AKLW
Sbjct  157  KTIISAGEDTVIRIWDVETGEVIKKTDKENGHSRAITSLSLSADGSHFITGSQDKTAKLW  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTLTLLKTY TERPVNAV +SPL++H+V+GGGQ+AS VTT+D RAGKFEAKF+ KI  
Sbjct  217  DTRTLTLLKTYSTERPVNAVAISPLMNHVVVGGGQEASQVTTSDRRAGKFEAKFFHKIFC  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            +EIGGV+GHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD DY+ ++
Sbjct  277  DEIGGVRGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDPDYYKLQ  323


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 65/161 (40%), Gaps = 22/161 (14%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W    G+ L       GH   +     S   +  ITGS D+S KLWD+
Sbjct  25   LFSCAKDHNPTVWYGHNGERL---GTYRGHNGAVWCCDVSRHSTRLITGSADQSVKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI----  336
             T T L T+    P  AV  +            D  AV +TD       A     +    
Sbjct  82   ETGTQLHTFNFVSPARAVDFAE----------GDKLAVISTDPFMESVSAIHIKSVESSG  131

Query  335  LQEEIGGVKGHFGP---INALAFNPDGKSFASGGEDGYVRL  222
            LQ+  G +K   GP   IN + + P  K+  S GED  +R+
Sbjct  132  LQQ--GSIKTFTGPTGRINRVVWGPLNKTIISAGEDTVIRI  170



>gb|KDO58631.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=313

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+++RIWD ETGKLLKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSF  255
            EEIGGVKGHFGPINALAFNPDGK +
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKRY  303


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMTLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
             T   L T+  + P  +V  +       +G   D  AV TTD       A    +I +  
Sbjct  82   ETGAQLFTFNFDSPARSVDFA-------VG---DKLAVITTDPFMELNSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  ADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRI  172



>ref|XP_006448046.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|ESR61286.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
Length=313

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+++RIWD ETGKLLKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLW
Sbjct  159  RTIISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQ
Sbjct  219  DARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSF  255
            EEIGGVKGHFGPINALAFNPDGK +
Sbjct  279  EEIGGVKGHFGPINALAFNPDGKRY  303


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D++AKLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMTLITGSADQTAKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
             T   L T+  + P  +V  +       +G   D  AV TTD       A    +I +  
Sbjct  82   ETGAQLFTFNFDSPARSVDFA-------VG---DKLAVITTDPFMELNSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  +KG  G IN   + P  ++  S GED  VR+
Sbjct  132  ADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRI  172



>gb|EAZ42270.1| hypothetical protein OsJ_26838 [Oryza sativa Japonica Group]
Length=380

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 151/222 (68%), Gaps = 54/222 (24%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+ GED+ +RIWD ETG+ LKESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLW
Sbjct  159  RTIITAGEDATIRIWDTETGQCLKESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERP--------------------VNAVTMS-----------------  441
            D RTLTL+KTYVTERP                    V+++T                   
Sbjct  219  DTRTLTLIKTYVTERPVNAVDISPLLDHPCHIGPTSVSSITKCGDSWMPQRIVAGMVLDD  278

Query  440  ----PLL-------------DHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGV  312
                P++             + +V+GGGQDA  VT TD RAGKFEAKF+ KILQEEIGGV
Sbjct  279  GGAMPVVILNVGTWQQPRQSERVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGV  338

Query  311  KGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            KGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  339  KGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  380


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 26/164 (16%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G  L       GH   + S   S D +  ITGS D++AKLWD+
Sbjct  25   LFSCAKDHTPNVWFADNGDRLGTY---RGHNGAVWSCDVSRDSTRLITGSADQTAKLWDV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+  + P  +V  +       +G   D  AV TTD+           +I ++ 
Sbjct  82   QTGRELFTFRFDAPARSVEFA-------IG---DGLAVITTDNFMENVPTAQVKRIAEDP  131

Query  323  ----------IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      I G+KG    IN   + P  ++  + GED  +R+
Sbjct  132  DDQSEESLLVITGIKGR---INRAVWGPLNRTIITAGEDATIRI  172



>ref|XP_007215753.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
 gb|EMJ16952.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
Length=295

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 136/168 (81%), Gaps = 25/168 (15%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TIIS GED+V+RIWD+ETGKLLKE+D+E GHKK ITSLAKS+DGSHF+TGSLDKSA+LW
Sbjct  153  RTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKTITSLAKSVDGSHFLTGSLDKSARLW  212

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAV MSPLLD +VLGGGQDASAVTTTDHRAGKFEAKFYD+ L+
Sbjct  213  DIRTLTLIKTYVTERPVNAVAMSPLLDDVVLGGGQDASAVTTTDHRAGKFEAKFYDRFLK  272

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
                                      SGGEDGYVRLHHFD+DYF+IKI
Sbjct  273  -------------------------WSGGEDGYVRLHHFDSDYFNIKI  295



>ref|XP_002500789.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62047.1| predicted protein [Micromonas sp. RCC299]
Length=317

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 137/167 (82%), Gaps = 3/167 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI++GGED V+R+WD ETGK++ E++    HKK I  L+ S+D +HFI+ SLDK+AKL+
Sbjct  154  RTILTGGEDGVIRLWDVETGKIVHEAND---HKKQIQHLSLSVDKTHFISASLDKTAKLF  210

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  LKTY  +RPVNA  +SP+LDHI+LGGGQDA AVTTT  +AGKF++K + KI +
Sbjct  211  DSETLECLKTYAADRPVNAAILSPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYE  270

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            EEIGG++GHFGPINALA++PDG+SF SGGEDGYVR+HHFD DYF IK
Sbjct  271  EEIGGIRGHFGPINALAWHPDGRSFTSGGEDGYVRIHHFDNDYFRIK  317


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (46%), Gaps = 9/129 (7%)
 Frame = -3

Query  599  GHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIV  420
            GH   + +   + D    +TGS D + K+WD  T T   T+  E+PV AV +S    H+V
Sbjct  45   GHNGAVWTCDVTEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMV  104

Query  419  LGGGQ---DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFAS  249
            +         +A+   D  A + E     KI       + G  G IN   + P  ++  +
Sbjct  105  ISSDPFMGVPAALHIVDVAANREEQTNEIKI------SMSGPEGRINRALWGPLNRTILT  158

Query  248  GGEDGYVRL  222
            GGEDG +RL
Sbjct  159  GGEDGVIRL  167



>ref|XP_001418365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96658.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=323

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KT+++GGED ++R WD ETG +LK S +   H K I  L  S DGSHFI+ SLDK+AK++
Sbjct  160  KTVVTGGEDGIIRSWDVETGDVLKMSQE---HSKQIQHLVMSDDGSHFISASLDKTAKVF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  LKTY  +RPVNA  +SP+ DHIVLGGGQDA AVTTT  +AGKF++K Y KI +
Sbjct  217  DSETLECLKTYSADRPVNAAILSPIRDHIVLGGGQDAMAVTTTSSKAGKFDSKIYHKIFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHI  192
            EEIGG++GHFGPINALAFNPDG+SF SGGEDGYVR+H  D  YF I
Sbjct  277  EEIGGIRGHFGPINALAFNPDGRSFTSGGEDGYVRIHPLDNSYFEI  322


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 62/133 (47%), Gaps = 18/133 (14%)
 Frame = -3

Query  599  GHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIV  420
            GH   + +   S D S  +TGS D +AKLWD +T     T+  ++PV AV ++       
Sbjct  50   GHNGAVWTCDVSDDSSTLVTGSADTTAKLWDTKTGECYFTFEFDQPVRAVALN-------  102

Query  419  LGGGQDASAVTTTDHRAGKFEA------KFYDKILQ--EEIGGVKGHFGPINALAFNPDG  264
             GG Q A    TTD   G   A         D+  Q  E +  ++G  G +  + + P  
Sbjct  103  AGGTQCA---ITTDPFMGVPSAIHIVNVNLGDRAAQRGEVVKRIEGPQGRVTRVMWGPLN  159

Query  263  KSFASGGEDGYVR  225
            K+  +GGEDG +R
Sbjct  160  KTVVTGGEDGIIR  172



>ref|XP_003079673.1| TGF-beta receptor-interacting protein 1 (ISS) [Ostreococcus tauri]
 emb|CAL53318.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=323

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+I+GGED ++R WDAE G++LK S +   H K I  L+ S DGSHFI+ SLDK+AK++
Sbjct  160  RTVITGGEDGIIRSWDAENGEVLKISQE---HSKQIQHLSMSEDGSHFISASLDKTAKVF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  +KTY  +RPVNA  +SP+ DHIVLGGGQDA +VTTT  +AGKF++K Y KI +
Sbjct  217  DSETLECMKTYSADRPVNAAILSPIRDHIVLGGGQDAMSVTTTSSKAGKFDSKIYHKIFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHI  192
            EEIGG++GHFGPINALAFNPDG+SF SGGEDGYVR+H  D  YF I
Sbjct  277  EEIGGIRGHFGPINALAFNPDGRSFTSGGEDGYVRIHPLDNSYFEI  322


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 69/150 (46%), Gaps = 21/150 (14%)
 Frame = -3

Query  650  IWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVT  471
            +W  +TG+ +       GH   + +   S D S  +TGS D +AKLWD +T     T+  
Sbjct  36   LWYGDTGERVG---TYVGHNGAVWTCDVSDDSSTLLTGSADTTAKLWDAKTGECYFTFTF  92

Query  470  ERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE--------IGG  315
            ++PV AV ++         GG+ A+   TTD   G   A    +I  E+        I  
Sbjct  93   DQPVRAVALA--------HGGKRAA--ITTDPFMGVPSAIHIVEIDLEDRSRQTARVIRR  142

Query  314  VKGHFGPINALAFNPDGKSFASGGEDGYVR  225
            + G  G +  + + P  ++  +GGEDG +R
Sbjct  143  IDGPQGRVTRVLWGPLNRTVITGGEDGIIR  172



>ref|XP_003059370.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56502.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI++GGED V+R WD ETGK+  E+     HKK I  L  S D +HF++ SLDK+AKL+
Sbjct  171  ETILTGGEDGVIRAWDVETGKIKLEA---RDHKKQIQHLCLSEDKTHFVSASLDKTAKLF  227

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  LKTYV +RPVNA  +SP+LDHIVLGGGQDA AVTTT  +AGKF++K Y K+ +
Sbjct  228  DSETLECLKTYVADRPVNAAIISPILDHIVLGGGQDAMAVTTTSSKAGKFDSKIYFKVYE  287

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            EEIG ++GHFGP+NALAFNPDG+SF +GGEDGY R+HH D DYF I+
Sbjct  288  EEIGSIRGHFGPVNALAFNPDGRSFTTGGEDGYSRVHHLDNDYFRIR  334



>gb|KCW69348.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=280

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTIIS GED+V+RIWD+ETGKLL+ESD+E+GHKK +TSL KS+DGSHF+TGS DKSAKLW
Sbjct  159  KTIISAGEDAVIRIWDSETGKLLRESDKETGHKKAVTSLMKSVDGSHFVTGSQDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQDASAVT TDHRAGKFEAKF+DK L+
Sbjct  219  DIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTMTDHRAGKFEAKFFDKFLK  278


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   +     S D    ITGS D +AKLW +
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDVSRDSMRLITGSADTTAKLWSV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  330
            +  T L T+  + P  +V  S       +G   D  AV TTD       A    +I +  
Sbjct  82   QNGTQLFTFNFDSPARSVDFS-------IG---DKLAVITTDPFMELPSAIHVKRIARDP  131

Query  329  -----EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                 E +  ++GH G I    + P  K+  S GED  +R+
Sbjct  132  ADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRI  172



>ref|XP_007512918.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16476.1| predicted protein [Bathycoccus prasinos]
Length=327

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHK-KGITSLAKSIDGSHFITGSLDKSAKL  513
            +T ++ GED VLR+WD ETGK+L E+     HK K I  L  S D +H IT SLDK+AK+
Sbjct  162  ETFLTAGEDGVLRVWDVETGKVLHEA--RDAHKGKPIQHLELSADKTHAITASLDKTAKI  219

Query  512  WDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKIL  333
            +D + L LLKTYV +RPVNA  +SP+ +HI+LGGGQDA AVTTT  +AGKF++K Y KI 
Sbjct  220  FDAQNLELLKTYVADRPVNAAIISPIREHIILGGGQDAMAVTTTSSKAGKFDSKIYHKIF  279

Query  332  QEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            +EEIGG++GHFGPINALAF PDGKSF SGGEDGY R+HH D  YF IK
Sbjct  280  EEEIGGIRGHFGPINALAFCPDGKSFTSGGEDGYARIHHLDNTYFDIK  327



>gb|EMT33770.1| hypothetical protein F775_29343 [Aegilops tauschii]
Length=406

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  635  TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVN  456
            TGKLLKESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVN
Sbjct  276  TGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVN  335

Query  455  AVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  276
            AV +SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAF
Sbjct  336  AVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAF  395

Query  275  NPDGKS  258
            NPDG+S
Sbjct  396  NPDGRS  401



>gb|KJB56102.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=318

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLW
Sbjct  159  RTIVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLW  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  336
            D RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+
Sbjct  219  DTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKV  276


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            + S  +D    +W A+ G+ L       GH   + S   S D    ITGS D++ KLW++
Sbjct  25   LFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDVSRDSMRLITGSADQTVKLWNV  81

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +T   L T+    P  +V  S       +G   D  AV TTD       A    +I ++ 
Sbjct  82   QTGAQLYTFNFGSPARSVDFS-------VG---DKLAVITTDPFMELTSAIHVKRIARDP  131

Query  323  IGG-------VKGHFGPINALAFNPDGKSFASGGEDGYVRL  222
                      +KG  G IN   + P  ++  S GED  +R+
Sbjct  132  TEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRI  172



>ref|XP_011401093.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
 gb|KFM28081.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
Length=324

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+I+  ED  +R WD ETGK L     E  H+K I  L  S+DG+HFIT S+D S+KL 
Sbjct  159  RTLITASEDGFVRRWDVETGKELAA---EHVHEKNIQDLQMSVDGTHFITASVDCSSKLV  215

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D +TL +LKTY +  PVN+  +SP+ DH++LGGGQDAS VTTT  RAG+FE++F+ K+ Q
Sbjct  216  DTQTLAVLKTYQSNVPVNSAALSPVYDHVILGGGQDASQVTTTSSRAGRFESRFFHKVFQ  275

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE G V+GHFGPINA++F+PDG  FASGGE+GYVRLH FDADYF  K 
Sbjct  276  EEFGNVRGHFGPINAVSFSPDGTGFASGGEEGYVRLHKFDADYFTTKF  323



>gb|KDD75202.1| hypothetical protein H632_c812p0 [Helicosporidium sp. ATCC 50920]
Length=318

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+IS  +D V+R WD ETGK+L E+   + H++ I  L  S DG+HF+T S D+SAKL 
Sbjct  153  RTLISASDDGVVRRWDVETGKILVEN---TIHERNIQDLQMSTDGTHFVTASADRSAKLV  209

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL ++KTY +  PVN+  +SPL DH+++GGGQ+AS VTTT  RAGKFE++ + K+  
Sbjct  210  DAETLEVMKTYQSTVPVNSAAISPLYDHVLIGGGQEASQVTTTAGRAGKFESRIFHKVFA  269

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE   ++GHFGPINA+AF PDG  F SGGE+GY+RLHHFDADYF  K 
Sbjct  270  EEFANIRGHFGPINAVAFMPDGSGFVSGGEEGYIRLHHFDADYFTTKF  317



>ref|XP_006395438.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32724.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=289

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TI+SGGED+V+R+WD ETGKL+KES++E GHKK ITSL K+ D SHFITGSLDK+AKLW
Sbjct  161  ETIVSGGEDAVIRVWDTETGKLIKESNEEEGHKKTITSLCKAADDSHFITGSLDKTAKLW  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  336
            D+RTLTL+KTY T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDK+
Sbjct  221  DMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKV  278



>gb|KIZ03352.1| Eukaryotic translation initiation factor 3 subunit I [Monoraphidium 
neglectum]
Length=329

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K +++  +   +R WDAETG+LL+E+     H+  I  +  S DGS+ +T SLDK+AKL 
Sbjct  164  KVLLTSHDGGFVRRWDAETGELLEEAQV---HEDAIQDMQFSQDGSYVVTASLDKTAKLV  220

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+ TL +LKTY T R V +  +SPL+DH++ GGGQDAS VTTT  +AG FEA+F+ KI Q
Sbjct  221  DVCTLEVLKTYKTGRFVQSAAISPLMDHVLAGGGQDASQVTTTAAKAGGFEARFFHKIYQ  280

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            EE G V+GHFGPIN++AF PDG+SFA+GGEDGYVR+HHFD +YF  K
Sbjct  281  EEFGNVRGHFGPINSVAFAPDGRSFATGGEDGYVRIHHFDMEYFSAK  327



>ref|XP_008549768.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + IWD  TGK L   + + GHK  I  +  S DG+ FIT S D +AKL+
Sbjct  160  ETIITGHEDGEINIWDVRTGKKL---NSQKGHKSQINDMQASKDGTMFITASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+A+FY  + +
Sbjct  217  DSESLMHLKTYKTERPVNSATISPIYDHVVLGGGQDAMDVTTTSTRQGKFDARFYHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+SF+SGGEDGYVR++ FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSFSSGGEDGYVRINTFDQSYF  320



>ref|XP_008553489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + IWD  TGK L   + + GHK  I  +  S DG+ FIT S D +AKL+
Sbjct  160  ETIITGHEDGEINIWDVSTGKKL---NSQKGHKSLINDMQPSKDGTMFITASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+ T+SP+ DH++LGGGQDA  VTTT  R GKF+A+FY  + +
Sbjct  217  DSESLMHLKTYQTERPVNSATISPIFDHVILGGGQDAMDVTTTSARQGKFDARFYHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+PDG+SF SGGEDG++R++ FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPDGRSFCSGGEDGFIRINPFDKSYF  320



>ref|XP_001693266.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP03292.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=324

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            + +I+  +  +LR WD ETG LL+E   +  H+  I  +  S D +H IT SLDK+A+L 
Sbjct  159  RKLITSHDGGILRRWDVETGALLQE---QQVHEDAIQDMQMSPDETHVITASLDKTARLI  215

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+ T  ++KTY T R V +  +SPL DH+V+GGGQDAS VTTT  +AG FEA+F+ KI Q
Sbjct  216  DVDTFEVMKTYKTGRFVQSAAISPLFDHVVMGGGQDASQVTTTAAQAGGFEARFFHKIFQ  275

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE G V+GHFGPIN +AF+P GKSF +GGEDGYVRLHH D DYF  K 
Sbjct  276  EEFGRVRGHFGPINTVAFHPSGKSFTTGGEDGYVRLHHMDMDYFTTKF  323



>ref|XP_011314062.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fopius arisanus]
Length=326

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + IWD  TGK+L  +    GH+  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEINIWDVRTGKILTSA---KGHRSQINDMQFNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D   L  LKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+A+F+  + +
Sbjct  217  DSEQLVHLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDARFFHMVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+GKSF+SGGEDGYVR++ FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGKSFSSGGEDGYVRINTFDQSYF  320



>ref|NP_001040433.1| eukaryotic translation initiation factor 3 subunit I [Bombyx 
mori]
 sp|Q1HPW4.1|EIF3I_BOMMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Bombyx mori]
 gb|ABF51377.1| eukaryotic translation initiation factor 3 subunit 2 beta [Bombyx 
mori]
Length=329

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G E   L  WD  TGK +    +   H   IT +  S DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEAGDLIQWDLRTGKKIHSVKE---HTHQITDMQLSRDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GKF+A+F+  + +
Sbjct  217  DTNSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE G VKGHFGPIN+LAF+PDGKS+ASGGEDGYVR+H+FD  YF
Sbjct  277  EEFGRVKGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYF  320



>ref|XP_011337589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cerapachys biroi]
 gb|EZA54998.1| Eukaryotic translation initiation factor 3 subunit I [Cerapachys 
biroi]
Length=326

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEIKLWDVRTGKKLTSV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSETLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_005647023.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22479.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +IS GED  +R WD ETGK+ +E+     H+K I  +    DG+H +T S+DK  KL D 
Sbjct  161  LISAGEDGFVRRWDVETGKVKEEAKL---HEKEIRDMQLYKDGTHMVTASVDKLVKLVDT  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            +TL +LK + T+RP NA  +SP+ D +++GGGQDA+ VTTT  RAG F+++F  KI  EE
Sbjct  218  QTLEVLKFFNTDRPANAAALSPVFDQVLIGGGQDAADVTTTSDRAGGFQSRFIHKIFMEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            IG V+GHFGPINA+AF PDG+SFA+GGEDGY+R++HFD DY 
Sbjct  278  IGSVRGHFGPINAVAFRPDGRSFATGGEDGYIRINHFDNDYL  319



>ref|XP_011254946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camponotus floridanus]
Length=326

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEIKLWDVRTGKKLSSV---KGHKSQINDMQCNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_011160448.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Solenopsis invicta]
Length=326

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  L++WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGELKLWDVRTGKKLSSV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSESLVLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  320



>gb|EFZ22632.1| hypothetical protein SINV_00160 [Solenopsis invicta]
Length=326

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  L++WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGELKLWDVRTGKKLSSV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSESLVLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  320



>gb|EGI64611.1| Eukaryotic translation initiation factor 3 subunit I [Acromyrmex 
echinatior]
Length=322

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  156  ETIITGHEDGEIKLWDVRTGKKLSSV---KGHKSQINDMQCNKDGTMFVTASKDHTAKLF  212

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  213  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  272

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  273  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  316



>ref|XP_011055583.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Acromyrmex echinatior]
Length=326

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEIKLWDVRTGKKLSSV---KGHKSQINDMQCNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  320



>gb|KJE92223.1| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=329

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KT+I+G +D  + +WD ETGK++K S +   H+K I S+  + D + F++ S D +AKL+
Sbjct  163  KTLITGHDDGTINVWDVETGKIIKSSQE---HEKYINSIQLNGDQTSFVSASKDSTAKLF  219

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL +LKTY T   VN+  +SPL  H+VLGGGQ+A  VTTT  R GKFE +F+  I +
Sbjct  220  DTETLEVLKTYKTPTNVNSAAISPLRPHVVLGGGQEAREVTTTSTRVGKFEVRFFHLIFE  279

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIG VKGHFGPIN +AF+P GKSFASGGEDG++R+H FD DY+  + 
Sbjct  280  EEIGRVKGHFGPINTVAFHPSGKSFASGGEDGFIRVHAFDPDYYEFEF  327



>ref|XP_004364074.2| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=325

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KT+I+G +D  + +WD ETGK++K S +   H+K I S+  + D + F++ S D +AKL+
Sbjct  159  KTLITGHDDGTINVWDVETGKIIKSSQE---HEKYINSIQLNGDQTSFVSASKDSTAKLF  215

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL +LKTY T   VN+  +SPL  H+VLGGGQ+A  VTTT  R GKFE +F+  I +
Sbjct  216  DTETLEVLKTYKTPTNVNSAAISPLRPHVVLGGGQEAREVTTTSTRVGKFEVRFFHLIFE  275

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EEIG VKGHFGPIN +AF+P GKSFASGGEDG++R+H FD DY+  + 
Sbjct  276  EEIGRVKGHFGPINTVAFHPSGKSFASGGEDGFIRVHAFDPDYYEFEF  323



>ref|XP_002957235.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
 gb|EFJ41733.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
Length=324

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 117/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            + +I+  +  +LR WD ETG++L+E      H+  I  +  S D +H IT SLDK+A+L 
Sbjct  159  RKVITSHDYGILRRWDVETGQMLQEVQV---HEDAIQDMQMSPDETHVITASLDKTARLI  215

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DI T T+LK Y T R V +  +SPL DH+++GGGQDAS VTTT   AG FEA+F+ K+ Q
Sbjct  216  DIETFTVLKVYKTGRFVQSAAISPLFDHVLMGGGQDASQVTTTAAGAGGFEARFFHKVFQ  275

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE G V+GHFGP+N +AF+P G+SF +GGEDGYVRLHH D DYF  K 
Sbjct  276  EEFGRVRGHFGPVNTVAFHPSGRSFTTGGEDGYVRLHHMDLDYFTTKF  323



>gb|EHJ63876.1| eukaryotic translation initiation factor 3 subunit I [Danaus 
plexippus]
Length=325

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G E   L  WD  TGK +    +   H   I  +  S DG+ FIT S D++AKL+
Sbjct  156  ETIITGHEAGDLIQWDLRTGKKVHSVKE---HTHQINDMQLSRDGTMFITASKDQTAKLF  212

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GKF+A+F+  + +
Sbjct  213  DTSSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFE  272

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE G VKGHFGPIN+LAF+PDGKSFASGGEDGY+R+  FD  YF
Sbjct  273  EEFGRVKGHFGPINSLAFHPDGKSFASGGEDGYIRVQSFDQSYF  316



>ref|XP_002021487.1| GL26537 [Drosophila persimilis]
 ref|XP_001355946.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
 sp|B4GSH1.1|EIF3I_DROPE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
persimilis]
 sp|Q29L19.2|EIF3I_DROPS RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
pseudoobscura pseudoobscura]
 gb|EDW25330.1| GL26537 [Drosophila persimilis]
 gb|EAL33005.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
Length=326

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ F+T S D +AKL+
Sbjct  160  ETIITGHDNGNIAIWDVRKGQ--KVVDSGSDHAAGINDMQLSKDGTMFVTASRDTTAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  322



>dbj|BAM18089.1| eukaryotic translation initiation factor 3 subunit I [Papilio 
xuthus]
Length=329

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G E   L  WD  TGK +  S +E  H+  I  +  S DG+ FIT S D++AKL+
Sbjct  160  ETIITGHEAGDLIQWDLRTGKKV-HSIKEHNHQ--INDMQLSRDGTMFITASKDQTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GKF+A+F+  + +
Sbjct  217  DTSSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE G VKGHFGPIN+LAF+PDGKS+ASGGEDGYVR+  FD  YF
Sbjct  277  EEFGRVKGHFGPINSLAFHPDGKSYASGGEDGYVRVQSFDQSYF  320



>ref|XP_002001737.1| GI15375 [Drosophila mojavensis]
 sp|B4KGX9.1|EIF3I_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
mojavensis]
 gb|EDW11179.1| GI15375 [Drosophila mojavensis]
Length=322

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ F+T S D +AKL+
Sbjct  156  ETIITGHDNGNIAIWDIRKGQ--KVVDSGSDHTAGINDMQLSKDGTMFVTASKDTTAKLF  213

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  214  DSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  273

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  274  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  318



>ref|XP_392780.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Apis mellifera]
 ref|XP_003693606.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Apis florea]
 ref|XP_006570172.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Apis mellifera]
 ref|XP_006612554.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Apis dorsata]
 ref|XP_006612555.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Apis dorsata]
Length=326

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  T K L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEITLWDVRTRKKLTSV---KGHKSQINDMQFNKDGTMFVTASKDNTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+SF++GGEDGYVR++ FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSYF  320



>sp|B3MVL6.2|EIF3I_DROAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
ananassae]
Length=322

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ F+T S D +AKL+
Sbjct  156  ETIITGHDNGNIAIWDIRKGQ--KVVDSGSDHTAGINDMQLSKDGTMFVTASKDTTAKLF  213

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  214  DSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  273

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  274  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  318



>ref|XP_001965147.1| GF23646 [Drosophila ananassae]
 gb|EDV33281.1| GF23646 [Drosophila ananassae]
Length=332

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ F+T S D +AKL+
Sbjct  166  ETIITGHDNGNIAIWDIRKGQ--KVVDSGSDHTAGINDMQLSKDGTMFVTASKDTTAKLF  223

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  224  DSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  283

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  284  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  328



>ref|XP_002051937.1| GJ17275 [Drosophila virilis]
 gb|EDW64092.1| GJ17275, partial [Drosophila virilis]
Length=325

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  159  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHTAGINDMQLSKDGTMFVTASRDTTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  217  DSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  277  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQSFDSTYFE  321



>gb|EFX80147.1| hypothetical protein DAPPUDRAFT_304176 [Daphnia pulex]
Length=327

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            + +ISG ++  L  WD  TGK   +++  S H K I  +  S DG+  IT S D +AKL+
Sbjct  161  EVVISGHDNGDLAQWDLRTGK---KNNLVSEHAKSINDMQLSKDGALLITASKDCTAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            +  TL  LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  R GKF+A+F+  + +
Sbjct  218  NAETLECLKTYKTERPVNSAAISPIMDHVVLGGGQDAMDVTTTSTRVGKFDARFFHLVFE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE   VKGHFGPIN+LAF+PDGK++ASGGEDGYVRL+ FD  YF  K 
Sbjct  278  EEFARVKGHFGPINSLAFHPDGKTYASGGEDGYVRLNQFDQSYFDFKF  325



>gb|EFN69223.1| Eukaryotic translation initiation factor 3 subunit I [Camponotus 
floridanus]
Length=322

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  +++WD    K L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  156  ETIITGHEDGEIKLWDVRARKKLSSV---KGHKSQINDMQCNKDGTMFVTASKDHTAKLF  212

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  213  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  272

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  273  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  316



>sp|B4LUA5.2|EIF3I_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
virilis]
Length=322

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  156  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHTAGINDMQLSKDGTMFVTASRDTTAKLF  213

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  214  DSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  273

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  274  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQSFDSTYFE  318



>ref|XP_011145247.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
 ref|XP_011145248.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
Length=326

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGDITLWDVRTGKKLSNV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKT+ TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSDSLMLLKTFKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  320


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 80/170 (47%), Gaps = 27/170 (16%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITG-SLDKSAKLW-  510
            ++SG  D+ LR+WD +TGK + + D  S  +      + S + + F T  +L    +++ 
Sbjct  67   LLSGSGDNSLRVWDCQTGKEIGQLDTNSSVR--TCGFSYSANLAVFSTDKALGHQCEMFI  124

Query  509  -DIRTL--TLLKTYVTER-PVNAVTMSPL----LDHIVLGGGQDASAVTTTDHRAGKFEA  354
             DIR +  TL +     R  VN   +S +    LD  ++ G +D   +T  D R GK   
Sbjct  125  MDIRNVDSTLSQDDAISRISVNGPRISAILWGALDETIITGHEDGD-ITLWDVRTGK---  180

Query  353  KFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDAD  204
                     ++  VKGH   IN + FN DG  F +  +D   +L  FD+D
Sbjct  181  ---------KLSNVKGHKSQINDMQFNKDGTMFVTASKDHTAKL--FDSD  219



>ref|XP_005707349.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
 gb|EME30829.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
Length=324

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KT+IS GED  +R WD ETG+    ++  + H+K I  L  S  G   IT S D SAK+ 
Sbjct  159  KTLISTGEDGTVRKWDIETGR---NTETVTIHQKPINDLQLSKSGGQLITASSDFSAKIL  215

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D R+L +LKT++T+RPVN+  +SP+L H++LGGGQ+AS VTTT  RAG+FEA+ +  I +
Sbjct  216  DFRSLKVLKTFLTDRPVNSAAISPILPHVLLGGGQEASQVTTTGDRAGRFEARLFHLIYE  275

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            +EIG ++GHFGPIN +AF+PDG  FASG E+G++RLH+FD +YF 
Sbjct  276  DEIGIIRGHFGPINTVAFSPDGLQFASGAEEGFIRLHNFDEEYFQ  320



>ref|XP_003707661.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Megachile rotundata]
Length=326

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  T K L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEITLWDVRTRKKLSSV---KGHKSQINDMQFNKDGTMFVTASKDNTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSDSLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+SF++GGEDGYVR++ FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSYF  320



>ref|XP_002078185.1| GD22675 [Drosophila simulans]
 sp|B4Q354.1|EIF3I_DROSI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
simulans]
 gb|EDX03770.1| GD22675 [Drosophila simulans]
Length=326

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  160  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASRDTTAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_011180318.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera cucurbitae]
Length=326

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G   +E +  + H  GI  +  + DG+ F+T S D SAKL+
Sbjct  160  ETIITGHDNGQISIWDIRKGG--REINSVNDHTAGINDMQMNKDGTMFVTASKDTSAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYF  321



>ref|XP_011198986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera dorsalis]
Length=326

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G   +E +  + H  GI  +  + DG+ F+T S D SAKL+
Sbjct  160  ETIITGHDNGQISIWDIRKGG--REINSVNDHTAGINDMQMNKDGTMFVTASKDTSAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYF  321



>emb|CCA18540.1| eukaryotic translation initiation factor 3 subunit p [Albugo 
laibachii Nc14]
Length=331

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K+I++ G D  L+++D ++GK+LKE    SG    +T+++ +   +  IT S D +AKL 
Sbjct  161  KSILASGGDGGLKVFDPKSGKVLKECKIHSG---DVTNISFNKLKTLAITSSKDNTAKLL  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+ TL +LKTY T+RPVN+  MSP+ +H+VLGGGQ+A +VTTT  + GKFEA+F+  + Q
Sbjct  218  DVETLDVLKTYETDRPVNSAAMSPIREHVVLGGGQEAMSVTTTSGQVGKFEARFFHMVFQ  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   VKGHFGPIN +AF+PDGKS+ SG EDGYVRLHHFD DYF
Sbjct  278  EEFARVKGHFGPINTIAFHPDGKSYVSGAEDGYVRLHHFDEDYF  321



>ref|NP_523478.1| Trip1 [Drosophila melanogaster]
 ref|XP_002037884.1| GM18055 [Drosophila sechellia]
 sp|O02195.1|EIF3I_DROME RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog; AltName: 
Full=eIF-3-beta [Drosophila melanogaster]
 sp|B4I195.1|EIF3I_DROSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
sechellia]
 gb|AAB53431.1| TRIP-1 homolog [Drosophila melanogaster]
 gb|AAF52183.1| Trip1 [Drosophila melanogaster]
 gb|AAM49896.1| LD24026p [Drosophila melanogaster]
 gb|EDW54302.1| GM18055 [Drosophila sechellia]
 gb|ACL84827.1| Trip1-PA, partial [synthetic construct]
 gb|ACL89803.1| Trip1-PA [synthetic construct]
Length=326

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  160  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_004531427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Ceratitis capitata]
Length=326

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G   +E +  + H  GI  +  + DG+ F+T S D SAKL+
Sbjct  160  ETIITGHDNGQISIWDIRKGG--REINSVNDHTAGINDMQMNKDGTMFVTASKDTSAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_001968738.1| GG24335 [Drosophila erecta]
 sp|B3N4C7.1|EIF3I_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
erecta]
 gb|EDV57797.1| GG24335 [Drosophila erecta]
Length=326

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  160  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_001989068.1| GH10244 [Drosophila grimshawi]
 sp|B4JB43.1|EIF3I_DROGR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
grimshawi]
 gb|EDW03935.1| GH10244 [Drosophila grimshawi]
Length=326

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 117/165 (71%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D    H  GI  +  S DG+ F+T S D +AKL+
Sbjct  160  ETIITGHDNGNIAIWDVRKGQ--KVVDSGVDHAAGINDMQLSKDGTMFVTASKDNTAKLF  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SP+ DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  218  DAESLMCLKTYKTERPVNSAAISPIFDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  278  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQSFDSTYFE  322



>gb|ETN60290.1| eukaryotic translation initiation factor 3 subunit [Anopheles 
darlingi]
Length=327

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+I+G E+  +RIWD    + +KE +  + H   IT +  S DG+ FI+ S D +AKL+
Sbjct  162  ETVITGHENGSIRIWDL---RAVKELNSVNDHTANITDMQMSHDGTMFISSSKDTTAKLF  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SPL +H+ LGGGQDA  VTTT  +AGKF+++F+  + +
Sbjct  219  DSESLVCLKTYKTERPVNSAAISPLYEHVALGGGQDAMEVTTTSTQAGKFDSRFFHLVYE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE   VKGHFGPIN+LAF+PDGKSF +GGEDG+VR+  FD+ YF  ++
Sbjct  279  EEFARVKGHFGPINSLAFHPDGKSFTTGGEDGFVRVQVFDSSYFEFQL  326



>ref|XP_002088703.1| Trip1 [Drosophila yakuba]
 gb|EDW88415.1| Trip1 [Drosophila yakuba]
Length=325

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  159  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LK+Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  217  DSESLMCLKSYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  277  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  321



>ref|XP_316636.4| AGAP006607-PA [Anopheles gambiae str. PEST]
 sp|Q7PP77.4|EIF3I_ANOGA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Anopheles gambiae]
 gb|EAA10908.5| AGAP006607-PA [Anopheles gambiae str. PEST]
Length=327

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+I+G E+  LRIWD    + +KE +  + H   IT +  S DG+ F++ S D SAKL+
Sbjct  162  ETVITGHENGSLRIWDL---RAVKELNSVNDHTASITDMQMSSDGTMFVSSSKDCSAKLF  218

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKT+ TERPVN+  +SPL +H+ LGGGQDA  VTTT  +AGKF+++F+  + +
Sbjct  219  DSDSLMCLKTFKTERPVNSACISPLFEHVALGGGQDAMEVTTTSTQAGKFDSRFFHLVYE  278

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   VKGHFGPIN++AF+PDGKSFA+GGEDG+VRL  FD+ Y+
Sbjct  279  EEFARVKGHFGPINSMAFHPDGKSFATGGEDGFVRLQVFDSSYY  322



>sp|B4NW98.2|EIF3I_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
yakuba]
Length=322

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+
Sbjct  156  ETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLF  213

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LK+Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  214  DSESLMCLKSYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  273

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  274  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  318



>ref|XP_003396808.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Bombus terrestris]
Length=301

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  T K +        HK  I  +  + DG+ F+T S D +AKL+
Sbjct  135  ETIITGHEDGEITLWDVRTRKKMTSV---RSHKSQINDMQFNKDGTMFVTASKDNTAKLF  191

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  192  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFE  251

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+SF++GGEDGYVR++ FD  YF
Sbjct  252  EEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSYF  295



>gb|KDR14214.1| hypothetical protein L798_11754 [Zootermopsis nevadensis]
Length=338

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K++I+G E+  L  WD   GK +  ++  SG    I  +  S  G  FIT S D +A+L+
Sbjct  171  KSVITGHENGELTQWDLRMGKTMNSTNDHSG---SINDMQMSKHGIMFITASKDYTARLF  227

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL+ LKTY TERPVN+  +SP+ DH+V+GGGQDA  VTTT  R GKF+++F+  + +
Sbjct  228  DTDTLSCLKTYKTERPVNSAAISPIYDHVVVGGGQDAMDVTTTSTRIGKFDSRFFHLVFE  287

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            EE G VKGHFGPIN++AF+PDGKS++SGGEDGY+R+H+FD+ YF    
Sbjct  288  EEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYIRIHNFDSAYFEFNF  335



>ref|XP_002066637.1| GK24461 [Drosophila willistoni]
 sp|B4N0L0.1|EIF3I_DROWI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
willistoni]
 gb|EDW77623.1| GK24461 [Drosophila willistoni]
Length=322

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+  K  D  + H   I  +  S DG+ F+T S D +AKL+
Sbjct  156  ETIITGHDNGNIAIWDVRKGQ--KVVDSGTDHTGVINDMQLSKDGTMFVTASKDATAKLF  213

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  214  DSETLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  273

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  195
            EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  274  EEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQSFDSTYFE  318



>ref|XP_003487069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Bombus impatiens]
Length=326

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  T K +        HK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGEITLWDVRTRKKMTSV---RSHKSQINDMQFNKDGTMFVTASKDNTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+SF++GGEDGYVR++ FD  YF
Sbjct  277  EEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSYF  320



>ref|XP_005535289.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79003.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
Length=327

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            ++S  ED  +R WD ETGK   E D+   HKK IT +  S D   F+TGS D +A LWD 
Sbjct  163  MLSVSEDGTVRKWDVETGK---EVDRAKRHKKAITDIKFSKDHQMFLTGSADGTAVLWDT  219

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
              +  ++++V +RP+NAV +SPL+ H V+GGGQ+AS VTTT  +AGKF A F   I  EE
Sbjct  220  HAMQEIRSFVLDRPLNAVDLSPLMPHAVVGGGQEASQVTTTAGKAGKFAATFLHLIYGEE  279

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            I  VKGHFGPIN L+F PDG+ FASGGEDGYVRLHHFD +Y+
Sbjct  280  IFSVKGHFGPINCLSFTPDGRGFASGGEDGYVRLHHFDEEYY  321



>gb|KFO76878.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Cuculus canorus]
Length=263

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  99   IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  155

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  156  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  215

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  216  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  261



>ref|XP_008188704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like, partial [Acyrthosiphon pisum]
Length=191

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = -3

Query  686  TIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWD  507
            TII+G ED  +  WD  TGK ++       H+  I  + K+  G+ F+T S DK++KL+D
Sbjct  26   TIITGHEDGAITQWDLRTGKSIETVKD---HQGSINDMQKNRQGTMFVTASKDKTSKLFD  82

Query  506  IRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  327
            +  L++ K YVTERPVN+ ++SP+ DH+VLGGGQDA  VTTT  +AGKF+A+F+  I +E
Sbjct  83   VDDLSVHKVYVTERPVNSASLSPVYDHVVLGGGQDAMDVTTTAAQAGKFDARFFHVIFEE  142

Query  326  EIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADY  201
            E   VKGHFGPIN+LAF+PDG+SF++GGEDG++R+  FD  Y
Sbjct  143  EFARVKGHFGPINSLAFHPDGESFSTGGEDGFIRVQSFDPSY  184



>gb|ETO77218.1| hypothetical protein F444_07544 [Phytophthora parasitica P1976]
Length=327

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K I++ G D  ++++D  TG+LL+  D  +G    IT++A +   +  IT S D +AKL 
Sbjct  161  KAIMTTGGDGTIKLFDPTTGQLLESHDIHTGE---ITNVAFNKTKTLAITSSKDNTAKLL  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            DI TL +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + Q
Sbjct  218  DIETLKVLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQ  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHI  192
            EE G VKGHFGPIN +AF+P+GKS+ASG EDGYVRLHHFD DY  +
Sbjct  278  EEFGRVKGHFGPINTIAFHPNGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_009560176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Cuculus canorus]
Length=266

 Score =   180 bits (457),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  102  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  158

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  159  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  218

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  219  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  264



>gb|ABK92672.1| unknown [Populus trichocarpa]
Length=87

 Score =   174 bits (441),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  446  MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  267
            MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD
Sbjct  1    MSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  60

Query  266  GKSFASGGEDGYVRLHHFDADYFHIKI  186
            GKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  61   GKSFSSGGEDGYVRLHHFDPDYFNIKI  87



>gb|AEE62555.1| unknown [Dendroctonus ponderosae]
 gb|ENN81757.1| hypothetical protein YQE_01850, partial [Dendroctonus ponderosae]
 gb|ERL89282.1| hypothetical protein D910_06655 [Dendroctonus ponderosae]
Length=326

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+ISG E+  +  WD +TGK L    +   H + I  +  + D + FIT S D +AKL+
Sbjct  160  ETLISGHENGEIIQWDLKTGKKLNSITE---HSQLINDMQWNKDCTMFITASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D + L LLKTY TERPVN+  +SP+ +H+VLGGGQ+A  VTTT  RAGKF+++F+  + +
Sbjct  217  DAQKLMLLKTYKTERPVNSAAISPIAEHVVLGGGQEAMEVTTTSTRAGKFDSRFFHLVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE G VKGHFGPIN++AF+PDGKS+ASGGEDGYVR+H+ D+ YF
Sbjct  277  EEFGRVKGHFGPINSVAFHPDGKSYASGGEDGYVRVHNLDSSYF  320



>gb|KFQ29136.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Merops nubicus]
Length=242

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  78   IIAGHESGELNQFSAKSGEQLANIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  134

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  135  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  194

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  195  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  240



>ref|XP_005427180.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Geospiza fortis]
Length=249

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  85   IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  141

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  142  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  201

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  202  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  247



>ref|XP_007363750.1| WD40 repeat-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF63198.1| WD40 repeat-like protein [Dichomitus squalens LYAD-421 SS1]
Length=334

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   + ++DA+TG  +K +  E  H+  +T L  S D S+FIT S DK+A+L + 
Sbjct  163  IITGHESGKVALFDAKTGDEIKTN--EHAHRDTVTDLQLSPDRSYFITSSKDKTARLHET  220

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
            RTLT+LKTYVTE P+N+  ++PL  +++LGGGQDA +VTTT  R GKFE +F+ K+L+EE
Sbjct  221  RTLTVLKTYVTETPLNSAALAPLKPYVLLGGGQDAMSVTTTSLRQGKFETRFWHKVLEEE  280

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            +G VKGHFGP+N +A +P G  +ASGGEDG+VR+HHF+  YF  K
Sbjct  281  VGRVKGHFGPVNTIAVSPKGDCYASGGEDGFVRVHHFEESYFRAK  325



>ref|XP_002431936.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
 gb|EEB19198.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
Length=320

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  L+ WD + GK +  +    G    I  +  + D + FIT S D +AKL+
Sbjct  154  ETIITGHDNGELQQWDMKNGKKIVSTKDHFGM---INDMQMNKDSTFFITASKDYTAKLF  210

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  LKTY TERPVN+  +SPLLDH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  211  DSDTLFCLKTYKTERPVNSAAISPLLDHVVLGGGQDAMEVTTTSTRIGKFDSRFFHMVFE  270

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE G VKGHFGPIN++AF+PDG+S++SGGEDGY+R+H+FD  YF
Sbjct  271  EEFGRVKGHFGPINSVAFHPDGRSYSSGGEDGYIRVHYFDNSYF  314



>ref|XP_010731470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Larimichthys crocea]
Length=296

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  L  + A++G +LK + +   H K I  +  S+D + FI+ S D SAKL+D 
Sbjct  132  VIAGHENGELNQFSAKSGDILKSAKE---HTKQINDIQTSVDLTMFISASKDNSAKLFDC  188

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  189  TSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  248

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGY R+H+FD+ YF  ++
Sbjct  249  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTRIHYFDSQYFDFEL  294



>ref|XP_002400973.1| translation initiation factor 3 and TGF-beta interacting protein, 
putative [Ixodes scapularis]
 gb|EEC00610.1| translation initiation factor 3 and TGF-beta interacting protein, 
putative [Ixodes scapularis]
Length=195

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            I+S  ED  + IWD ++G+ L   +    H   I  L  + D S FIT S D +AKL+D 
Sbjct  31   ILSAHEDGTVSIWDIKSGEQL---NTIKPHNLTINDLQYNKDQSFFITASKDTTAKLFDA  87

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKTY TERPVN+ ++SP+ +H+VLGGGQ+A  VTT+  +AGKF+A+F+  I +EE
Sbjct  88   DTLEHLKTYKTERPVNSASLSPIKEHVVLGGGQEAMDVTTSSTKAGKFDARFFHLIFEEE  147

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VK HFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  +I
Sbjct  148  FGKVKDHFGPINSVAFHPDGKSYSSGGEDGYVRVHYFDPSYFDFQI  193



>ref|XP_008904158.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETI48440.1| hypothetical protein F443_07533 [Phytophthora parasitica P1569]
 gb|ETK88380.1| hypothetical protein L915_07354 [Phytophthora parasitica]
 gb|ETL41778.1| hypothetical protein L916_07299 [Phytophthora parasitica]
 gb|ETL94935.1| hypothetical protein L917_07189 [Phytophthora parasitica]
 gb|ETM48172.1| hypothetical protein L914_07247 [Phytophthora parasitica]
 gb|ETN10397.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETP18232.1| hypothetical protein F441_07512 [Phytophthora parasitica CJ01A1]
 gb|ETP46176.1| hypothetical protein F442_07542 [Phytophthora parasitica P10297]
Length=327

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K I++ G D  ++++D  TG+LL+  D  +G    IT++A +   +  IT S D +AKL 
Sbjct  161  KAIMTTGGDGTIKLFDPTTGQLLESHDIHTGE---ITNVAFNKTKTLAITSSKDNTAKLL  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+ TL +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + Q
Sbjct  218  DVETLKVLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQ  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHI  192
            EE G VKGHFGPIN +AF+P+GKS+ASG EDGYVRLHHFD DY  +
Sbjct  278  EEFGRVKGHFGPINTIAFHPNGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_010083431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pterocles gutturalis]
 ref|XP_010121524.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Chlamydotis macqueenii]
Length=263

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  99   IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  155

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  156  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  215

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  216  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  261



>gb|AFK47032.1| unknown [Medicago truncatula]
Length=87

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = -3

Query  446  MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  267
            MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPD
Sbjct  1    MSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPD  60

Query  266  GKSFASGGEDGYVRLHHFDADYFHIKI  186
            GKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  61   GKSFSSGGEDGYVRLHHFDPDYFNIKI  87



>ref|XP_008937943.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Merops nubicus]
Length=258

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  94   IIAGHESGELNQFSAKSGEQLANIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  150

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  151  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  210

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  211  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  256



>ref|XP_967415.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Tribolium castaneum]
 gb|EEZ99635.1| hypothetical protein TcasGA2_TC002391 [Tribolium castaneum]
Length=326

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G E+  L  WD ++GK +  + +   H+  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHENGDLIKWDLKSGKEISSTRE---HEHLINDMQWNKDGTMFVTASKDHTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D   L LLKTY TERPVN+  +SP+ +H+V+GGGQDA  VTTT  R GKF+++F+  + +
Sbjct  217  DAADLMLLKTYKTERPVNSAAISPIFEHVVVGGGQDAMDVTTTSARVGKFDSRFFHMVFE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD+ YF
Sbjct  277  EEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRVHNFDSSYF  320



>ref|XP_009538303.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
 gb|EGZ06406.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
Length=327

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 121/166 (73%), Gaps = 3/166 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            + I++ G D  ++++D +TG+LL+  D  +G    IT++A +   +  IT S D +AKL 
Sbjct  161  EAIMTTGGDGCIKLFDPQTGELLESHDIHTGE---ITNVAFNKTKTLAITSSKDNTAKLL  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+ T+ +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + Q
Sbjct  218  DVETMKVLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQ  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHI  192
            EE G VKGHFGPIN +AF+P+GKS+ASG EDGYVRLHHFD DY  +
Sbjct  278  EEFGRVKGHFGPINTIAFHPNGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_008613397.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|EQC33274.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|KDO31229.1| hypothetical protein SPRG_03847 [Saprolegnia parasitica CBS 223.65]
Length=325

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 120/162 (74%), Gaps = 3/162 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            I++ GED ++++++ ETG L+ E    +G    ITSL+ + D +  IT S D +AKL D+
Sbjct  163  ILTTGEDGMVKLFNPETGALISEHKVHNG---SITSLSFNKDKTLAITSSKDNTAKLLDV  219

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL +LKTY T+RPVN+ ++SP  +H+VLGGGQ+A  VT T  RAGKFEA+F+ ++ +EE
Sbjct  220  ETLEVLKTYETDRPVNSASISPTKEHVVLGGGQEAMTVTVTAGRAGKFEARFFHQVYEEE  279

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
             G VKGHFGPIN++ F+PDGKS+ SG EDGYVR+HHFD +Y 
Sbjct  280  FGRVKGHFGPINSITFHPDGKSYTSGAEDGYVRIHHFDQEYL  321



>ref|XP_010012332.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Nestor notabilis]
Length=263

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  99   IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  155

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  156  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  215

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  216  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  261



>ref|XP_009330494.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pygoscelis adeliae]
Length=279

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  115  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  171

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  172  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  231

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  232  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  277



>ref|XP_006676014.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83190.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
Length=337

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 116/170 (68%), Gaps = 3/170 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            KTII+G +  ++ +WDAETG+L+   +    H   I  L    +  +FIT S D SA++ 
Sbjct  161  KTIITGHDKGLVSLWDAETGELI---NSVQAHTGPIQDLQFGPEKEYFITASKDNSAQII  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL +LK +  ERPVN+  +SP+   I+LGGGQDA  VTTT  R GKFE +F+  + +
Sbjct  218  DATTLEVLKRFEVERPVNSAAISPIRQQIMLGGGQDAMNVTTTSARQGKFEVRFFHLVFR  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI*G  180
            EEIG V+GHFGPIN LAF+PDGKSF+SGGEDGYVR+H FD DYF  K  G
Sbjct  278  EEIGRVRGHFGPINTLAFHPDGKSFSSGGEDGYVRVHFFDNDYFTFKFPG  327



>gb|EJU03377.1| WD40 repeat-like protein [Dacryopinax sp. DJM-731 SS1]
Length=339

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 122/167 (73%), Gaps = 2/167 (1%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K II+G E   + I+DA+TG+ L+ +  E  H + +T L  + D S+F+T S DKSA+L 
Sbjct  166  KHIITGHESGKVAIFDAKTGEELRAN--EKAHHEPVTDLQLAPDRSYFVTSSKDKSARLH  223

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D RTL +LKTY TE P+N+  ++PL  +++LGGGQDA +VTTT  R GKFE +F+ K+ +
Sbjct  224  DSRTLAVLKTYTTETPLNSAAIAPLRPYVLLGGGQDAMSVTTTSLRQGKFETRFWHKVFE  283

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
            EE+G V+GHFGPIN +A +PDG+S++SGGEDG+VR+H FD  YF  +
Sbjct  284  EEVGRVRGHFGPINTIAVHPDGRSYSSGGEDGFVRVHFFDVSYFKAR  330



>ref|XP_009482861.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pelecanus crispus]
Length=270

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  106  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  162

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  163  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  222

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  223  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  268



>ref|XP_005823889.1| translation initiation factor 3, subunit I [Guillardia theta 
CCMP2712]
 gb|EKX36909.1| translation initiation factor 3, subunit I [Guillardia theta 
CCMP2712]
Length=319

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 116/167 (69%), Gaps = 3/167 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K I+   E   +  ++A TG+ L E       ++ I     S D   FI  S D +A L+
Sbjct  156  KKILVSNEAGGILSYEAATGECLIE---RCDFEQEIPDFTYSQDMMTFIVASKDHTAMLY  212

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  TL  ++ YV++RP+N+  +SPL+DH+V+GGGQDASAVTTT  R+G+F+A FY KI +
Sbjct  213  DTNTLEPIRKYVSDRPINSAAISPLMDHVVIGGGQDASAVTTTAGRSGRFQALFYHKIFE  272

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  189
             EIG V+GHFGPIN+LAFNPDG+SF SGGEDGYVR+HHFD +YF ++
Sbjct  273  NEIGSVQGHFGPINSLAFNPDGRSFTSGGEDGYVRVHHFDPEYFSLE  319



>gb|KFP30991.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Colius striatus]
Length=305

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  141  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  197

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  198  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHWAFEEE  257

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  258  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  303



>emb|CCI46504.1| unnamed protein product [Albugo candida]
Length=317

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 120/163 (74%), Gaps = 3/163 (2%)
 Frame = -3

Query  686  TIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWD  507
            +I++ G D  L+++D ++GK+LKE    SG    IT+++ +   +  IT S D +AKL D
Sbjct  148  SILASGGDGGLKLFDPKSGKVLKECKIHSG---DITNISFNKLKTLAITSSKDNTAKLVD  204

Query  506  IRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQE  327
            + TL +LKTY T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  + GKFEA+F+  + QE
Sbjct  205  VETLDVLKTYETDRPVNSAAISPIREHVVLGGGQEAMSVTTTSGQVGKFEARFFHMVFQE  264

Query  326  EIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            E   VKGHFGPIN +AF+PDGKS+ SG EDGYVRLHHFD DYF
Sbjct  265  EFARVKGHFGPINTIAFHPDGKSYVSGAEDGYVRLHHFDEDYF  307



>ref|XP_006806095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Neolamprologus brichardi]
Length=325

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  +  + A++G++LK++ +   H K I  +  S+D + FI+ S D +AKL+D 
Sbjct  161  VIAGHENGEINQFSAKSGEILKKAKE---HTKQINDIQTSVDLTMFISASKDNTAKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGYVR+H+FD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEL  323



>gb|KFB49333.1| AGAP006607-PA-like protein [Anopheles sinensis]
Length=342

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +T+I+G E+  LRIWD    + +KE +  + H   IT +  S D + F++ S D SAKL+
Sbjct  177  ETVITGHENGSLRIWDL---RAVKELNSVNDHTASITDMQMSNDATMFVSSSKDSSAKLF  233

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SPL +H+ LGGGQDA  VTTT  +AGKF+++F+  + +
Sbjct  234  DSESLMNLKTYKTERPVNSACISPLYEHVALGGGQDAMEVTTTSTQAGKFDSRFFHLVYE  293

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   VKGHFGPIN++AF+PDGKSFA+GGEDG+VR+  FD  Y+
Sbjct  294  EEFARVKGHFGPINSMAFHPDGKSFATGGEDGFVRVQVFDNSYY  337



>ref|XP_003443814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oreochromis niloticus]
 ref|XP_004563737.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Maylandia zebra]
 ref|XP_005745286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pundamilia nyererei]
 ref|XP_005950654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Haplochromis burtoni]
Length=325

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  +  + A++G++LK++ +   H K I  +  S+D + FI+ S D +AKL+D 
Sbjct  161  VIAGHENGEINQFSAKSGEILKKAKE---HTKQINDIQTSVDLTMFISASKDNTAKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGYVR+H+FD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEL  323



>gb|EFN80705.1| Eukaryotic translation initiation factor 3 subunit I [Harpegnathos 
saltator]
Length=320

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  156  ETIITGHEDGDITLWD--TGKKLSNV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLF  210

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKT+ TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  211  DSDSLMLLKTFKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  270

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  271  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  314



>ref|XP_009814792.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I, partial [Gavia stellata]
Length=292

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  128  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  184

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  185  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  244

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  245  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  290



>gb|EFN80704.1| Eukaryotic translation initiation factor 3 subunit I [Harpegnathos 
saltator]
Length=324

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ED  + +WD  TGK L       GHK  I  +  + DG+ F+T S D +AKL+
Sbjct  160  ETIITGHEDGDITLWD--TGKKLSNV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLF  214

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L LLKT+ TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +
Sbjct  215  DSDSLMLLKTFKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE  274

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  275  EEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  318



>gb|EMC82690.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Columba livia]
Length=293

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  129  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  185

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  186  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  245

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  246  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  291



>ref|XP_010221644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like, partial [Tinamus guttatus]
Length=158

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  596  HKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVL  417
            H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VL
Sbjct  20   HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVL  79

Query  416  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGED  237
            GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGED
Sbjct  80   GGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGED  139

Query  236  GYVRLHHFDADYFHIKI  186
            GYVR+H+FD  YF  + 
Sbjct  140  GYVRIHYFDPQYFEFEF  156



>ref|XP_005509744.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Columba livia]
Length=307

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  143  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  199

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  200  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  259

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  260  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  305



>ref|XP_007067631.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chelonia mydas]
Length=217

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 117/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G++L    +   H K I  +  S D + FIT S D SAKL+D 
Sbjct  53   IIAGHENGELNQFSAKSGEVLVNVKE---HTKQINDIQTSRDMTMFITASKDNSAKLFDS  109

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL   K++ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+   ++EE
Sbjct  110  TTLEHQKSFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEE  169

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G +KGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  170  FGRIKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  215



>gb|ACD65081.1| eukaryotic translation initiation factor [Forcipomyia taiwana]
Length=325

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G E+  + +WD   G+   E +  + H   I  L  S DG+ F++ S D +AKL+
Sbjct  160  ETIITGHENGQITLWDLRIGR---EINSVNDHMGAINDLQLSKDGTMFVSSSRDTTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+  +SPLL+H+VLGGGQDA  VTTT  R GKF+++F+  I +
Sbjct  217  DSDSLMCLKTYKTERPVNSAAISPLLEHVVLGGGQDAMEVTTTSARQGKFDSRFFHLIYE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   VKGHFGPIN+LAF+PDG+S+A+GGEDG+VRL  FD+ Y+
Sbjct  277  EEFARVKGHFGPINSLAFHPDGRSYATGGEDGFVRLQTFDSSYY  320



>ref|XP_010198429.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Colius striatus]
Length=306

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  142  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  198

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  199  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHWAFEEE  258

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  259  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  304



>ref|XP_002899797.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
 gb|EEY60851.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
Length=327

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K I++ G D  ++++D +TG+LL+     +G    IT++A +   +  IT S D +AKL 
Sbjct  161  KAIMTTGGDGTIKLFDPKTGQLLESYVIHTGE---ITNVAFNKSKTLAITSSKDNTAKLL  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+ TL +LK Y T+RPVN+  +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + Q
Sbjct  218  DVETLKVLKVYETDRPVNSAAISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQ  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHI  192
            EE G VKGHFGPIN +AF+P+GKS+ASG EDGYVRLHHFD DY  +
Sbjct  278  EEFGRVKGHFGPINTIAFHPNGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_009283047.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Aptenodytes forsteri]
Length=331

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  167  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  223

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  224  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  283

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  284  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_009927166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Haliaeetus albicilla]
Length=300

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  136  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  192

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  193  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  252

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  253  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  298



>ref|XP_003844805.1| similar to eukaryotic translation initiation factor 3 subunit 
[Leptosphaeria maculans JN3]
 emb|CBY01326.1| similar to eukaryotic translation initiation factor 3 subunit 
[Leptosphaeria maculans JN3]
Length=340

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K IISG ED  +  WD +TG+LL  +         +T L  + D S+FIT S DK+AKL 
Sbjct  160  KYIISGHEDGSITQWDGKTGELLSSNYDVHEPDMQVTDLQWAPDRSYFITASKDKTAKLV  219

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+  LT+LK+YV + P+N+  ++P+ D+++LGGGQ A  VTTT  R GKFEA+FY KI  
Sbjct  220  DVEDLTVLKSYVADTPLNSAAITPVKDYVILGGGQAAMDVTTTSARQGKFEARFYHKIFM  279

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EEIG V+GHFGP+N +A +P G S+ SGGEDGYVR+HHFD  YF
Sbjct  280  EEIGRVRGHFGPLNYVAVHPQGTSYCSGGEDGYVRVHHFDKPYF  323



>ref|XP_008024458.1| hypothetical protein SETTUDRAFT_168745 [Setosphaeria turcica 
Et28A]
 gb|EOA87954.1| hypothetical protein SETTUDRAFT_168745 [Setosphaeria turcica 
Et28A]
Length=342

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K IISG ED  +  WD +TG+LL  +         IT +  + D S+FIT S DK+AKL 
Sbjct  160  KYIISGHEDGSITQWDGKTGELLSSNYDAHEPDMQITDIQWAPDRSYFITASKDKTAKLV  219

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+  LT+LK+YV + P+N+  ++P+ D+++LGGGQ A  VTTT  R GKFEA+FY KI  
Sbjct  220  DVEDLTVLKSYVADTPLNSAAITPVKDYVILGGGQAAMDVTTTSARQGKFEARFYHKIFM  279

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EEIG V+GHFGP+N +A +P G S+ SGGEDGYVR+HHFD  YF
Sbjct  280  EEIGRVRGHFGPLNYVAVHPQGTSYCSGGEDGYVRVHHFDKPYF  323



>ref|XP_003969003.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Takifugu rubripes]
Length=325

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 121/166 (73%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  +  + A++G++LK+  +   H + I  +  S+D + FIT S D +AKL+D 
Sbjct  161  VIAGHENGEINQFSAKSGEILKKVKE---HSRQINDIQTSVDLTMFITASKDNTAKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  +K++ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  NSLDHIKSFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGYVR+H+FD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEL  323



>ref|XP_009977243.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Tauraco erythrolophus]
Length=338

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  174  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  230

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  231  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  290

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  291  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  336



>ref|XP_009579506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fulmarus glacialis]
Length=331

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  167  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  223

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  224  TTLQHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  283

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  284  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  329



>gb|KFP00122.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Calypte anna]
Length=325

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_009679337.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Struthio camelus australis]
Length=338

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  174  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  230

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  231  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  290

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  291  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  336



>ref|XP_005239876.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco peregrinus]
 ref|XP_005432815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco cherrug]
 ref|XP_009946176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Leptosomus discolor]
 ref|XP_010180366.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Mesitornis unicolor]
Length=331

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  167  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  223

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  224  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  283

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  284  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_010168387.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Caprimulgus carolinensis]
Length=331

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  167  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  223

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  224  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  283

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  284  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_007680736.1| hypothetical protein BAUCODRAFT_286498 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC92363.1| hypothetical protein BAUCODRAFT_286498 [Baudoinia compniacensis 
UAMH 10762]
Length=346

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 126/186 (68%), Gaps = 14/186 (8%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG--ITSLAKSIDGSHFITGSLDKSAK  516
            + II+G E+  +  WDA+TG+++ +   E  H+ G  +T L  S D ++FIT S DK+AK
Sbjct  161  RYIITGHENGCVAQWDAKTGEMIAD---EYPHEDGASVTDLQWSADRTYFITSSKDKTAK  217

Query  515  LWDIRTLTLLKTYVTERPVNAVTMSP-LLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDK  339
            L D RTL +L TYV + P+N+  ++P   ++++LGGGQ A  VTTT  R GKFEA+FY K
Sbjct  218  LQDARTLKVLHTYVADTPLNSAAITPEPTNYVILGGGQAAMDVTTTSARQGKFEARFYHK  277

Query  338  ILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI*G*SAAASQ  159
            I +EE+G V+GHFGP+N +A +PDGK + SGGEDGYVR+HHFD  YF  K         +
Sbjct  278  IFEEEVGRVRGHFGPLNYVAVSPDGKCYCSGGEDGYVRVHHFDPPYFDFKY--------E  329

Query  158  IERQSQ  141
            +ER+ Q
Sbjct  330  VEREMQ  335



>gb|KFP52286.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Cathartes aura]
 gb|KFV16729.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Pterocles gutturalis]
Length=263

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 113/166 (68%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A+  + L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  99   IIAGHESGELNQFSAKVREQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  155

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  156  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  215

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  216  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  261



>gb|EOB00694.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Anas platyrhynchos]
 gb|KFU91822.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Chaetura pelagica]
Length=325

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>gb|KFV75063.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Picoides pubescens]
Length=324

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  160  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  216

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  217  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  276

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  277  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  322



>ref|NP_001157867.1| eukaryotic translation initiation factor 3 subunit I [Gallus 
gallus]
 ref|XP_009469099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Nipponia nippon]
 ref|XP_009998862.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chaetura pelagica]
Length=325

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_009882825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Charadrius vociferus]
Length=339

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  175  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  231

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  232  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  291

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  292  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  337



>ref|XP_010574326.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Haliaeetus leucocephalus]
Length=332

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  168  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  224

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  225  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  284

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  285  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  330



>ref|XP_009646824.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I [Egretta garzetta]
Length=331

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  167  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  223

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  224  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  283

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  284  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_009708532.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I [Cariama cristata]
Length=329

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  165  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  221

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  222  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  281

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  282  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  327



>ref|XP_010574327.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Haliaeetus leucocephalus]
Length=325

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_005181692.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Musca domestica]
Length=324

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            +TII+G ++  + IWD   G+   E +  + H   I  +    DG+ F+T S D +AKL+
Sbjct  160  ETIITGHDNGQISIWDIRKGR---EVNSVNDHTGSINDMQMYKDGTMFVTASKDTTAKLF  216

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +
Sbjct  217  DSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYE  276

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   +KGHFGPIN+LAF+PDG+S+ASGGEDG+VR++ FD+ Y+
Sbjct  277  EEFARLKGHFGPINSLAFHPDGRSYASGGEDGFVRVNTFDSTYY  320



>gb|KEQ62058.1| putative eukaryotic translation initiation factor 3 subunit I 
[Aureobasidium melanogenum CBS 110374]
Length=335

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 120/170 (71%), Gaps = 5/170 (3%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG--ITSLAKSIDGSHFITGSLDKSAK  516
            + IISG ED  +  WDA+TG+   E ++   H+ G  IT L  S D ++FIT S DKSAK
Sbjct  161  RYIISGHEDGSVTQWDAKTGE---EYERAYPHEDGMMITDLQWSADRTYFITASKDKSAK  217

Query  515  LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  336
            L D +TL ++KTYV + P+N+  ++P+ D++++GGGQ A  VTTT  R GKFEA+FY KI
Sbjct  218  LMDAKTLEVMKTYVADTPLNSAAITPVKDYVIVGGGQAAMDVTTTSARQGKFEARFYHKI  277

Query  335  LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             +EEIG V+GHFGP+N +A +P G  +ASGGEDGYVR+HHFD  YF  K 
Sbjct  278  FEEEIGRVRGHFGPLNYVAVSPLGTVYASGGEDGYVRVHHFDQPYFDFKF  327



>ref|XP_002167671.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Hydra vulgaris]
Length=325

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  +  W A+TG L+K       H   ++ L KS +   FIT S D ++KL+D 
Sbjct  161  IITGHENGTVSKWCAQTGDLIKSM---RAHIDKVSDLQKSSNEMMFITASKDNTSKLFDT  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             T+ LLKTY T+RPVN+  +SP+ D +VLGGGQ+A  VTTT  R GKF+A+F+  I +EE
Sbjct  218  ETMQLLKTYKTDRPVNSAAISPIRDQVVLGGGQEAMEVTTTSTRIGKFDARFFHMIFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
            IG VKGHFGPIN+LAF+P+GKS++SGGEDGYVR H FD  Y+  + 
Sbjct  278  IGRVKGHFGPINSLAFHPNGKSYSSGGEDGYVRSHVFDKSYYEFEF  323



>ref|XP_009964403.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Tyto alba]
Length=324

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  160  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  216

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  217  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  276

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  277  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  322



>ref|XP_008294825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Stegastes partitus]
Length=325

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  +  + A++G++LK+  +   H K I  +  S+D + FIT S D SAKL+D 
Sbjct  161  VIAGHENGEINQFSAKSGEVLKKIKE---HTKQINDIQPSVDLTIFITASKDNSAKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGY R+H+FD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTRIHYFDPQYFDFEL  323



>ref|XP_009068306.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Acanthisitta chloris]
Length=324

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  160  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  216

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  217  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  276

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  277  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  322



>emb|CAF99511.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=325

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  +  + A++G +LK+  +   H + I  +  S+D + FIT S D +AKL+D 
Sbjct  161  VIAGHENGEINQFSAKSGDILKKVKE---HSRQINDIQTSVDLTMFITASKDNTAKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  +K++ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  NSLDHIKSFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGYVR+H+FD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEL  323



>ref|XP_010280277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Phaethon lepturus]
Length=336

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  172  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  228

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  229  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  288

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  289  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  334



>gb|KFQ49075.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Nestor notabilis]
Length=263

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A+  + L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  99   IIAGHENGELNQFSAKVREQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  155

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  156  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  215

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  216  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  261



>ref|XP_008491107.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Calypte anna]
Length=340

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  176  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  232

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  233  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  292

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  293  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  338



>ref|XP_005058303.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Ficedula albicollis]
 ref|XP_005529814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Pseudopodoces humilis]
 ref|XP_009096805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Serinus canaria]
Length=325

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>gb|KFP75614.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Acanthisitta chloris]
Length=325

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|NP_001157823.1| eukaryotic translation initiation factor 3 subunit I [Taeniopygia 
guttata]
 sp|B5FZ19.2|EIF3I_TAEGU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Taeniopygia guttata]
 gb|ACH44281.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44283.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44284.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44285.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44286.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
Length=325

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  161  IIAGHENGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TSLKHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  278  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_010721802.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Meleagris gallopavo]
Length=351

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  187  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  243

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  244  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  303

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  304  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  349



>ref|XP_009906815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Picoides pubescens]
Length=340

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  176  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  232

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  233  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  292

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  293  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  338



>ref|XP_005020506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anas platyrhynchos]
Length=359

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  195  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  251

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  252  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  311

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  312  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  357



>ref|XP_009821601.1| hypothetical protein H257_00561 [Aphanomyces astaci]
 gb|ETV89201.1| hypothetical protein H257_00561 [Aphanomyces astaci]
Length=325

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            + II+ GED  +++++ ETG L+ E+   +G    IT+LA + D +  IT S D +AKL 
Sbjct  161  EAIITTGEDGYVKLFNPETGALISETKVHNG---VITNLAFNKDKTLGITSSKDNTAKLI  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+  + +LKTY T+RPVN+ ++SP  +H+VLGGGQ+A  VT T  RAGKFEA+F+ ++ +
Sbjct  218  DLDAMQVLKTYETDRPVNSASISPTKEHVVLGGGQEAMTVTVTAGRAGKFEARFFHQVFE  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EE   VKGHFGPIN++ F+PDGKS++SG EDGYVR+HHFD DY 
Sbjct  278  EEFARVKGHFGPINSITFHPDGKSYSSGAEDGYVRIHHFDQDYL  321



>ref|XP_010295903.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Balearica regulorum gibbericeps]
Length=329

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E   L  + A++G+ L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  165  IIAGHESGELNQFSAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  221

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  222  TSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  281

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  282  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  327



>gb|KFW72870.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Pygoscelis adeliae]
Length=277

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            II+G E+  L  + A+  + L    +   H K I  +  S D + FIT S D +AKL+D 
Sbjct  113  IIAGHENGELNQFSAKVREQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDC  169

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  170  TTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEE  229

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  230  FGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  275



>gb|ACQ58286.1| Eukaryotic translation initiation factor 3 subunit I [Anoplopoma 
fimbria]
Length=325

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+     + A++G+++K++ +   H K I  +  S+D + FI+ S D +AKL+D 
Sbjct  161  VIAGHENGEFNQFSAKSGEIIKKAKE---HTKQINDIQTSVDLTMFISASKDNTAKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             T+  +KT+ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  ATMDHIKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGY R+H+FD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTRIHYFDPQYFDFEL  323



>ref|XP_007692855.1| hypothetical protein COCMIDRAFT_108319 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007695274.1| hypothetical protein COCSADRAFT_78119 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007709508.1| hypothetical protein COCCADRAFT_88768 [Bipolaris zeicola 26-R-13]
 gb|EMD70149.1| hypothetical protein COCSADRAFT_78119 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD86429.1| hypothetical protein COCHEDRAFT_1115799 [Bipolaris maydis C5]
 gb|ENI06380.1| hypothetical protein COCC4DRAFT_135480 [Bipolaris maydis ATCC 
48331]
 gb|EUC36235.1| hypothetical protein COCCADRAFT_88768 [Bipolaris zeicola 26-R-13]
 gb|EUC40628.1| hypothetical protein COCMIDRAFT_108319 [Bipolaris oryzae ATCC 
44560]
 gb|EUN32539.1| hypothetical protein COCVIDRAFT_84697 [Bipolaris victoriae FI3]
Length=340

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = -3

Query  689  KTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLW  510
            K IISG ED  +  WD +TG+LL  +         IT +  + D S+FIT S DK+AKL 
Sbjct  158  KYIISGHEDGSITQWDGKTGELLSSNYDAHEPDMQITDIQWAPDRSYFITASKDKTAKLI  217

Query  509  DIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  330
            D+  L++LK+YV + P+N+  ++P+ D+++LGGGQ A  VTTT  R GKFEA+FY KI  
Sbjct  218  DVEDLSVLKSYVADTPLNSAAITPVKDYVILGGGQAAMDVTTTSARQGKFEARFYHKIFM  277

Query  329  EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  198
            EEIG V+GHFGP+N +A +P G S+ SGGEDGYVR+HHFD  YF
Sbjct  278  EEIGRVRGHFGPLNYVAVHPKGTSYCSGGEDGYVRVHHFDKPYF  321



>ref|NP_001133273.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI32945.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68205.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68969.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI70142.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16123.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16168.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
Length=325

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 119/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  683  IISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDI  504
            +I+G E+  +  + A++G++LK+  +   H K I  +  S+D +  IT S D S+KL+D 
Sbjct  161  VIAGHENGEINQFSAKSGEVLKKVKE---HNKQINDIQTSVDLTMVITASKDCSSKLFDS  217

Query  503  RTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE  324
             TL  +K++ TERPVN+  +SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE
Sbjct  218  TTLDHIKSFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEE  277

Query  323  IGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  186
             G VKGHFGPIN +AF+PDGKS++SGGEDGY R+HHFD  YF  ++
Sbjct  278  FGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTRIHHFDPQYFDFEL  323



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520