BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034O06

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFR40584.1|  cellulase                                               182   2e-54   Populus nigra [black poplar]
gb|AFR40585.1|  cellulase                                               182   2e-54   Populus nigra [black poplar]
gb|AFR40563.1|  cellulase                                               182   3e-54   Populus trichocarpa [western balsam poplar]
gb|AFR40589.1|  cellulase                                               180   9e-54   Populus nigra [black poplar]
gb|AFR40578.1|  cellulase                                               180   1e-53   Populus fremontii
gb|AFR40581.1|  cellulase                                               179   2e-53   Populus fremontii
gb|AFR40588.1|  cellulase                                               179   3e-53   Populus nigra [black poplar]
emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     181   7e-53   Pisum sativum [garden pea]
gb|AID55380.1|  glycoside hydrolase family 9 A2                         191   7e-53   Gossypium hirsutum [American cotton]
gb|KJB70736.1|  hypothetical protein B456_011G089500                    190   8e-53   Gossypium raimondii
gb|KDP32467.1|  hypothetical protein JCGZ_13392                         189   3e-52   Jatropha curcas
gb|AAZ08322.1|  endo-1,4-beta-glucanase                                 186   5e-52   Eucalyptus globulus [blue gum]
gb|AFR40583.1|  cellulase                                               176   5e-52   Populus nigra [black poplar]
gb|AFR40591.1|  cellulase                                               175   1e-51   Populus nigra [black poplar]
gb|ADB82903.1|  membrane-bound endo-beta-1,4-glucanase                  186   3e-51   Populus alba x Populus grandidentata
ref|XP_006385837.1|  endo-1 family protein                              186   4e-51   Populus trichocarpa [western balsam poplar]
gb|AHA41508.1|  endo-1,4 -beta-glucanase                                186   4e-51   Populus deltoides
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             186   4e-51   Phaseolus vulgaris [French bean]
gb|AAT75041.1|  Cel9A                                                   186   4e-51   Populus tremula x Populus tremuloides
gb|AEO97252.1|  endo-1,4-beta-glucanase                                 186   4e-51   Populus tomentosa [Chinese white poplar]
gb|AEO97239.1|  endo-1,4-beta-glucanase                                 186   5e-51   Populus tomentosa [Chinese white poplar]
gb|AEO97182.1|  endo-1,4-beta-glucanase                                 185   5e-51   Populus tomentosa [Chinese white poplar]
gb|AEO97184.1|  endo-1,4-beta-glucanase                                 185   5e-51   Populus trichocarpa [western balsam poplar]
gb|AEO97238.1|  endo-1,4-beta-glucanase                                 185   5e-51   Populus tomentosa [Chinese white poplar]
emb|CBI29606.3|  unnamed protein product                                184   5e-51   Vitis vinifera
gb|AEO97265.1|  endo-1,4-beta-glucanase                                 185   5e-51   Populus tomentosa [Chinese white poplar]
ref|XP_010065200.1|  PREDICTED: endoglucanase 25-like                   186   5e-51   Eucalyptus grandis [rose gum]
gb|AAS45400.1|  endo-1,4-beta-glucanase                                 185   6e-51   Populus tremuloides
gb|AFR40586.1|  cellulase                                               173   6e-51   Populus nigra [black poplar]
ref|XP_003546229.1|  PREDICTED: endoglucanase 25-like                   185   7e-51   Glycine max [soybeans]
gb|KHN14382.1|  Endoglucanase 25                                        185   9e-51   Glycine soja [wild soybean]
ref|XP_011022354.1|  PREDICTED: endoglucanase 25-like                   184   1e-50   Populus euphratica
ref|XP_002519394.1|  endo-1,4-beta-glucanase, putative                  184   1e-50   Ricinus communis
emb|CAN68337.1|  hypothetical protein VITISV_025978                     184   1e-50   Vitis vinifera
gb|AEO97283.1|  endo-1,4-beta-glucanase                                 184   2e-50   Populus tomentosa [Chinese white poplar]
gb|AEO97183.1|  endo-1,4-beta-glucanase                                 184   2e-50   Populus tomentosa [Chinese white poplar]
gb|AEO97185.1|  endo-1,4-beta-glucanase                                 184   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002299405.1|  endo-1 family protein                              184   2e-50   
gb|AFY03622.1|  endo-1,4-beta-glucanase                                 184   3e-50   Eucalyptus globulus [blue gum]
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               183   4e-50   Gossypium hirsutum [American cotton]
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               183   4e-50   Gossypium herbaceum subsp. africanum
gb|AAP83128.1|  endo-1,4-beta-glucanase                                 183   4e-50   Gossypium hirsutum [American cotton]
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               183   4e-50   Gossypium hirsutum [American cotton]
gb|ABD62083.1|  endo-1,4-beta-glucancase precursor                      182   5e-50   Glycine max [soybeans]
ref|XP_003535026.1|  PREDICTED: endoglucanase 25                        182   5e-50   
gb|KJB66548.1|  hypothetical protein B456_010G143300                    182   5e-50   Gossypium raimondii
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 182   5e-50   Gossypium gossypioides
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 182   5e-50   Gossypium hirsutum [American cotton]
gb|AEN70798.1|  endo-1,4-beta-glucanase                                 182   6e-50   Gossypium turneri
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   182   7e-50   
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        185   8e-50   
ref|XP_010088712.1|  Endoglucanase 25                                   182   9e-50   Morus notabilis
gb|AGV22123.1|  endo-1,4-beta-glucanase 1                               182   9e-50   Betula luminifera [liang ye hua]
gb|KHN40215.1|  Endoglucanase 25                                        170   9e-50   Glycine soja [wild soybean]
gb|AEN70809.1|  endo-1,4-beta-glucanase                                 182   9e-50   Gossypium hirsutum subsp. latifolium
gb|AEN70810.1|  endo-1,4-beta-glucanase                                 182   9e-50   Gossypium hirsutum subsp. latifolium
ref|XP_011088109.1|  PREDICTED: endoglucanase 25-like                   181   1e-49   
gb|ADY68791.1|  membrane-anchored endo-1,4-beta-glucanase               181   1e-49   Gossypium barbadense [Egyptian cotton]
gb|AFD33696.1|  korrigan                                                181   1e-49   Eucalyptus camaldulensis
gb|KDO53876.1|  hypothetical protein CISIN_1g007014mg                   178   2e-49   Citrus sinensis [apfelsine]
ref|XP_003594425.1|  Endoglucanase                                      181   2e-49   Medicago truncatula
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 181   2e-49   Gossypium schwendimanii
ref|XP_011092233.1|  PREDICTED: endoglucanase 25-like                   181   3e-49   Sesamum indicum [beniseed]
ref|XP_003529689.1|  PREDICTED: endoglucanase 25-like                   180   4e-49   Glycine max [soybeans]
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   180   5e-49   Solanum tuberosum [potatoes]
ref|XP_004171003.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    180   5e-49   
ref|XP_004133745.1|  PREDICTED: endoglucanase 25-like                   180   6e-49   Cucumis sativus [cucumbers]
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   180   6e-49   Cicer arietinum [garbanzo]
ref|XP_003550680.1|  PREDICTED: endoglucanase 25-like                   180   6e-49   Glycine max [soybeans]
ref|XP_009600540.1|  PREDICTED: endoglucanase 25-like                   179   7e-49   Nicotiana tomentosiformis
ref|XP_009770880.1|  PREDICTED: endoglucanase 25-like                   179   7e-49   Nicotiana sylvestris
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        182   8e-49   Populus euphratica
ref|XP_007154086.1|  hypothetical protein PHAVU_003G089600g             179   9e-49   Phaseolus vulgaris [French bean]
ref|NP_001284449.1|  endoglucanase 25-like                              179   1e-48   Cucumis melo [Oriental melon]
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        179   1e-48   Tarenaya hassleriana [spider flower]
gb|KDO53875.1|  hypothetical protein CISIN_1g007014mg                   179   2e-48   Citrus sinensis [apfelsine]
ref|XP_006431347.1|  hypothetical protein CICLE_v10000600mg             179   2e-48   Citrus clementina [clementine]
gb|AIE16186.1|  endo-1,4-beta-glucanase                                 178   3e-48   Nicotiana tabacum [American tobacco]
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        177   5e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008347974.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    175   3e-47   
ref|XP_008339246.1|  PREDICTED: endoglucanase 25-like                   175   3e-47   Malus domestica [apple tree]
emb|CDP17765.1|  unnamed protein product                                175   3e-47   Coffea canephora [robusta coffee]
gb|AFR40582.1|  cellulase                                               164   3e-47   Populus fremontii
ref|XP_009765308.1|  PREDICTED: endoglucanase 25-like                   175   3e-47   Nicotiana sylvestris
ref|XP_009595607.1|  PREDICTED: endoglucanase 25-like                   175   4e-47   Nicotiana tomentosiformis
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   175   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_006358489.1|  PREDICTED: endoglucanase 25-like                   174   6e-47   Solanum tuberosum [potatoes]
ref|NP_001233943.1|  endo-1,4-beta-glucanase                            174   6e-47   Solanum lycopersicum
dbj|BAC22690.1|  endo-1,4-beta-D-glucanase                              174   1e-46   Pyrus communis
ref|XP_009399913.1|  PREDICTED: endoglucanase 9-like                    174   1e-46   
dbj|BAF42036.1|  cellulase1                                             173   1e-46   Pyrus communis
ref|XP_009340771.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    173   1e-46   
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    175   3e-46   
dbj|BAD95336.1|  cellulase homolog OR16pep precursor                    165   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             175   4e-46   
ref|XP_010266669.1|  PREDICTED: endoglucanase 9-like                    171   5e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   171   9e-46   Tarenaya hassleriana [spider flower]
ref|XP_010088713.1|  Endoglucanase 25                                   162   1e-45   
ref|XP_007222007.1|  hypothetical protein PRUPE_ppa002911mg             171   1e-45   Prunus persica
ref|XP_008803421.1|  PREDICTED: endoglucanase 10-like                   168   7e-45   Phoenix dactylifera
emb|CDX83181.1|  BnaA03g23250D                                          168   8e-45   
emb|CAB51903.1|  cellulase                                              168   8e-45   Brassica napus [oilseed rape]
ref|XP_006281810.1|  hypothetical protein CARUB_v10027986mg             168   8e-45   Capsella rubella
gb|AFL65037.1|  endoglucanase                                           166   9e-45   Pinus pinaster [cluster pine]
ref|XP_010909007.1|  PREDICTED: endoglucanase 10-like                   168   1e-44   Elaeis guineensis
ref|XP_009134026.1|  PREDICTED: endoglucanase 25                        168   1e-44   Brassica rapa
ref|XP_010938102.1|  PREDICTED: endoglucanase 9-like                    168   1e-44   Elaeis guineensis
ref|XP_010482263.1|  PREDICTED: endoglucanase 25-like                   168   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009355455.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    171   1e-44   
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        171   1e-44   
ref|XP_009123553.1|  PREDICTED: endoglucanase 25                        167   2e-44   Brassica rapa
emb|CDY37768.1|  BnaA10g05530D                                          167   2e-44   Brassica napus [oilseed rape]
emb|CDX71601.1|  BnaC09g26420D                                          167   2e-44   
ref|XP_006858422.1|  hypothetical protein AMTR_s00071p00064260          167   2e-44   Amborella trichopoda
ref|XP_010441020.1|  PREDICTED: endoglucanase 25                        167   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010442441.1|  PREDICTED: endoglucanase 25                        167   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002865753.1|  hypothetical protein ARALYDRAFT_495032             167   3e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009406859.1|  PREDICTED: endoglucanase 9-like                    166   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16291.1|  unknown                                                 166   4e-44   Picea sitchensis
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  166   4e-44   Picea glauca
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        169   4e-44   Fragaria vesca subsp. vesca
gb|AAM63370.1|  cellulase homolog OR16pep precursor                     166   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921267.1|  PREDICTED: endoglucanase 9-like                    166   7e-44   Elaeis guineensis
gb|AAK59818.1|  AT5g49720/K2I5_8                                        166   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199783.1|  endo-1,4-beta-D-glucanase                             165   8e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAN72232.1|  At5g49720/K2I5_8                                        165   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216021.1|  hypothetical protein PRUPE_ppa014845mg             165   9e-44   
emb|CDY21449.1|  BnaC03g27480D                                          165   1e-43   Brassica napus [oilseed rape]
ref|XP_008243721.1|  PREDICTED: endoglucanase 9-like                    165   1e-43   Prunus mume [ume]
gb|ABR15471.1|  endoglucanase                                           165   1e-43   Pinus taeda
ref|XP_008782747.1|  PREDICTED: endoglucanase 9-like                    165   1e-43   Phoenix dactylifera
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   164   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793381.1|  PREDICTED: endoglucanase 9-like                    164   2e-43   Phoenix dactylifera
gb|KFK26611.1|  hypothetical protein AALP_AA8G271400                    164   3e-43   Arabis alpina [alpine rockcress]
ref|NP_001183308.1|  hypothetical protein                               163   6e-43   Zea mays [maize]
ref|XP_009417855.1|  PREDICTED: endoglucanase 9-like                    162   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006402245.1|  hypothetical protein EUTSA_v10012932mg             162   1e-42   
ref|XP_006402246.1|  hypothetical protein EUTSA_v10012932mg             162   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004984503.1|  PREDICTED: endoglucanase 9-like                    161   3e-42   Setaria italica
emb|CDX92628.1|  BnaC07g38860D                                          160   5e-42   
ref|XP_009137436.1|  PREDICTED: endoglucanase 21-like                   160   8e-42   Brassica rapa
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                158   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   157   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529892.1|  PREDICTED: endoglucanase 25-like                   157   6e-41   Tarenaya hassleriana [spider flower]
ref|NP_001142480.1|  uncharacterized protein LOC100274698               149   1e-40   
ref|XP_006431346.1|  hypothetical protein CICLE_v10003884mg             155   1e-40   
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          156   1e-40   Sorghum bicolor [broomcorn]
gb|KDO53877.1|  hypothetical protein CISIN_1g041590mg                   155   2e-40   Citrus sinensis [apfelsine]
ref|NP_001050004.1|  Os03g0329500                                       154   6e-40   
gb|EEE58992.1|  hypothetical protein OsJ_10702                          154   6e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147537.1|  endo-1,4-beta-glucanase                            154   1e-39   Zea mays [maize]
ref|XP_006650027.1|  PREDICTED: endoglucanase 9-like                    154   1e-39   Oryza brachyantha
ref|XP_009137865.1|  PREDICTED: endoglucanase 21                        153   2e-39   Brassica rapa
emb|CDY34271.1|  BnaA01g13740D                                          152   2e-39   Brassica napus [oilseed rape]
gb|EMT00674.1|  Endoglucanase 10                                        152   2e-39   
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   153   2e-39   Oryza brachyantha
gb|EMS52550.1|  Endoglucanase 10                                        152   2e-39   Triticum urartu
dbj|BAJ94336.1|  predicted protein                                      152   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           152   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        152   4e-39   Brachypodium distachyon [annual false brome]
gb|ABP96983.1|  cellulase                                               152   4e-39   Colocasia esculenta [cocoyam]
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 149   4e-39   Avena strigosa
emb|CDI66528.1|  Endoglucanase 10                                       152   5e-39   Saccharum hybrid cultivar R570
emb|CDI66602.1|  Endoglucanase 10                                       152   5e-39   Saccharum hybrid cultivar R570
emb|CBB36505.1|  Hordeum vulgare protein similar to endo-1,4-b-gl...    152   6e-39   Saccharum hybrid cultivar R570
gb|ACZ82300.1|  beta-1,4 glycosidase                                    152   6e-39   Phyllostachys edulis [kikko-chiku]
gb|EPS69180.1|  hypothetical protein M569_05586                         151   1e-38   Genlisea aurea
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       150   1e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDI66566.1|  Endoglucanase 10                                       151   1e-38   Saccharum hybrid cultivar R570
ref|XP_006444448.1|  hypothetical protein CICLE_v10024241mg             150   1e-38   Citrus clementina [clementine]
ref|NP_001051192.1|  Os03g0736300                                       150   1e-38   
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          150   1e-38   Sorghum bicolor [broomcorn]
ref|XP_008342152.1|  PREDICTED: endoglucanase 9-like                    150   1e-38   
ref|XP_009339798.1|  PREDICTED: endoglucanase 9-like                    150   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_006413454.1|  hypothetical protein EUTSA_v10024681mg             150   2e-38   
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 150   2e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003557996.1|  PREDICTED: endoglucanase 9                         150   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_006480121.1|  PREDICTED: endoglucanase 25-like                   150   3e-38   Citrus sinensis [apfelsine]
gb|KDO87072.1|  hypothetical protein CISIN_1g046335mg                   150   3e-38   Citrus sinensis [apfelsine]
ref|XP_010433798.1|  PREDICTED: endoglucanase 21-like                   150   3e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001151770.1|  endo-1,4-beta-glucanase Cel1                       149   5e-38   
gb|AFR40587.1|  cellulase                                               139   5e-38   Populus nigra [black poplar]
tpg|DAA51201.1|  TPA: endo-1,4-beta-glucanase Cel1                      149   5e-38   
gb|ACN28577.1|  unknown                                                 149   5e-38   Zea mays [maize]
ref|XP_002515321.1|  endo-1,4-beta-glucanase, putative                  149   6e-38   Ricinus communis
emb|CDY03467.1|  BnaC01g16150D                                          148   9e-38   
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   147   2e-37   Setaria italica
ref|XP_010277803.1|  PREDICTED: endoglucanase 12-like                   147   2e-37   Nelumbo nucifera [Indian lotus]
emb|CDY45056.1|  BnaA08g02190D                                          145   9e-37   Brassica napus [oilseed rape]
ref|XP_006283336.1|  hypothetical protein CARUB_v10004382mg             145   1e-36   Capsella rubella
ref|XP_006403190.1|  hypothetical protein EUTSA_v10003366mg             144   1e-36   
ref|XP_010448587.1|  PREDICTED: endoglucanase 21-like                   145   2e-36   Camelina sativa [gold-of-pleasure]
ref|NP_194157.1|  endoglucanase 21                                      144   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KFK22234.1|  hypothetical protein AALP_AAs42893U000400               144   2e-36   Arabis alpina [alpine rockcress]
ref|XP_002867672.1|  predicted protein                                  144   2e-36   Arabidopsis lyrata subsp. lyrata
gb|EPS66085.1|  hypothetical protein M569_08689                         143   5e-36   Genlisea aurea
ref|XP_010439066.1|  PREDICTED: endoglucanase 21                        143   6e-36   Camelina sativa [gold-of-pleasure]
gb|EMS51342.1|  Endoglucanase 9                                         143   2e-35   Triticum urartu
gb|KDP28223.1|  hypothetical protein JCGZ_13994                         142   2e-35   Jatropha curcas
ref|XP_008235173.1|  PREDICTED: endoglucanase 9-like                    141   2e-35   Prunus mume [ume]
gb|EMT18790.1|  Endoglucanase 9                                         141   3e-35   
ref|XP_002960146.1|  hypothetical protein SELMODRAFT_266522             141   3e-35   
gb|AGK26801.1|  endo-beta-1,4-glucanase                                 141   4e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26803.1|  endo-beta-1,4-glucanase                                 141   4e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26798.1|  endo-beta-1,4-glucanase                                 141   4e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26802.1|  endo-beta-1,4-glucanase                                 141   4e-35   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK04500.1|  predicted protein                                      140   6e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007199407.1|  hypothetical protein PRUPE_ppa026228mg             140   6e-35   Prunus persica
gb|EYU33245.1|  hypothetical protein MIMGU_mgv1a022358mg                139   7e-35   Erythranthe guttata [common monkey flower]
emb|CBI18623.3|  unnamed protein product                                138   1e-34   Vitis vinifera
ref|XP_002312211.1|  endo-1 family protein                              139   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002514768.1|  endo-1,4-beta-glucanase, putative                  139   2e-34   Ricinus communis
gb|KDP32490.1|  hypothetical protein JCGZ_13415                         139   2e-34   Jatropha curcas
ref|XP_010646848.1|  PREDICTED: endoglucanase 12                        138   2e-34   
ref|XP_002983992.1|  hypothetical protein SELMODRAFT_268803             138   3e-34   
gb|AFZ78629.1|  korrigan                                                138   5e-34   Populus tomentosa [Chinese white poplar]
ref|XP_011077092.1|  PREDICTED: endoglucanase 12                        137   7e-34   Sesamum indicum [beniseed]
ref|XP_004250089.1|  PREDICTED: endoglucanase 12                        137   7e-34   Solanum lycopersicum
ref|XP_011010912.1|  PREDICTED: endoglucanase 12                        137   8e-34   Populus euphratica
ref|XP_011014628.1|  PREDICTED: endoglucanase 12-like isoform X3        136   2e-33   Populus euphratica
ref|XP_006468640.1|  PREDICTED: endoglucanase 12-like                   136   2e-33   Citrus sinensis [apfelsine]
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   136   2e-33   Phoenix dactylifera
ref|XP_010929679.1|  PREDICTED: endoglucanase 12-like                   136   2e-33   Elaeis guineensis
ref|XP_011014603.1|  PREDICTED: endoglucanase 12-like isoform X1        135   3e-33   Populus euphratica
gb|KDO77086.1|  hypothetical protein CISIN_1g013288mg                   134   4e-33   Citrus sinensis [apfelsine]
ref|XP_006448516.1|  hypothetical protein CICLE_v10014583mg             135   4e-33   Citrus clementina [clementine]
ref|XP_002315101.2|  hypothetical protein POPTR_0010s18480g             134   4e-33   
ref|XP_006858738.1|  hypothetical protein AMTR_s00066p00128970          135   4e-33   Amborella trichopoda
gb|AEO97186.1|  endo-1,4-beta-glucanase                                 135   7e-33   Populus trichocarpa [western balsam poplar]
gb|AFZ78628.1|  korrigan                                                135   8e-33   Populus tomentosa [Chinese white poplar]
ref|XP_010065082.1|  PREDICTED: endoglucanase 12                        134   1e-32   Eucalyptus grandis [rose gum]
ref|XP_009141938.1|  PREDICTED: endoglucanase 21-like                   133   1e-32   Brassica rapa
ref|XP_004502103.1|  PREDICTED: endoglucanase 12-like                   134   1e-32   Cicer arietinum [garbanzo]
ref|XP_007028162.1|  Six-hairpin glycosidases superfamily protein       133   3e-32   
ref|XP_009782313.1|  PREDICTED: endoglucanase 12                        133   3e-32   Nicotiana sylvestris
ref|XP_003556773.1|  PREDICTED: endoglucanase 12-like                   133   3e-32   Glycine max [soybeans]
gb|KHN09941.1|  Endoglucanase 7                                         133   3e-32   Glycine soja [wild soybean]
ref|XP_009602898.1|  PREDICTED: endoglucanase 12                        133   4e-32   Nicotiana tomentosiformis
ref|XP_010930303.1|  PREDICTED: endoglucanase 12-like                   132   6e-32   Elaeis guineensis
ref|XP_007146006.1|  hypothetical protein PHAVU_006G0049001g            131   7e-32   Phaseolus vulgaris [French bean]
ref|XP_009385674.1|  PREDICTED: endoglucanase 12-like                   132   9e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912745.1|  PREDICTED: endoglucanase 12-like                   130   1e-31   
ref|XP_006353239.1|  PREDICTED: endoglucanase 12-like                   132   1e-31   Solanum tuberosum [potatoes]
emb|CDP09829.1|  unnamed protein product                                130   1e-31   Coffea canephora [robusta coffee]
gb|ACF87544.1|  unknown                                                 130   1e-31   Zea mays [maize]
tpg|DAA36812.1|  TPA: hypothetical protein ZEAMMB73_340402              130   2e-31   
gb|ACT54547.1|  endo-1,4-beta-glucanase                                 130   4e-31   Dimocarpus longan [longan]
ref|NP_001147970.1|  glycoside transferase, six-hairpin, subgroup       130   4e-31   Zea mays [maize]
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   129   5e-31   Phoenix dactylifera
ref|XP_010528623.1|  PREDICTED: endoglucanase 7                         129   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_004976098.1|  PREDICTED: endoglucanase 12-like                   129   9e-31   Setaria italica
emb|CDP21162.1|  unnamed protein product                                128   1e-30   Coffea canephora [robusta coffee]
ref|XP_008791029.1|  PREDICTED: endoglucanase 12-like                   127   4e-30   Phoenix dactylifera
ref|XP_010673846.1|  PREDICTED: endoglucanase 12-like                   127   4e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008441913.1|  PREDICTED: endoglucanase 7                         127   6e-30   Cucumis melo [Oriental melon]
emb|CAN59981.1|  hypothetical protein VITISV_016152                     117   1e-29   Vitis vinifera
ref|XP_002961082.1|  hypothetical protein SELMODRAFT_75214              125   1e-29   
ref|XP_002966925.1|  hypothetical protein SELMODRAFT_408186             125   2e-29   
gb|AID55392.1|  glycoside hydrolase family 9 A6                         125   2e-29   Gossypium hirsutum [American cotton]
ref|XP_002446733.1|  hypothetical protein SORBIDRAFT_06g021440          125   2e-29   Sorghum bicolor [broomcorn]
ref|NP_001288466.1|  endoglucanase 12-like                              124   3e-29   Zea mays [maize]
ref|XP_003601506.1|  Endoglucanase                                      124   3e-29   Medicago truncatula
ref|NP_001288520.1|  uncharacterized protein LOC103641803               124   4e-29   Zea mays [maize]
gb|KJB49856.1|  hypothetical protein B456_008G141900                    123   8e-29   Gossypium raimondii
emb|CDY39820.1|  BnaC02g42980D                                          122   1e-28   Brassica napus [oilseed rape]
ref|XP_004976099.1|  PREDICTED: endoglucanase 12-like                   123   1e-28   Setaria italica
gb|EYU39502.1|  hypothetical protein MIMGU_mgv1a002977mg                122   3e-28   Erythranthe guttata [common monkey flower]
emb|CDY16412.1|  BnaA02g12160D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_010496067.1|  PREDICTED: endoglucanase 7                         122   3e-28   Camelina sativa [gold-of-pleasure]
emb|CDY29138.1|  BnaA09g53910D                                          121   3e-28   Brassica napus [oilseed rape]
gb|EAY94707.1|  hypothetical protein OsI_16485                          122   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009403795.1|  PREDICTED: endoglucanase 12-like                   122   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q7XUK4.2|GUN12_ORYSJ  RecName: Full=Endoglucanase 12; AltName:...    122   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006391540.1|  hypothetical protein EUTSA_v10018270mg             121   5e-28   Eutrema salsugineum [saltwater cress]
ref|XP_004152840.1|  PREDICTED: endoglucanase 7-like                    121   6e-28   Cucumis sativus [cucumbers]
ref|XP_004169320.1|  PREDICTED: endoglucanase 7-like                    121   6e-28   
ref|XP_009127411.1|  PREDICTED: endoglucanase 7                         120   1e-27   Brassica rapa
ref|NP_176738.1|  glycosyl hydrolase 9A2                                120   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58029.1|  endo-1,4-beta-glucanase                                 119   2e-27   Genlisea aurea
ref|XP_002888427.1|  hypothetical protein ARALYDRAFT_894138             119   3e-27   
ref|XP_006300882.1|  hypothetical protein CARUB_v10019972mg             119   4e-27   
gb|EMT22659.1|  Endoglucanase 12                                        116   1e-26   
ref|XP_010673848.1|  PREDICTED: endoglucanase 12-like                   116   2e-26   
ref|XP_001772986.1|  predicted protein                                  115   7e-26   
ref|XP_006652472.1|  PREDICTED: endoglucanase 12-like                   114   1e-25   
gb|AGG19084.1|  cellulase                                               114   2e-25   
ref|XP_003580066.1|  PREDICTED: endoglucanase 12                        114   2e-25   
gb|EMT15171.1|  Endoglucanase 12                                        113   4e-25   
ref|XP_003610176.1|  Endo-1 4-beta-glucanase                            110   5e-25   
gb|KFK41003.1|  hypothetical protein AALP_AA2G072700                    113   5e-25   
ref|XP_009407065.1|  PREDICTED: endoglucanase 25-like                   112   8e-25   
ref|XP_001759056.1|  predicted protein                                  110   5e-24   
ref|XP_001775325.1|  predicted protein                                  108   2e-23   
dbj|BAH57006.1|  AT5G49720                                              107   3e-23   
ref|XP_011465378.1|  PREDICTED: endoglucanase 9-like isoform X2         106   6e-23   
ref|XP_007137548.1|  hypothetical protein PHAVU_009G135900g             107   6e-23   
ref|XP_004301819.1|  PREDICTED: endoglucanase 25-like isoform X1        106   1e-22   
ref|XP_002526151.1|  endo-1,4-beta-glucanase, putative                  105   2e-22   
ref|XP_004502591.1|  PREDICTED: endoglucanase 25-like                   105   3e-22   
ref|XP_003527970.1|  PREDICTED: endoglucanase 25-like                   105   3e-22   
gb|KHN23415.1|  Endoglucanase 25                                        104   4e-22   
gb|AAQ63883.1|  cellulase                                               103   7e-22   
gb|AES72416.2|  glycosyl hydrolase family 9 protein                     103   7e-22   
ref|XP_003602165.1|  Endoglucanase                                      103   7e-22   
ref|XP_006858456.1|  hypothetical protein AMTR_s00071p00095020          103   8e-22   
ref|XP_010110143.1|  Endoglucanase 7                                  97.4    1e-21   
ref|XP_010107239.1|  Endoglucanase 7                                    101   1e-21   
gb|KEH24407.1|  glycosyl hydrolase family 9 protein                   99.0    2e-21   
ref|XP_008786534.1|  PREDICTED: endoglucanase 10-like                   102   2e-21   
gb|AID55391.1|  glycoside hydrolase family 9 A3                         102   2e-21   
ref|XP_002278065.1|  PREDICTED: endoglucanase 25-like                   102   2e-21   
sp|P23666.1|GUN2_PERAE  RecName: Full=Endoglucanase 2; AltName: F...  96.3    3e-21   
ref|XP_010415102.1|  PREDICTED: endoglucanase 7-like                    102   3e-21   
ref|XP_009360182.1|  PREDICTED: endoglucanase 25-like                   102   3e-21   
emb|CDP18285.1|  unnamed protein product                                102   3e-21   
ref|XP_001754846.1|  predicted protein                                  102   4e-21   
ref|XP_006383615.1|  hypothetical protein POPTR_0005s21090g             101   4e-21   
ref|XP_010999860.1|  PREDICTED: endoglucanase 9-like                    101   5e-21   
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                            100   1e-20   
ref|XP_008240312.1|  PREDICTED: endoglucanase 25-like                   100   1e-20   
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg              99.8    2e-20   
ref|XP_007019419.1|  Endo-1,4-beta-glucanase, putative                  100   2e-20   
gb|KHG04285.1|  Endoglucanase 1                                       99.0    2e-20   
gb|AID55372.1|  glycoside hydrolase family 9 B13                      99.0    2e-20   
ref|XP_004510305.1|  PREDICTED: endoglucanase 1-like                  95.1    2e-20   
gb|AFK41115.1|  unknown                                               94.7    2e-20   
gb|KDP25211.1|  hypothetical protein JCGZ_20367                       98.6    3e-20   
gb|KJB19224.1|  hypothetical protein B456_003G089600                  99.0    3e-20   
gb|KJB19223.1|  hypothetical protein B456_003G089600                  99.0    4e-20   
gb|KDP43035.1|  hypothetical protein JCGZ_25221                       99.0    4e-20   
ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                  98.2    5e-20   
ref|XP_004170784.1|  PREDICTED: endoglucanase 25-like                 98.6    6e-20   
ref|XP_004147421.1|  PREDICTED: endoglucanase 25-like                 98.6    6e-20   
dbj|BAA06877.1|  cellulase precursor                                  97.8    6e-20   
ref|XP_010100207.1|  Endoglucanase 1                                  97.4    7e-20   
emb|CDP12234.1|  unnamed protein product                              97.4    7e-20   
gb|KJB18957.1|  hypothetical protein B456_003G077300                  97.4    8e-20   
gb|AFZ78635.1|  korrigan                                              97.4    8e-20   
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                       97.4    9e-20   
sp|P05522.1|GUN1_PERAE  RecName: Full=Endoglucanase 1; AltName: F...  97.1    1e-19   
dbj|BAA77239.1|  endo-1,4-beta glucanase                              97.1    1e-19   
ref|XP_011026779.1|  PREDICTED: endoglucanase CX-like                 97.1    1e-19   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                 96.7    1e-19   
ref|XP_006434418.1|  hypothetical protein CICLE_v10003122mg           97.4    1e-19   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  96.7    2e-19   
ref|XP_010676913.1|  PREDICTED: endoglucanase 1-like                  96.7    2e-19   
ref|XP_002299423.1|  hypothetical protein POPTR_0001s11430g           96.3    2e-19   
ref|XP_007039376.1|  Endoglucanase 1                                  96.3    2e-19   
gb|ABK24648.1|  unknown                                               96.7    2e-19   
ref|XP_002975128.1|  hypothetical protein SELMODRAFT_415162           95.9    2e-19   
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                  96.7    2e-19   
gb|KDO83647.1|  hypothetical protein CISIN_1g043321mg                 97.1    2e-19   
dbj|BAB39482.1|  endo-1,4-beta glucanase                              96.3    2e-19   
ref|XP_011069683.1|  PREDICTED: endoglucanase 1-like                  95.9    2e-19   
ref|XP_002977531.1|  hypothetical protein SELMODRAFT_417347           95.9    2e-19   
ref|XP_004298838.1|  PREDICTED: endoglucanase 20-like                 95.9    2e-19   
ref|XP_010906451.1|  PREDICTED: endoglucanase 1-like                  95.9    2e-19   
ref|XP_009393121.1|  PREDICTED: endoglucanase 1-like                  95.9    3e-19   
ref|XP_008784873.1|  PREDICTED: endoglucanase 1-like                  95.9    3e-19   
gb|KGN65598.1|  hypothetical protein Csa_1G467175                     90.5    3e-19   
dbj|BAL41418.1|  endo-1,4-beta-glucanase                              95.5    4e-19   
gb|EYU19432.1|  hypothetical protein MIMGU_mgv1a005008mg              95.5    4e-19   
gb|KDP36939.1|  hypothetical protein JCGZ_08230                       95.5    4e-19   
ref|XP_006827988.1|  hypothetical protein AMTR_s00008p00230370        90.5    4e-19   
ref|XP_011022406.1|  PREDICTED: endoglucanase 1-like isoform X2       95.1    4e-19   
gb|AEO97202.1|  endo-1,4-beta-glucanase                               95.1    4e-19   
gb|ABY58175.1|  endo-1,4-D-glucanase                                  93.2    4e-19   
gb|AFZ78636.1|  korrigan                                              95.1    4e-19   
ref|XP_006385809.1|  hypothetical protein POPTR_0003s14740g           95.5    5e-19   
ref|XP_002302191.1|  hypothetical protein POPTR_0002s07200g           92.0    5e-19   
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                  94.0    5e-19   
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                       95.1    6e-19   
ref|XP_011022404.1|  PREDICTED: endoglucanase 1-like isoform X1       95.1    6e-19   
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                             94.7    7e-19   
gb|KHN07637.1|  Endoglucanase 1                                       94.7    7e-19   
gb|KJB14408.1|  hypothetical protein B456_002G123700                  95.1    7e-19   
ref|XP_006836842.1|  hypothetical protein AMTR_s00099p00070580        94.7    7e-19   
ref|XP_001763929.1|  predicted protein                                95.5    7e-19   
dbj|BAF42037.1|  cellulase2                                           95.1    7e-19   
emb|CDY10895.1|  BnaC01g15100D                                        94.7    7e-19   
gb|AGG19097.1|  cellulase                                             93.6    7e-19   
ref|XP_004292399.2|  PREDICTED: endoglucanase 9-like                  94.7    7e-19   
ref|XP_010676410.1|  PREDICTED: endoglucanase-like isoform X1         94.7    7e-19   
ref|XP_010676411.1|  PREDICTED: endoglucanase-like isoform X2         94.0    8e-19   
ref|XP_008239259.1|  PREDICTED: endoglucanase CX                      94.7    8e-19   
ref|XP_007209935.1|  hypothetical protein PRUPE_ppa004653mg           94.7    8e-19   
ref|XP_003552557.1|  PREDICTED: endoglucanase 1                       94.7    8e-19   
gb|ABD62082.1|  endo-1,4-beta-glucancase precursor                    94.0    8e-19   
gb|ABY58176.1|  endo-1,4-D-glucanase                                  92.4    8e-19   
ref|XP_009592543.1|  PREDICTED: endoglucanase 17-like                 94.7    8e-19   
ref|XP_003521576.1|  PREDICTED: endoglucanase 17                      94.4    1e-18   
gb|KCW69215.1|  hypothetical protein EUGRSUZ_F02731                   93.6    1e-18   
ref|XP_008448558.1|  PREDICTED: endoglucanase CX-like                 94.0    1e-18   
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                  94.4    1e-18   
ref|XP_004502058.1|  PREDICTED: endoglucanase 1-like                  94.0    1e-18   
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                 94.0    1e-18   
ref|XP_007050983.1|  Glycosyl hydrolase 9B13                          94.4    1e-18   
ref|XP_002440523.1|  hypothetical protein SORBIDRAFT_09g002490        94.0    1e-18   
gb|AGC94751.1|  endoglucanase-1,4-beta glucanase 6                    94.4    1e-18   
gb|ABY58189.1|  endo-1,4-D-glucanase                                  91.7    1e-18   
gb|ABY58190.1|  endo-1,4-D-glucanase                                  91.7    1e-18   
gb|ABY58177.1|  endo-1,4-D-glucanase                                  91.7    1e-18   
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                 94.0    1e-18   
ref|XP_004146136.1|  PREDICTED: endoglucanase 1-like                  93.6    1e-18   
ref|XP_004159715.1|  PREDICTED: endoglucanase 1-like                  93.6    2e-18   
ref|XP_009788905.1|  PREDICTED: endoglucanase 17-like                 93.6    2e-18   
ref|XP_007163509.1|  hypothetical protein PHAVU_001G239900g           93.6    2e-18   
emb|CDX72723.1|  BnaC07g47450D                                        93.6    2e-18   
ref|XP_009101910.1|  PREDICTED: endoglucanase 23-like                 93.6    2e-18   
gb|KHN30675.1|  Endoglucanase 17                                      92.8    2e-18   
gb|ACJ83779.1|  unknown                                               87.8    2e-18   
ref|XP_007017776.1|  EG isoform 2                                     93.6    2e-18   
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein       93.6    2e-18   
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                  93.6    2e-18   
ref|XP_007017775.1|  EG isoform 1                                     93.2    3e-18   
emb|CDP07412.1|  unnamed protein product                              93.2    3e-18   
gb|ABK96199.1|  unknown                                               90.9    3e-18   
emb|CDP04111.1|  unnamed protein product                              88.2    3e-18   
ref|XP_003536878.1|  PREDICTED: endoglucanase 17-like                 92.8    3e-18   
ref|XP_002518918.1|  endo-1,4-beta-glucanase, putative                92.8    3e-18   
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                93.2    3e-18   
ref|XP_009137168.1|  PREDICTED: endoglucanase 20                      92.8    3e-18   
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                 92.8    3e-18   
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                  93.2    3e-18   
ref|XP_010064810.1|  PREDICTED: endoglucanase 25-like                 93.6    3e-18   
ref|XP_006842476.1|  hypothetical protein AMTR_s00077p00078180        90.9    4e-18   
gb|KJB43353.1|  hypothetical protein B456_007G195700                  92.8    4e-18   
ref|XP_002982868.1|  hypothetical protein SELMODRAFT_117027           92.4    4e-18   
ref|XP_009103215.1|  PREDICTED: endoglucanase 3                       92.4    4e-18   
ref|XP_002990970.1|  hypothetical protein SELMODRAFT_132689           92.4    4e-18   
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                  92.8    4e-18   
ref|XP_010094077.1|  Endoglucanase 13                                 92.4    4e-18   
ref|XP_006413541.1|  hypothetical protein EUTSA_v10025071mg           92.4    4e-18   
ref|XP_010269597.1|  PREDICTED: endoglucanase 17-like                 92.4    4e-18   
emb|CDY25758.1|  BnaA07g10240D                                        92.4    4e-18   
dbj|BAB32662.1|  beta-1,4-glucanase                                   92.4    4e-18   
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg              92.4    4e-18   
ref|XP_010533541.1|  PREDICTED: endoglucanase 1-like                  92.4    4e-18   
ref|XP_007145197.1|  hypothetical protein PHAVU_007G218400g           92.4    5e-18   
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                 92.4    5e-18   
ref|XP_003629333.1|  Endoglucanase                                    92.4    5e-18   
gb|KFK44376.1|  hypothetical protein AALP_AA1G249400                  92.0    5e-18   
ref|XP_002451429.1|  hypothetical protein SORBIDRAFT_04g001960        92.4    5e-18   
ref|NP_001288415.1|  endoglucanase 4-like                             92.4    6e-18   
gb|KDO76516.1|  hypothetical protein CISIN_1g006835mg                 90.5    6e-18   
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                 92.4    6e-18   
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                  92.4    6e-18   
gb|AIW39765.1|  putative endoglucanase 4 precursor                    92.0    6e-18   
ref|XP_007209103.1|  hypothetical protein PRUPE_ppa005285mg           91.7    6e-18   
gb|AIW39772.1|  putative endoglucanase 4 precursor                    92.0    6e-18   
gb|KEH27425.1|  endo-1,4-beta-glucanase                               90.1    6e-18   
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                      92.0    6e-18   
ref|XP_002523114.1|  endo-1,4-beta-glucanase, putative                92.0    6e-18   
ref|XP_009343864.1|  PREDICTED: endoglucanase 20-like                 92.0    6e-18   
ref|XP_002509863.1|  endo-1,4-beta-glucanase, putative                92.0    7e-18   
ref|XP_006646814.1|  PREDICTED: endoglucanase 4-like                  92.0    7e-18   
ref|XP_009363387.1|  PREDICTED: endoglucanase 20-like                 92.0    7e-18   
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                  92.0    7e-18   
ref|XP_003518974.1|  PREDICTED: endoglucanase 17                      92.0    7e-18   
ref|XP_010088306.1|  Endoglucanase 17                                 92.0    7e-18   
ref|XP_011041734.1|  PREDICTED: endoglucanase 4-like                  91.7    7e-18   
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                 92.4    7e-18   
ref|XP_002868877.1|  glycosyl hydrolase family 9 protein              91.7    7e-18   
gb|KFK28905.1|  hypothetical protein AALP_AA7G063600                  91.7    7e-18   
ref|XP_010660138.1|  PREDICTED: endoglucanase 1                       91.7    7e-18   
ref|XP_011010933.1|  PREDICTED: endoglucanase 4-like                  91.7    7e-18   
emb|CBI36884.3|  unnamed protein product                              91.3    7e-18   
ref|XP_008792937.1|  PREDICTED: endoglucanase 15-like                 90.9    7e-18   
ref|XP_003591494.1|  Endo-1 4-beta-glucanase                          91.7    8e-18   
dbj|BAA85150.1|  endo-1,4-beta-glucanase                              91.7    8e-18   
gb|EPS68604.1|  endo-1,4-beta-glucanase                               90.9    8e-18   
gb|KHN00484.1|  Endoglucanase 24                                      91.7    8e-18   
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                 92.0    8e-18   
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                 92.0    8e-18   
gb|KDO76515.1|  hypothetical protein CISIN_1g006835mg                 90.1    8e-18   
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1       90.5    9e-18   
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg           91.7    9e-18   
emb|CDY29381.1|  BnaA06g14150D                                        92.0    9e-18   
ref|XP_010053064.1|  PREDICTED: endoglucanase 1-like                  91.7    9e-18   
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                 91.3    9e-18   
emb|CAZ96184.1|  endoglucanase 4 precursor                            91.7    9e-18   
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                 91.7    9e-18   
ref|XP_006653871.1|  PREDICTED: endoglucanase 13-like                 92.0    9e-18   
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                 91.7    9e-18   
gb|KDP28191.1|  hypothetical protein JCGZ_13962                       91.7    9e-18   
gb|KJB58121.1|  hypothetical protein B456_009G195400                  90.5    9e-18   
ref|XP_010104437.1|  Endoglucanase 24                                 91.7    9e-18   
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                       91.7    9e-18   
gb|AAL30455.1|AF362950_1  endo-beta-1,4-glucanase precursor           89.7    1e-17   
ref|XP_004495939.1|  PREDICTED: endoglucanase 17-like                 91.3    1e-17   
ref|NP_001234882.1|  endo-1,4-beta-glucanase precursor                91.7    1e-17   
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                       91.7    1e-17   
gb|KDO76744.1|  hypothetical protein CISIN_1g010632mg                 90.5    1e-17   
ref|XP_001768182.1|  predicted protein                                91.7    1e-17   
ref|NP_173423.1|  glycosyl hydrolase 9B5                              91.7    1e-17   
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2       90.1    1e-17   
gb|AFW69912.1|  hypothetical protein ZEAMMB73_844086                  88.2    1e-17   
ref|XP_010112045.1|  Endoglucanase 9                                  91.3    1e-17   
gb|ABC70313.1|  endo-1,4-beta-glucanase precursor                     90.5    1e-17   
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                 91.3    1e-17   



>gb|AFR40584.1| cellulase, partial [Populus nigra]
Length=131

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK+SYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKISYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTMKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40585.1| cellulase, partial [Populus nigra]
 gb|AFR40590.1| cellulase, partial [Populus nigra]
 gb|AFR40592.1| cellulase, partial [Populus nigra]
 gb|AFR40593.1| cellulase, partial [Populus nigra]
Length=131

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK+SYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKISYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40563.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40564.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40565.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40566.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40567.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40568.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40569.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40570.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40571.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40572.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40573.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40574.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40575.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40576.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40577.1| cellulase, partial [Populus trichocarpa]
Length=131

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40589.1| cellulase, partial [Populus nigra]
Length=131

 Score =   180 bits (457),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK+ YVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKIXYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTXKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40578.1| cellulase, partial [Populus fremontii]
 gb|AFR40579.1| cellulase, partial [Populus fremontii]
 gb|AFR40580.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFRDVRANYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40581.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFRDVRXNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40588.1| cellulase, partial [Populus nigra]
Length=131

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK  YVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKXXYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLV ALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFHDVRTNYNYTEPTIAGNAGLVXALVALSGDKTTGIDKNTIFSAV  115



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   181 bits (460),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPK KV+YNCKGGWKWRD+ KPNPNILVGAMVAGP
Sbjct  111  NPRKMSYIVGFGNHYPKHVHHRGASIPKTKVKYNCKGGWKWRDTSKPNPNILVGAMVAGP  170

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSG++S  IDKNT+FSAV
Sbjct  171  DRHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGDKSIPIDKNTLFSAV  220



>gb|AID55380.1| glycoside hydrolase family 9 A2 [Gossypium hirsutum]
Length=621

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRDSKKPNPN LVGAMVAGP
Sbjct  496  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDSKKPNPNTLVGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNTIFSAV
Sbjct  556  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTGIDKNTIFSAV  605



>gb|KJB70736.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=621

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRDSKKPNPN LVGAMVAGP
Sbjct  496  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDSKKPNPNTLVGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNTIFSAV
Sbjct  556  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTGIDKNTIFSAV  605



>gb|KDP32467.1| hypothetical protein JCGZ_13392 [Jatropha curcas]
Length=620

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRDSKKPNPN LVGAMVAGP
Sbjct  495  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDSKKPNPNTLVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++TRIDKNTIFSAV
Sbjct  555  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTRIDKNTIFSAV  604



>gb|AAZ08322.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=456

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  331  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  390

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S +IDKNTIFSAV
Sbjct  391  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGSAKIDKNTIFSAV  440



>gb|AFR40583.1| cellulase, partial [Populus nigra]
Length=122

 Score =   176 bits (445),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK   VVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKXXXVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTMKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40591.1| cellulase, partial [Populus nigra]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK  YVVGFGNHYPKHVHHRGASIPKN +RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKXXYVVGFGNHYPKHVHHRGASIPKNXIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFXDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|ADB82903.1| membrane-bound endo-beta-1,4-glucanase [Populus alba x Populus 
grandidentata]
Length=619

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DGHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_006385837.1| endo-1 family protein [Populus trichocarpa]
 gb|ERP63634.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>gb|AHA41508.1| endo-1,4 -beta-glucanase [Populus deltoides]
Length=619

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_007147545.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
 gb|ESW19539.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
Length=619

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSG++ST IDKNTIFSAV
Sbjct  554  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGDKSTSIDKNTIFSAV  603



>gb|AAT75041.1| Cel9A [Populus tremula x Populus tremuloides]
Length=619

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>gb|AEO97252.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97267.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97239.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97240.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97241.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97243.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97244.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97245.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97247.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97248.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97250.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97251.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97254.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97256.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97258.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97259.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97263.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97266.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97269.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97270.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97272.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97182.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97209.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97236.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97237.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97242.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97246.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97249.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97253.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97255.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97257.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97260.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97261.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97262.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97264.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97268.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97271.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97273.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97274.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78626.1| korrigan [Populus tomentosa]
Length=610

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97184.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97211.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97238.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>emb|CBI29606.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS KPNPN LVGAMVAGP
Sbjct  376  NPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGP  435

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  436  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV  485



>gb|AEO97265.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>ref|XP_010065200.1| PREDICTED: endoglucanase 25-like [Eucalyptus grandis]
 gb|KCW62542.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=623

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  498  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S +IDKNTIFSAV
Sbjct  558  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGSAKIDKNTIFSAV  607



>gb|AAS45400.1| endo-1,4-beta-glucanase [Populus tremuloides]
Length=619

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>gb|AFR40586.1| cellulase, partial [Populus nigra]
Length=126

 Score =   173 bits (438),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK  YVVGFGNHYPKHVHHRGASIPKN +RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  6    NPRKXXYVVGFGNHYPKHVHHRGASIPKNXIRYNCKGGWKWRDTMKPNPNTLVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSA  354
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSA
Sbjct  66   DRHDGFXDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSA  114



>ref|XP_003546229.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=618

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  493  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNTIFSAV
Sbjct  553  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTSIDKNTIFSAV  602



>gb|KHN14382.1| Endoglucanase 25 [Glycine soja]
Length=652

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  527  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGP  586

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNTIFSAV
Sbjct  587  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTSIDKNTIFSAV  636



>ref|XP_011022354.1| PREDICTED: endoglucanase 25-like [Populus euphratica]
Length=619

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNKVRYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKVRYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR+NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DRHDGFHDVRSNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_002519394.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF43011.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=621

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  496  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTIVGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +T+IDKNTIFSAV
Sbjct  556  DRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGTTKIDKNTIFSAV  605



>emb|CAN68337.1| hypothetical protein VITISV_025978 [Vitis vinifera]
Length=616

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS KPNPN LVGAMVAGP
Sbjct  491  NPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  551  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV  600



>gb|AEO97283.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97288.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97291.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97292.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97294.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97297.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97299.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97300.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97302.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97303.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97305.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97306.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97308.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97309.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97310.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97183.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97210.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97275.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97276.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97277.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97278.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97279.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97280.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97281.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97282.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97284.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97285.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97286.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97287.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97289.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97290.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97293.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97295.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97296.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97298.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97301.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97304.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97307.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97311.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97312.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97313.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78627.1| korrigan [Populus tomentosa]
Length=610

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97185.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97212.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  485  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  544

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  545  DRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  594



>ref|XP_002299405.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE84210.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  603



>gb|AFY03622.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=623

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  498  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+   +IDKNTIFSAV
Sbjct  558  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGXAKIDKNTIFSAV  607



>gb|ADY68794.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNTIFSAV  603



>gb|ADY68792.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium herbaceum 
subsp. africanum]
Length=619

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNTIFSAV  603



>gb|AAP83128.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNTIFSAV  603



>gb|AAS87601.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68790.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70799.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70801.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70805.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70807.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNTIFSAV  603



>gb|ABD62083.1| endo-1,4-beta-glucancase precursor [Glycine max]
Length=604

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGAS+PKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  493  NPRKMSYVVGFGNHYPKHVHHRGASVPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ T IDKNTIFSAV
Sbjct  553  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKGTSIDKNTIFSAV  602



>ref|XP_003535026.1| PREDICTED: endoglucanase 25 [Glycine max]
 gb|KHN40745.1| Endoglucanase 25 [Glycine soja]
Length=618

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGAS+PKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  493  NPRKMSYVVGFGNHYPKHVHHRGASVPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ T IDKNTIFSAV
Sbjct  553  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKGTSIDKNTIFSAV  602



>gb|KJB66548.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=618

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  493  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  553  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNTIFSAV  602



>gb|AEN70816.1| endo-1,4-beta-glucanase [Gossypium gossypioides]
Length=619

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNTIFSAV  603



>gb|AAQ08018.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68793.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium raimondii]
 gb|ADY68795.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|AEN70795.1| endo-1,4-beta-glucanase [Gossypium thurberi]
 gb|AEN70796.1| endo-1,4-beta-glucanase [Gossypium laxum]
 gb|AEN70800.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70813.1| endo-1,4-beta-glucanase [Gossypium davidsonii]
 gb|AEN70814.1| endo-1,4-beta-glucanase [Gossypium klotzschianum]
 gb|AEN70815.1| endo-1,4-beta-glucanase [Gossypium aridum]
 gb|AEN70817.1| endo-1,4-beta-glucanase [Gossypium lobatum]
 gb|AEN70818.1| endo-1,4-beta-glucanase [Gossypium trilobum]
 gb|AID55374.1| glycoside hydrolase family 9 A1 [Gossypium hirsutum]
 gb|KJB66547.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=619

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNTIFSAV  603



>gb|AEN70798.1| endo-1,4-beta-glucanase [Gossypium turneri]
 gb|AEN70811.1| endo-1,4-beta-glucanase [Gossypium armourianum]
 gb|AEN70812.1| endo-1,4-beta-glucanase [Gossypium harknessii]
Length=619

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNTIFSAV  603



>ref|XP_004238641.1| PREDICTED: endoglucanase 25-like [Solanum lycopersicum]
Length=616

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGAS+PKNKV+YNCKGGWKWRDS KPNPNILVGAMVAGP
Sbjct  491  NPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDSSKPNPNILVGAMVAGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNTIFSAV
Sbjct  551  DKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   185 bits (470),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS KPNPN LVGAMVAGP
Sbjct  493  NPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  553  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV  602



>ref|XP_010088712.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36893.1| Endoglucanase 25 [Morus notabilis]
Length=622

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNK++YNCKGGW WRD+K PNPN++VGAMVAGP
Sbjct  497  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWHWRDTKNPNPNVIVGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAAL+ALSGE++  IDKNTIFSAV
Sbjct  557  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALIALSGEKNAGIDKNTIFSAV  606



>gb|AGV22123.1| endo-1,4-beta-glucanase 1 [Betula luminifera]
Length=618

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS  PNPN +VGAMVAGP
Sbjct  493  NPRKMSYVVGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSNPNPNTIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +T IDKNTIFSAV
Sbjct  553  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDSTTGIDKNTIFSAV  602



>gb|KHN40215.1| Endoglucanase 25 [Glycine soja]
Length=122

 Score =   170 bits (430),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  668  MSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHD  489
            MSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGPD HD
Sbjct  1    MSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGPDKHD  60

Query  488  GFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
             FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT+FSAV
Sbjct  61   HFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTLFSAV  106



>gb|AEN70809.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNKLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNTIFSAV  603



>gb|AEN70810.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNKLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNTIFSAV  603



>ref|XP_011088109.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=596

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS KPNPN +VGAMVAGP
Sbjct  471  NPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPNTIVGAMVAGP  530

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S  IDKNTIFSAV
Sbjct  531  DRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDSSVGIDKNTIFSAV  580



>gb|ADY68791.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70802.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70803.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70804.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70806.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70808.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK+SYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKLSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNTIFSAV  603



>gb|AFD33696.1| korrigan [Eucalyptus camaldulensis]
Length=623

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYP+ VHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  498  NPRKMSYIVGFGNHYPRRVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S +IDKNTIFSAV
Sbjct  558  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGSAKIDKNTIFSAV  607



>gb|KDO53876.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=441

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNK+RYNCKGGWK RDS KPNPN LVGA+VAGP
Sbjct  315  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKLRDSSKPNPNTLVGALVAGP  374

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS-TRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S T IDKNTIFSAV
Sbjct  375  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSRTTIDKNTIFSAV  425



>ref|XP_003594425.1| Endoglucanase [Medicago truncatula]
 gb|ABD32918.1| Glycoside transferase, six-hairpin, subgroup [Medicago truncatula]
 gb|AES64676.1| membrane-anchored endo-1,4-beta-glucanase [Medicago truncatula]
Length=622

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHR ASIPKNKV+YNCKGGWKWR+S KPNPNILVGAMVAGP
Sbjct  497  NPRKMSYVVGFGNHYPKHVHHRAASIPKNKVKYNCKGGWKWRESSKPNPNILVGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR NYNYTEPTLAGNAGLVAALVALSG++S  IDKNT+FSAV
Sbjct  557  DRHDGFHDVRKNYNYTEPTLAGNAGLVAALVALSGDKSIPIDKNTLFSAV  606



>gb|AEN70797.1| endo-1,4-beta-glucanase [Gossypium schwendimanii]
Length=619

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD F DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  554  DKHDAFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNTIFSAV  603



>ref|XP_011092233.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=617

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGAS+PKNKV+YNCKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  492  NPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S  IDKNTIFSAV
Sbjct  552  DRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDTSMTIDKNTIFSAV  601



>ref|XP_003529689.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT+FSAV
Sbjct  554  DKHDHFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTLFSAV  603



>ref|XP_006356407.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=616

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGAS+PKNKV+YNCKGGWKWRDS KPNPN LVGAMVAGP
Sbjct  491  NPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDSSKPNPNTLVGAMVAGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNTIFSAV
Sbjct  551  DKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_004171003.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Cucumis 
sativus]
Length=622

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 3/113 (3%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTTKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG---ERSTRIDKNTIFSAV  351
            D  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG   E++T IDKNTIFSAV
Sbjct  554  DKRDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGENSEKATGIDKNTIFSAV  606



>ref|XP_004133745.1| PREDICTED: endoglucanase 25-like [Cucumis sativus]
 gb|KGN56301.1| hypothetical protein Csa_3G113920 [Cucumis sativus]
Length=622

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 3/113 (3%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTTKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG---ERSTRIDKNTIFSAV  351
            D  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG   E++T IDKNTIFSAV
Sbjct  554  DKRDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGENSEKATGIDKNTIFSAV  606



>ref|XP_004486415.1| PREDICTED: endoglucanase 25-like [Cicer arietinum]
Length=620

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGN+YPKHVHHRGASIPKNKV+YNCKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  495  NPRKMSYIVGFGNNYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR NYNYTEPTLAGNAGLVAALVALSG+RS  IDKNT+FSAV
Sbjct  555  DRHDGFHDVRMNYNYTEPTLAGNAGLVAALVALSGDRSIPIDKNTLFSAV  604



>ref|XP_003550680.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT+FSAV
Sbjct  554  DKHDHFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTLFSAV  603



>ref|XP_009600540.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=617

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS K NPNI+VGAMVAGP
Sbjct  492  NPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSSKANPNIIVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSG+R   +DKNTIFSAV
Sbjct  552  DKHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGDRDVGVDKNTIFSAV  601



>ref|XP_009770880.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=619

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS K NPNI+VGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSSKANPNIIVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSG+R   +DKNTIFSAV
Sbjct  554  DKHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGDRDIGVDKNTIFSAV  603



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   182 bits (463),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKH+HHRGASIPKNKVRYNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  495  NPRKMSYIVGFGNHYPKHLHHRGASIPKNKVRYNCKGGWKWRDTTKPNPNSLVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSA  354
            D HDGF DVRTNYNYTEPT+AGNAGLVAALVA SG+++T IDKNTIFSA
Sbjct  555  DRHDGFRDVRTNYNYTEPTIAGNAGLVAALVASSGDKTTGIDKNTIFSA  603



>ref|XP_007154086.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
 gb|ESW26080.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
Length=620

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHR ASIPKNK++YNCKGGWKWRD+ KPNP+ +VGAMVAGP
Sbjct  495  NPRKMSYIVGFGNHYPKHVHHRAASIPKNKIKYNCKGGWKWRDTSKPNPHTIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S+ IDKNT+FSAV
Sbjct  555  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSSGIDKNTLFSAV  604



>ref|NP_001284449.1| endoglucanase 25-like [Cucumis melo]
 dbj|BAF30815.1| endoglucanase [Cucumis melo]
Length=622

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 3/113 (3%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTTKPNPNTLVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG---ERSTRIDKNTIFSAV  351
            D  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG   E++T IDKNTIFSAV
Sbjct  554  DRRDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGENSEKATGIDKNTIFSAV  606



>ref|XP_010533226.1| PREDICTED: endoglucanase 25 [Tarenaya hassleriana]
Length=622

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG+ YPKHVHHRGASIPKNK+RYNCKGGWKWRDSKKPNPN +VGAMVAGP
Sbjct  496  NPRKMSYVVGFGDRYPKHVHHRGASIPKNKIRYNCKGGWKWRDSKKPNPNTVVGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ S  IDKNTIFSAV
Sbjct  556  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKDSGSIDKNTIFSAV  606



>gb|KDO53875.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=620

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNK+RYNCKGGWK RDS KPNPN LVGA+VAGP
Sbjct  494  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKLRDSSKPNPNTLVGALVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS-TRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S T IDKNTIFSAV
Sbjct  554  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSRTTIDKNTIFSAV  604



>ref|XP_006431347.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 ref|XP_006470776.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
 gb|ESR44587.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 gb|KDO53874.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=621

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHRGASIPKNK+RYNCKGGWK RDS KPNPN LVGA+VAGP
Sbjct  495  NPRKMSYIVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKLRDSSKPNPNTLVGALVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS-TRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S T IDKNTIFSAV
Sbjct  555  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSRTTIDKNTIFSAV  605



>gb|AIE16186.1| endo-1,4-beta-glucanase [Nicotiana tabacum]
Length=617

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS K NPNI+VGAMVAGP
Sbjct  492  NPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSSKANPNIIVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHD R+NYNYTEPTLAGNAGLVAALVALSG+R   +DKNTIFSAV
Sbjct  552  DKHDGFHDARSNYNYTEPTLAGNAGLVAALVALSGDRDVGVDKNTIFSAV  601



>ref|XP_010682188.1| PREDICTED: endoglucanase 25 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG HYPKHVHHRGASIPKNK++Y+CKGGWKWRD+KKPNPN +VGAMVAGP
Sbjct  494  NPRKMSYLVGFGKHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTKKPNPNTIVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNT+FSAV
Sbjct  554  DRHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNTMFSAV  603



>ref|XP_008347974.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 13, partial 
[Malus domestica]
Length=629

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGP
Sbjct  69   NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTSKANPNTIDGAMVAGP  128

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSAV
Sbjct  129  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV  178



>ref|XP_008339246.1| PREDICTED: endoglucanase 25-like [Malus domestica]
Length=622

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ K NPN + GAMVAGP
Sbjct  497  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTPKANPNTIDGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSAV
Sbjct  557  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV  606



>emb|CDP17765.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYP+ VHHRGASIPKNK++YNCKGGWK RDS+ PNPN LVGAMVAGP
Sbjct  491  NPRKMSYVVGFGNHYPRRVHHRGASIPKNKIKYNCKGGWKLRDSRNPNPNTLVGAMVAGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSGE+S  +DKNTIFSAV
Sbjct  551  DKFDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGEKSVGVDKNTIFSAV  600



>gb|AFR40582.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKM  VVGFGNHYPKHVHHRGA IPKNK+RYNCKGG  WRD+ KPNPN  VGAMVAGP
Sbjct  6    NPRKMXXVVGFGNHYPKHVHHRGAXIPKNKIRYNCKGGXXWRDTTKPNPNXXVGAMVAGP  65

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  66   DRHDGFRDVRXNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_009765308.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=616

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGN YPK VHHRGASIPKNKV+YNCKGGWKWRDS K NPN LVGAMVAGP
Sbjct  491  NPRKMSYVVGFGNRYPKRVHHRGASIPKNKVKYNCKGGWKWRDSSKNNPNTLVGAMVAGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNTIFSAV
Sbjct  551  DKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_009595607.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=616

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGN YPK VHHRGASIPKNKV+YNCKGGWKWRDS K NPN LVGAMVAGP
Sbjct  491  NPRKMSYVVGFGNRYPKRVHHRGASIPKNKVKYNCKGGWKWRDSSKNNPNTLVGAMVAGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNTIFSAV
Sbjct  551  DKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_010521418.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=620

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG+ YPKHVHHRGASIPKNKVRYNCKGGWKWRDSK PNPN +VGAMVAGP
Sbjct  494  NPRKMSYVVGFGDRYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKNPNPNTIVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKNTIFSAV  351
            D  DGFHD+RTNYNYTEPTLAGNAGLVAALVALSG++ S  IDKNTIFSAV
Sbjct  554  DKRDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGDKDSGSIDKNTIFSAV  604



>ref|XP_006358489.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=617

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWK+RDS K NPN +VGAMVAGP
Sbjct  492  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKYRDSSKANPNTIVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSG+R   IDKNT+FSAV
Sbjct  552  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGDRDVGIDKNTLFSAV  601



>ref|NP_001233943.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
 gb|AAC49704.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
Length=617

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWK+RDS K NPN +VGAMVAGP
Sbjct  492  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKYRDSSKANPNTIVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSG+R   IDKNT+FSAV
Sbjct  552  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGDRDVGIDKNTLFSAV  601



>dbj|BAC22690.1| endo-1,4-beta-D-glucanase [Pyrus communis]
Length=621

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGP
Sbjct  496  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSAV
Sbjct  556  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV  605



>ref|XP_009399913.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=691

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPKHVHHRGASIPKN V+YNCKGGWKWRD+KKPNPN ++GAMVAGP
Sbjct  567  NPKKMSYVVGFGQRYPKHVHHRGASIPKNGVKYNCKGGWKWRDTKKPNPNTIIGAMVAGP  626

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGE ST +DKNTIFSAV
Sbjct  627  DKHDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGE-STGVDKNTIFSAV  675



>dbj|BAF42036.1| cellulase1 [Pyrus communis]
Length=622

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGP
Sbjct  497  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSAV
Sbjct  557  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV  606



>ref|XP_009340771.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Pyrus 
x bretschneideri]
Length=619

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGP
Sbjct  494  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSAV
Sbjct  554  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV  603



>ref|XP_008379019.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Malus domestica]
Length=1066

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGP
Sbjct  497  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTSKANPNTIDGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSAV
Sbjct  557  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV  606



>dbj|BAD95336.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=256

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  129  NPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  188

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  189  DKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  240



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   175 bits (443),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGP
Sbjct  472  NPRKMSYIVGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDTTKPNPNTLVGAMVAGP  531

Query  500  DAHDGFHDVRTNYNYTEPT  444
            D HDGFHDVRTNYNYTEPT
Sbjct  532  DKHDGFHDVRTNYNYTEPT  550



>ref|XP_010266669.1| PREDICTED: endoglucanase 9-like [Nelumbo nucifera]
Length=619

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGN YPKHVHHRGASIPKN+++YNCKGGWKWRD+ KPNPN +VGAMVAGP
Sbjct  495  NPQKMSYVVGFGNRYPKHVHHRGASIPKNRIKYNCKGGWKWRDTPKPNPNTIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+ T IDKNTIFSAV
Sbjct  555  DKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEK-TGIDKNTIFSAV  603



>ref|XP_010533225.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+ VHHRGASIPKNK RYNC+GGWKWRDSKKPNPN +VGAMVAGP
Sbjct  497  NPRKMSYVVGFGERYPRRVHHRGASIPKNKTRYNCRGGWKWRDSKKPNPNTIVGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKNTIFSAV  351
            D HDGFHDVRTNY+YTEPTLAGNAGLVAALVALSG+R S  IDKNTIFSA+
Sbjct  557  DKHDGFHDVRTNYSYTEPTLAGNAGLVAALVALSGDRGSGSIDKNTIFSAL  607



>ref|XP_010088713.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36894.1| Endoglucanase 25 [Morus notabilis]
Length=212

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG+HYPKHV HRGA IP N+++YNCKGGWKWRD+KKPNPN++VGAMVAGP
Sbjct  33   NPRKMSYLVGFGSHYPKHVRHRGAFIPNNEIKYNCKGGWKWRDTKKPNPNVIVGAMVAGP  92

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGFHDVRTNYNY EPTLAGNAGL+AALVALSGE++   DK+ IFSAV
Sbjct  93   DKDDGFHDVRTNYNYAEPTLAGNAGLIAALVALSGEKNVG-DKSAIFSAV  141



>ref|XP_007222007.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
 gb|EMJ23206.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
Length=622

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGN YPKHVHHRGASIPKNK++YNCKGGWKWRD+ K NPN L GAMVAGP
Sbjct  497  NPQKMSYVVGFGNRYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKANPNTLDGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE++  IDKNTIFSAV
Sbjct  557  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKNIGIDKNTIFSAV  606



>ref|XP_008803421.1| PREDICTED: endoglucanase 10-like [Phoenix dactylifera]
Length=617

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+G  YPKHVHHRGASIPKN VRY+CKGGWKWRD+K+PNPN LVGAMVAGP
Sbjct  493  NPQKMSYVVGYGKRYPKHVHHRGASIPKNGVRYSCKGGWKWRDTKRPNPNTLVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLV ALV+LSG + T +DKNTIFSAV
Sbjct  553  DKHDGFHDVRTNYNYTEPTLAGNAGLVFALVSLSGVK-TGVDKNTIFSAV  601



>emb|CDX83181.1| BnaA03g23250D [Brassica napus]
Length=621

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>emb|CAB51903.1| cellulase [Brassica napus]
Length=621

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_006281810.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
 gb|EOA14708.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
Length=621

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VG+G  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGYGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D HDGF DVR NYNYTEPTLAGNAGLVAAL+ALSGE     +IDKNTIFSAV
Sbjct  554  DKHDGFRDVRMNYNYTEPTLAGNAGLVAALIALSGEEEATGKIDKNTIFSAV  605



>gb|AFL65037.1| endoglucanase, partial [Pinus pinaster]
Length=448

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS +PNPN++VGAMVAGP
Sbjct  323  NPMKMSYVVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSPRPNPNVIVGAMVAGP  382

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT+FSAV
Sbjct  383  DKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNTMFSAV  432



>ref|XP_010909007.1| PREDICTED: endoglucanase 10-like [Elaeis guineensis]
Length=617

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+G  YPKHVHHRGASIPKN VRY+CKGGWKWRD+K+PNPN LVGAMVAGP
Sbjct  493  NPQKMSYVVGYGKRYPKHVHHRGASIPKNGVRYSCKGGWKWRDTKRPNPNTLVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLV ALV+LSG + T +DKNTIFSAV
Sbjct  553  DRHDGFHDVRTNYNYTEPTLAGNAGLVFALVSLSGVK-TGVDKNTIFSAV  601



>ref|XP_009134026.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DRRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_010938102.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGNHYPKHVHHRGASIPKN VRY+CKGGWKWRD+KKPNP+ + GAMVAGP
Sbjct  498  NPHKMSYVVGFGNHYPKHVHHRGASIPKNGVRYSCKGGWKWRDTKKPNPHTIAGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE++  +DKNTIFSAV
Sbjct  558  DRHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKNG-VDKNTIFSAV  606



>ref|XP_010482263.1| PREDICTED: endoglucanase 25-like [Camelina sativa]
Length=621

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYVVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_009355455.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Pyrus x bretschneideri]
Length=1064

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSY+VGFGN YPKHVHHRGASIPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGP
Sbjct  497  NPKKMSYIVGFGNQYPKHVHHRGASIPKNKIKYSCKGGWKWRDTSKANPNTINGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNTIFSA+
Sbjct  557  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAI  606



>ref|XP_008218604.1| PREDICTED: endoglucanase 25 [Prunus mume]
Length=1109

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGN YPKHVHHRGASIPKNK++YNCKGGWKWRD+ K NPN L GAMVAGP
Sbjct  497  NPQKMSYVVGFGNRYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKANPNTLDGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSA  354
            D HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE++  IDKNTIFSA
Sbjct  557  DKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKNIGIDKNTIFSA  605



>ref|XP_009123553.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGPKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>emb|CDY37768.1| BnaA10g05530D [Brassica napus]
Length=621

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGPKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>emb|CDX71601.1| BnaC09g26420D [Brassica napus]
Length=621

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGPKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_006858422.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
 gb|ERN19889.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
Length=617

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFGNHYPKHVHHR ASIPKNK++Y+CKGGWKWRD+ KP+PN LVGAMVAGP
Sbjct  493  NPRKMSYIVGFGNHYPKHVHHRAASIPKNKIKYSCKGGWKWRDTPKPSPNTLVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTEPTLAGNA LVAALVALSGE S  IDKNTIFSAV
Sbjct  553  DKHDGFKDVRGNYNYTEPTLAGNAALVAALVALSGE-SHSIDKNTIFSAV  601



>ref|XP_010441020.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_010442441.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_002865753.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42012.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEAEATGKIDKNTIFSAV  605



>ref|XP_009406859.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=623

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+K+SYVVGFG  YPKHVHHRGASIPKN V+YNCKGGWKWRD+KKPNPN +VGAMVAGP
Sbjct  499  NPQKLSYVVGFGARYPKHVHHRGASIPKNGVKYNCKGGWKWRDTKKPNPNTIVGAMVAGP  558

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE    +DKNTIFSAV
Sbjct  559  DRHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGE-GNGVDKNTIFSAV  607



>gb|ABR16291.1| unknown [Picea sitchensis]
 gb|ACN40901.1| unknown [Picea sitchensis]
Length=617

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS +PNPN+LVGAMVAGP
Sbjct  492  NPMKMSYLVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSPRPNPNVLVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT+FSAV
Sbjct  552  DKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNTMFSAV  601



>gb|AEL88496.1| membrane-bound endo-1,4-beta-glucanase [Picea glauca]
Length=617

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS +PNPN+LVGAMVAGP
Sbjct  492  NPMKMSYLVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSPRPNPNVLVGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT+FSAV
Sbjct  552  DKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNTMFSAV  601



>ref|XP_004301591.2| PREDICTED: endoglucanase 25 [Fragaria vesca subsp. vesca]
Length=1115

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VGFGNHYPK VHHR ASIPKNK++YNCKGGWKWRDS K NPNI+ GAMVAGP
Sbjct  493  NPAKMSYIVGFGNHYPKRVHHRAASIPKNKIKYNCKGGWKWRDSTKANPNIIEGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF DVR+NYNYTEPTLAGNAGLVAALV LSG++ST IDKNTIFSAV
Sbjct  553  DKRDGFRDVRSNYNYTEPTLAGNAGLVAALVGLSGDKSTGIDKNTIFSAV  602



>gb|AAM63370.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=621

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_010921267.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGN YPKHVHHR ASIPKN V+Y+CKGGWKWRD+KKPNP+ +VGAMVAGP
Sbjct  498  NPRKMSYVVGFGNRYPKHVHHRAASIPKNGVKYSCKGGWKWRDTKKPNPHTIVGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S  +DKNTIFSAV
Sbjct  558  DRRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSG-VDKNTIFSAV  606



>gb|AAK59818.1| AT5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|NP_199783.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 sp|Q38890.1|GUN25_ARATH RecName: Full=Endoglucanase 25; AltName: Full=Cellulase homolog 
OR16pep; AltName: Full=Endo-1,4-beta glucanase 25; AltName: 
Full=Protein KORRIGAN; AltName: Full=Protein RADIALLY SWOLLEN 
2 [Arabidopsis thaliana]
 gb|AAB60304.1| cellulase [Arabidopsis thaliana]
 gb|AAC33467.1| cellulase [Arabidopsis thaliana]
 gb|AAC35344.1| cellulase [Arabidopsis thaliana]
 gb|AAC83240.1| endo-1,4-beta-D-glucanase KORRIGAN [Arabidopsis thaliana]
 dbj|BAA98160.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
 gb|AED95850.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
Length=621

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>gb|AAN72232.1| At5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDKNTIFSAV
Sbjct  554  DKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_007216021.1| hypothetical protein PRUPE_ppa014845mg, partial [Prunus persica]
 gb|EMJ17220.1| hypothetical protein PRUPE_ppa014845mg, partial [Prunus persica]
Length=561

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGNH+PKHVHH GASIPK K++Y CK GWKWRDS KPNP  +VGAMVAGP
Sbjct  434  NPQKMSYVVGFGNHFPKHVHHSGASIPKKKIKYTCKEGWKWRDSLKPNPYTIVGAMVAGP  493

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D HDGFHDVR NYNYTEPTL GNAGLVAALVALSG+R+T  IDKNT+FSA+
Sbjct  494  DKHDGFHDVRANYNYTEPTLVGNAGLVAALVALSGDRTTDGIDKNTMFSAI  544



>emb|CDY21449.1| BnaC03g27480D [Brassica napus]
Length=621

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPPKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  554  DKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_008243721.1| PREDICTED: endoglucanase 9-like [Prunus mume]
Length=564

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGNH+PK VHHRGASIPK K++Y+CKGGWKWR S KPNP  +VGAMVAGP
Sbjct  437  NPQKMSYVVGFGNHFPKQVHHRGASIPKKKIKYSCKGGWKWRGSLKPNPYTIVGAMVAGP  496

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D HDGFHDVR NYNYTEPTL GNAGLVAALVALSG+R+T  IDKNT+FSA+
Sbjct  497  DKHDGFHDVRANYNYTEPTLVGNAGLVAALVALSGDRTTDGIDKNTMFSAI  547



>gb|ABR15471.1| endoglucanase [Pinus taeda]
Length=619

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS +PNPN++VGAMVAGP
Sbjct  494  NPMKMSYLVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSPRPNPNVIVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT+FSAV
Sbjct  554  DKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNTMFSAV  603



>ref|XP_008782747.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGNHYPKHVHHRGASIPKN V+Y+CKGGWKWR++KKPNP+ ++GAMVAGP
Sbjct  498  NPRKMSYVVGFGNHYPKHVHHRGASIPKNGVKYSCKGGWKWRNTKKPNPHNIIGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE++  +DKNTIFSAV
Sbjct  558  DRRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKNG-VDKNTIFSAV  606



>ref|XP_009395086.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+G  YPKHVHHRGASIPKN V+Y+CKGGWKWRD+KKPNPN +VGAMVAGP
Sbjct  495  NPQKMSYVVGYGKRYPKHVHHRGASIPKNGVKYSCKGGWKWRDTKKPNPNTIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALV+LSG  +T IDKNTIFSAV
Sbjct  555  DRHDGFKDVRTNYNYTEPTLAGNAGLVAALVSLSGV-TTGIDKNTIFSAV  603



>ref|XP_008793381.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFGN Y KHVHHRGASIPKN VRY+CKGGWKWRD+K+PNP+ + GAMVAGP
Sbjct  498  NPRKMSYVVGFGNRYAKHVHHRGASIPKNGVRYSCKGGWKWRDTKRPNPHTIFGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAAL+ALSGE++  +DKNTIFSAV
Sbjct  558  DRHDGFRDVRTNYNYTEPTLAGNAGLVAALIALSGEKNG-VDKNTIFSAV  606



>gb|KFK26611.1| hypothetical protein AALP_AA8G271400 [Arabis alpina]
Length=621

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VGFG  YP+ VHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  494  NPRKMSYLVGFGPRYPRRVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D HDGF DVR NYNYTEPTLAGNAGLVAALVALSG+  T   IDKNTIFSAV
Sbjct  554  DKHDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGDEDTAGTIDKNTIFSAV  605



>ref|NP_001183308.1| hypothetical protein [Zea mays]
 gb|ACR36366.1| unknown [Zea mays]
 tpg|DAA45168.1| TPA: hypothetical protein ZEAMMB73_159477 [Zea mays]
Length=619

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGNHYPKHVHHRGASIPKN V Y CKGGWKWRD+KKPNPNI+VGAMVAGP
Sbjct  495  NPLKMSYVVGFGNHYPKHVHHRGASIPKNGVHYGCKGGWKWRDTKKPNPNIIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  555  DRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  603



>ref|XP_009417855.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPKHVHHRGASIPKN V+Y+CKGGWKWRD+KKPNPN + GAMVAGP
Sbjct  496  NPQKMSYVVGFGKRYPKHVHHRGASIPKNGVKYSCKGGWKWRDTKKPNPNTIFGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF DVRTNYNYTEPTLAGNAGLVAALV+LSGE  T +DKNT+FSAV
Sbjct  556  DRQDGFRDVRTNYNYTEPTLAGNAGLVAALVSLSGE-GTGVDKNTMFSAV  604



>ref|XP_006402245.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43698.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=648

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR MSY+VGFG  YPK VHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  521  NPRNMSYLVGFGQKYPKRVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  580

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  581  DKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEDASRTIDKNTIFSAV  632



>ref|XP_006402246.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43699.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=620

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR MSY+VGFG  YPK VHHRGASIPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGP
Sbjct  493  NPRNMSYLVGFGQKYPKRVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDKNTIFSAV  351
            D  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE   S  IDKNTIFSAV
Sbjct  553  DKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEDASRTIDKNTIFSAV  604



>ref|XP_004984503.1| PREDICTED: endoglucanase 9-like [Setaria italica]
Length=619

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFG HYPKHVHHRGASIPKN V Y CKGGWKWRD+KKPNPNI+VGAMVAGP
Sbjct  495  NPLKMSYVVGFGKHYPKHVHHRGASIPKNGVHYGCKGGWKWRDTKKPNPNIIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF D R NYNYTE TLAGNAGLVAALVALSGE S  +DKNT+FSAV
Sbjct  555  DRHDGFKDARKNYNYTEATLAGNAGLVAALVALSGE-SHGVDKNTMFSAV  603



>emb|CDX92628.1| BnaC07g38860D [Brassica napus]
Length=619

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YPKHVHHRGASIPK+  R +CKGGWKWRD++K NPN +VGAMVAGP
Sbjct  493  NPRKMSYVVGFGQRYPKHVHHRGASIPKSVKRESCKGGWKWRDTRKNNPNTIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGER+   IDKNT+FSAV
Sbjct  553  DKHDGFHDLRTNYNYTEPTLAGNAGLVAALVALSGERTFGAIDKNTMFSAV  603



>ref|XP_009137436.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
 emb|CDY10998.1| BnaA03g46570D [Brassica napus]
Length=619

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YPKHVHHRGASIPK+  + +CKGGWKWRD+KK NPN +VGAMVAGP
Sbjct  493  NPRKMSYVVGFGQRYPKHVHHRGASIPKSVKKESCKGGWKWRDTKKNNPNTIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGER+   IDKNT+FSAV
Sbjct  553  DKHDGFHDLRTNYNYTEPTLAGNAGLVAALVALSGERTFGAIDKNTMFSAV  603



>gb|EYU35397.1| hypothetical protein MIMGU_mgv1a003033mg [Erythranthe guttata]
Length=613

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+G HYPK VHHRGASIPKN V+Y CKGG KWRDS K NPNI+VGAMVAGP
Sbjct  488  NPRKMSYVVGYGTHYPKQVHHRGASIPKNNVKYTCKGGLKWRDSTKANPNIIVGAMVAGP  547

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGF D R NYNYTEPTLAGNAGLVAALVALSG+    IDKNTIFSAV
Sbjct  548  DRNDGFKDKRNNYNYTEPTLAGNAGLVAALVALSGDTDVGIDKNTIFSAV  597



>ref|XP_009400506.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSY+VG+G  YPKHVHHRGASIPKN  RY CKGG+KWRDS +PNPN +VGAMVAGP
Sbjct  495  NPRKMSYIVGYGKRYPKHVHHRGASIPKNGARYGCKGGYKWRDSTRPNPNTIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTEPTLAGNAGLVAAL++LSG + T +DKNTIFSAV
Sbjct  555  DRHDGFRDVRVNYNYTEPTLAGNAGLVAALISLSGVK-TGVDKNTIFSAV  603



>ref|XP_010529892.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSY+VGFG  YPK VHHRGASIPKN+ RY+CKGGWKWRDSK PNPNI+VGAMVAGP
Sbjct  497  NPQSMSYIVGFGQRYPKRVHHRGASIPKNRNRYSCKGGWKWRDSKMPNPNIIVGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKNTIFSAV  351
            D  D FHDVR NYNYTEPTLAGNAGLVAALVALSG++ S  IDKNT+FSAV
Sbjct  557  DKRDRFHDVRNNYNYTEPTLAGNAGLVAALVALSGDKDSGSIDKNTMFSAV  607



>ref|NP_001142480.1| uncharacterized protein LOC100274698 [Zea mays]
 gb|ACG24268.1| hypothetical protein [Zea mays]
Length=198

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  71   NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  130

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  131  DRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  182



>ref|XP_006431346.1| hypothetical protein CICLE_v10003884mg, partial [Citrus clementina]
 gb|ESR44586.1| hypothetical protein CICLE_v10003884mg, partial [Citrus clementina]
Length=477

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSY+VGFG+ YP++VHHRGASIPKNK++Y+CKGGWKWR S KPNPN LVGAMVAGP
Sbjct  360  NPQKMSYLVGFGSPYPQYVHHRGASIPKNKIKYSCKGGWKWRHSSKPNPNTLVGAMVAGP  419

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
              HDGFHDVR+NYNYT PTL  NAGLVAALVALSG++ST  IDK+TIF+ V
Sbjct  420  HKHDGFHDVRSNYNYTVPTLHDNAGLVAALVALSGKKSTGGIDKSTIFTEV  470



>ref|XP_002465324.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
 gb|EER92322.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
Length=620

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGNHYPKHVHHRGASIPKN V Y CKGGWKWRD+KKPNPNI+VGAMVAGP
Sbjct  496  NPLKMSYVVGFGNHYPKHVHHRGASIPKNGVHYGCKGGWKWRDTKKPNPNIIVGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD F D R NYNYTE TL GNAGLVAALVALSGE    +DKN +FSAV
Sbjct  556  DRHDRFKDARKNYNYTEATLVGNAGLVAALVALSGE-GHGVDKNAMFSAV  604



>gb|KDO53877.1| hypothetical protein CISIN_1g041590mg [Citrus sinensis]
Length=493

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSY+VGFG+ YP++VHHRGASIPKNK++Y+CK GWKWRDS KPNPN LVGAMVAGP
Sbjct  376  NPQKMSYLVGFGSPYPQYVHHRGASIPKNKIKYSCKRGWKWRDSSKPNPNTLVGAMVAGP  435

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
              HDGFHDVR+NYNYT PTL  NAGLVAALVALSG++ST  IDK+TIF+ V
Sbjct  436  HKHDGFHDVRSNYNYTVPTLHDNAGLVAALVALSGKKSTGGIDKSTIFTEV  486



>ref|NP_001050004.1| Os03g0329500 [Oryza sativa Japonica Group]
 sp|P0C1U4.1|GUN9_ORYSJ RecName: Full=Endoglucanase 9; AltName: Full=Endo-1,4-beta glucanase 
9; AltName: Full=OsCel9D; AltName: Full=OsGLU1 [Oryza 
sativa Japonica Group]
 gb|ABF95745.1| membrane-anchored endo-1,4-beta-glucanase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11918.1| Os03g0329500 [Oryza sativa Japonica Group]
 dbj|BAF37261.1| endo-beta-1,4-D-glucanase [Oryza sativa]
 gb|EAY89858.1| hypothetical protein OsI_11408 [Oryza sativa Indica Group]
Length=619

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+GN YPK VHHRGASIPKN V Y CKGGWKWR++KKPNPNI+VGAMVAGP
Sbjct  495  NPLKMSYVVGYGNRYPKRVHHRGASIPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  555  DRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  603



>gb|EEE58992.1| hypothetical protein OsJ_10702 [Oryza sativa Japonica Group]
Length=619

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+GN YPK VHHRGASIPKN V Y CKGGWKWR++KKPNPNI+VGAMVAGP
Sbjct  495  NPLKMSYVVGYGNRYPKRVHHRGASIPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  555  DRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  603



>ref|NP_001147537.1| endo-1,4-beta-glucanase [Zea mays]
 gb|ACG27857.1| endo-1,4-beta-glucanase [Zea mays]
 gb|AFW88475.1| endo-1,4-beta-glucanase [Zea mays]
Length=620

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFG  YP+HVHHRGASIPKN V Y CKGGWKWRD+KKPNPN + GAMVAGP
Sbjct  495  NPLKMSYVVGFGKRYPRHVHHRGASIPKNGVHYGCKGGWKWRDAKKPNPNTIAGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF D R NYNYTE TLAGNAGLVAALVALSG+    +DKNT+FSAV
Sbjct  555  DRHDGFKDARRNYNYTEATLAGNAGLVAALVALSGDGHGGVDKNTMFSAV  604



>ref|XP_006650027.1| PREDICTED: endoglucanase 9-like [Oryza brachyantha]
Length=619

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMS+VVG+G HYPK VHHRGASIPKN V Y CKGGWKWR++KKPNPNI+VGAMVAGP
Sbjct  495  NPLKMSFVVGYGKHYPKRVHHRGASIPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  555  DHHDGFKDVRRNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  603



>ref|XP_009137865.1| PREDICTED: endoglucanase 21 [Brassica rapa]
Length=610

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSYVV FG  YP+HVHH+GASIPK+  + +CKGGWKWRD+K+ NPNI+VGAMVAGP
Sbjct  484  NPQNMSYVVDFGQRYPRHVHHKGASIPKSVKKESCKGGWKWRDTKRDNPNIIVGAMVAGP  543

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D HDGFHD+R+NYNYTEPTLAGNAGLVAALVALSGE +   IDKNTIFSAV
Sbjct  544  DKHDGFHDLRSNYNYTEPTLAGNAGLVAALVALSGEETLESIDKNTIFSAV  594



>emb|CDY34271.1| BnaA01g13740D [Brassica napus]
Length=561

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSYVV FG  YP+HVHH+GASIPK+  + +CKGGWKWRD+K+ NPNI+VGAMVAGP
Sbjct  435  NPQNMSYVVDFGQRYPRHVHHKGASIPKSVKKESCKGGWKWRDTKRDNPNIIVGAMVAGP  494

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D HDGFHD+R+NYNYTEPTLAGN GLVAALVALSGE +   IDKNTIFSAV
Sbjct  495  DKHDGFHDLRSNYNYTEPTLAGNGGLVAALVALSGEETLESIDKNTIFSAV  545



>gb|EMT00674.1| Endoglucanase 10 [Aegilops tauschii]
Length=555

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  428  NPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGP  487

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDKNTIFSAV
Sbjct  488  DKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDKNTIFSAV  539



>ref|XP_006650552.1| PREDICTED: endoglucanase 10-like [Oryza brachyantha]
Length=618

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR++KK NPNIL+GAMVAGP
Sbjct  494  NPQKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGFKWRETKKANPNILIGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLA NAGLVAAL++LS  + T IDKNTIFSA+
Sbjct  554  DRHDGFKDVRTNYNYTEPTLAANAGLVAALISLSNAK-TGIDKNTIFSAI  602



>gb|EMS52550.1| Endoglucanase 10 [Triticum urartu]
Length=555

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  428  NPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGP  487

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDKNTIFSAV
Sbjct  488  DKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDKNTIFSAV  539



>dbj|BAJ94336.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  494  NPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDKNTIFSAV
Sbjct  554  DKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDKNTIFSAV  605



>dbj|BAA94257.1| endo-1,4-beta-glucanase Cel1 [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  494  NPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDKNTIFSAV
Sbjct  554  DKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDKNTIFSAV  605



>ref|XP_003560035.1| PREDICTED: endoglucanase 10 [Brachypodium distachyon]
Length=621

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  494  NPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS--TRIDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGL+AAL++L+   +  T IDKNTIFSAV
Sbjct  554  DRHDGFKDIRTNYNYTEPTLAANAGLIAALISLADIDTGRTAIDKNTIFSAV  605



>gb|ABP96983.1| cellulase [Colocasia esculenta]
Length=618

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSY+VG+G  YPKHV+HRGASIPKN V+Y CK GWK RD+ KPNPN +VGAM+AGP
Sbjct  494  NPQKMSYLVGYGKRYPKHVYHRGASIPKNGVKYGCKAGWKLRDTTKPNPNTIVGAMIAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAALV+LSG ++  IDKNTIFSAV
Sbjct  554  DKHDGFKDVRTNYNYTEPTLAGNAGLVAALVSLSGVQAG-IDKNTIFSAV  602



>gb|ADQ73896.1| endo-1,4-beta-glucanase [Avena strigosa]
Length=338

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+G  YPK VHHRGASIP N V Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  210  NPQKMSYVVGYGKKYPKRVHHRGASIPHNGVHYGCKGGFKWRESKKANPNILVGAMVAGP  269

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaL----SGERSTRIDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGLVAAL++L    +G R T +DKNTIFSAV
Sbjct  270  DRHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGSR-TSVDKNTIFSAV  322



>emb|CDI66528.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
 emb|CDI66541.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  494  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  554  DRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  605



>emb|CDI66602.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=624

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  497  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  557  DRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  608



>emb|CBB36505.1| Hordeum vulgare protein similar to endo-1,4-b-glucanase BAA94257 
[Saccharum hybrid cultivar R570]
Length=626

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  499  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  558

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  559  DRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  610



>gb|ACZ82300.1| beta-1,4 glycosidase [Phyllostachys edulis]
Length=617

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK VHHR ASIP N V+Y CKGG+KWR+SKK NPNIL+GAMVAGP
Sbjct  493  NPLKMSYVVGFGNKYPKRVHHREASIPHNGVKYGCKGGFKWRESKKANPNILIGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLA NAGLVAAL++LS +  T IDKNT+FSA+
Sbjct  553  DRHDGFKDVRTNYNYTEPTLAANAGLVAALISLS-DVKTGIDKNTLFSAI  601



>gb|EPS69180.1| hypothetical protein M569_05586 [Genlisea aurea]
Length=615

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR+MSYVVGFG  YP HVHHRGASIPKNK + +C+GGWKWRDS KPNPN + GAMVAGP
Sbjct  491  NPRQMSYVVGFGRRYPTHVHHRGASIPKNK-KASCEGGWKWRDSSKPNPNTIRGAMVAGP  549

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVAL+   +  IDKNT+FSAV
Sbjct  550  DRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALAAGDNAGIDKNTMFSAV  599



>gb|ABF98747.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
Length=497

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR++KKPNPNIL+GA+VAGP
Sbjct  371  NPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGP  430

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG-ERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLA NAGLVAAL++L+     + IDKNTIFSAV
Sbjct  431  DRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKNTIFSAV  481



>emb|CDI66566.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YP+  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  494  NPLKMSYVVGFGNKYPRRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  554  DRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  605



>ref|XP_006444448.1| hypothetical protein CICLE_v10024241mg [Citrus clementina]
 gb|ESR57688.1| hypothetical protein CICLE_v10024241mg [Citrus clementina]
Length=610

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSY+VGFG  +P+HV HRGASIPKN ++YNC+GG KWRDS KPNPN+++GAMV GP
Sbjct  488  NPQNMSYIVGFGTRFPQHVLHRGASIPKNNIKYNCQGGRKWRDSAKPNPNVIIGAMVGGP  547

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGF D R+NYNYTEPT+AGNAGLVAALVALSGE++ +ID+NT+F A+
Sbjct  548  DQNDGFLDSRSNYNYTEPTIAGNAGLVAALVALSGEKTAQIDRNTLFYAI  597



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR++KKPNPNIL+GA+VAGP
Sbjct  494  NPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG-ERSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLA NAGLVAAL++L+     + IDKNTIFSAV
Sbjct  554  DRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKNTIFSAV  604



>ref|XP_002463915.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
 gb|EER90913.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
Length=621

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  494  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDG+ DVRTNYNY+EPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  554  DRHDGYKDVRTNYNYSEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  605



>ref|XP_008342152.1| PREDICTED: endoglucanase 9-like [Malus domestica]
Length=511

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR +SY+VGFG  +P+ VHHRGASIPKNK++Y CKGG KWRDSKKPNPNI+VGAMVAGP
Sbjct  386  NPRGISYIVGFGERFPQQVHHRGASIPKNKIKYGCKGGLKWRDSKKPNPNIIVGAMVAGP  445

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD F DVR+NYNYTEPTLAGNAGLVAALVALS      +DKN++F AV
Sbjct  446  DEHDNFQDVRSNYNYTEPTLAGNAGLVAALVALSTGNPAGVDKNSMFYAV  495



>ref|XP_009339798.1| PREDICTED: endoglucanase 9-like [Pyrus x bretschneideri]
Length=618

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR +SY+VGFG  +P+ VHHRGASIPKNK++Y CKGG KWRDSKKPNPNI+VGAMVAGP
Sbjct  493  NPRGISYIVGFGERFPQQVHHRGASIPKNKIKYGCKGGLKWRDSKKPNPNIIVGAMVAGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD F DVR+NYNYTEPTLAGNAGLVAALVALS      +DKN++F AV
Sbjct  553  DEHDNFQDVRSNYNYTEPTLAGNAGLVAALVALSTGNPAGVDKNSMFYAV  602



>ref|XP_006413454.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
 gb|ESQ54907.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
Length=624

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YP+HVHHRGASIP +  + +CKGGWKWRDSKK NPN + GAMVAGP
Sbjct  498  NPRKMSYVVGFGQRYPRHVHHRGASIPMSVKKESCKGGWKWRDSKKGNPNTITGAMVAGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            + +DGFHDVR NYNYTEPTLAGNAGLVAALVALSG ++   IDKNTIFSAV
Sbjct  558  NKYDGFHDVRANYNYTEPTLAGNAGLVAALVALSGGKTVGGIDKNTIFSAV  608



>gb|AAM13693.1| endo-1,4-beta-glucanase [Triticum aestivum]
Length=620

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+ KK NPNILVGAMVAGP
Sbjct  494  NPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWREFKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDKNTIFSAV
Sbjct  554  DKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDKNTIFSAV  605



>ref|XP_003557996.1| PREDICTED: endoglucanase 9 [Brachypodium distachyon]
Length=621

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG+GNHYPKHVHHRGASIPK K V Y CK GWKWRDSKKPNP+I+VGAMVAG
Sbjct  496  NPLKMSYVVGYGNHYPKHVHHRGASIPKKKGVHYGCKEGWKWRDSKKPNPHIVVGAMVAG  555

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HD F DVR NYNYTE TLAGNAGLV ALVALSGE +  +DKNT+FSAV
Sbjct  556  PDRHDRFKDVRKNYNYTEATLAGNAGLVTALVALSGE-AHGLDKNTMFSAV  605



>ref|XP_006480121.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
Length=610

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSY+VGFG  +P+HV HRGASIP+N ++YNC+GG KWRDS KPNPN+++GAMV GP
Sbjct  488  NPQNMSYIVGFGTRFPQHVLHRGASIPRNNIKYNCQGGRKWRDSAKPNPNVIIGAMVGGP  547

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGF D R+NYNYTEPT+AGNAGLVAALVALSGE++ +ID+NT+F A+
Sbjct  548  DQNDGFLDSRSNYNYTEPTIAGNAGLVAALVALSGEKTAQIDRNTLFYAI  597



>gb|KDO87072.1| hypothetical protein CISIN_1g046335mg [Citrus sinensis]
Length=613

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSY+VGFG  +P+HV HRGASIP+N ++YNC+GG KWRDS KPNPN+++GAMV GP
Sbjct  491  NPQNMSYIVGFGTRFPQHVLHRGASIPRNNIKYNCQGGRKWRDSAKPNPNVIIGAMVGGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGF D R+NYNYTEPT+AGNAGLVAALVALSGE++ +ID+NT+F A+
Sbjct  551  DQNDGFLDSRSNYNYTEPTIAGNAGLVAALVALSGEKTAQIDRNTLFYAI  600



>ref|XP_010433798.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=622

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YPK VHHRGASIP+N ++ +CKGG KW  SKK NPNI+ GAMVAGP
Sbjct  497  NPRKMSYVVGFGQRYPKQVHHRGASIPQN-MKESCKGGLKWEKSKKDNPNIIKGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTL+GNAGLVAALVALSGE +   IDKNT+FSAV
Sbjct  556  DKHDGFHDVRTNYNYTEPTLSGNAGLVAALVALSGEEAVGDIDKNTMFSAV  606



>ref|NP_001151770.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
 gb|ACG44266.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  494  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  554  DRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  605



>gb|AFR40587.1| cellulase, partial [Populus nigra]
Length=104

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -2

Query  620  HRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTl  441
            HRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+
Sbjct  1    HRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGPDRHDGFXDVRTNYNYTEPTI  60

Query  440  agnaglvaalvaLSGERSTRIDKNTIFSAV  351
            AGNAGLVAALV LSG+++T IDKNTIFSAV
Sbjct  61   AGNAGLVAALVXLSGDKTTGIDKNTIFSAV  90



>tpg|DAA51201.1| TPA: endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  494  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  554  DRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  605



>gb|ACN28577.1| unknown [Zea mays]
 gb|ACN34658.1| unknown [Zea mays]
 gb|AFW67687.1| hypothetical protein ZEAMMB73_593933 [Zea mays]
Length=621

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+KK NPNILVGAMVAGP
Sbjct  494  NPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  554  DRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNTIFSAI  605



>ref|XP_002515321.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47305.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=598

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MSY+VGFG+H+P+  HHRGASIP +KV+Y CK GW+W+ S++PNPN ++GAMVAGP
Sbjct  473  NPCDMSYIVGFGSHFPQQAHHRGASIPNSKVKYRCKDGWQWQVSRRPNPNTIIGAMVAGP  532

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF D+R NYNYTEPT+AGNAGL+AALVAL+G R+++IDKNTIFSA+
Sbjct  533  DKEDGFQDIRYNYNYTEPTIAGNAGLIAALVALTGGRTSKIDKNTIFSAI  582



>emb|CDY03467.1| BnaC01g16150D [Brassica napus]
Length=561

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSYVV FG  YP+HVHH+GASIPK+  + +CKGGWKWRD+K+ NPN +VGAMVAGP
Sbjct  435  NPQNMSYVVDFGQRYPRHVHHKGASIPKSVKKESCKGGWKWRDTKRDNPNTIVGAMVAGP  494

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D HD FHD+R+NYNYTEPTLAGNAGLVAALVALSGE +   IDKNTIFSAV
Sbjct  495  DKHDEFHDLRSNYNYTEPTLAGNAGLVAALVALSGEETLESIDKNTIFSAV  545



>ref|XP_004981854.1| PREDICTED: endoglucanase 10-like [Setaria italica]
Length=621

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR+SKK NPNILVGAMVAGP
Sbjct  494  NPQKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDKNTIFSAV  351
            D HD F D+RTNYNYTEPTLA NAGLVAAL++++   + R  IDKNTIFSA+
Sbjct  554  DKHDRFKDIRTNYNYTEPTLAANAGLVAALISIADIPTGRYSIDKNTIFSAI  605



>ref|XP_010277803.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=615

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G+ YPKHVHHRGASIP +  +Y+C GGWKWRDS+ PNPN +VGAMV GP
Sbjct  490  NPLKMSYVVGYGSKYPKHVHHRGASIPHDHNKYSCTGGWKWRDSRNPNPNTIVGAMVGGP  549

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTNYNYTEPTLAGNAGLVAALV+L+G     IDKNTIFSAV
Sbjct  550  DRFDQFRDVRTNYNYTEPTLAGNAGLVAALVSLTGSAGGGIDKNTIFSAV  599



>emb|CDY45056.1| BnaA08g02190D [Brassica napus]
Length=540

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSYVVGFG  YPK VHHRGASIPKN+ + +CKGGWKWR+S K NPN++ GAMVAGP
Sbjct  417  NPQNMSYVVGFGERYPKRVHHRGASIPKNR-KESCKGGWKWRESSKENPNVIEGAMVAGP  475

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVRTN NYTEPTL GNAGL+AALVALSG++   +DKN IFSA+
Sbjct  476  DGHDGFHDVRTNSNYTEPTLTGNAGLIAALVALSGQKD-NLDKNGIFSAI  524



>ref|XP_006283336.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
 gb|EOA16234.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
Length=622

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+G  YPKHVHHRGASIP+NK + +C GGWKW+ SK  NPNI+ GAMVAGP
Sbjct  497  NPRKMSYVVGYGQRYPKHVHHRGASIPRNK-KESCTGGWKWKKSKDANPNIIYGAMVAGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG  +   IDKNT+FSAV
Sbjct  556  DKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGGIAVGGIDKNTMFSAV  606



>ref|XP_006403190.1| hypothetical protein EUTSA_v10003366mg, partial [Eutrema salsugineum]
 gb|ESQ44643.1| hypothetical protein EUTSA_v10003366mg, partial [Eutrema salsugineum]
Length=528

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSYVVGFG  YPKHVHHRGASIPKN+ + +CKGGWKWRDSK+ NPN + GAMVAGP
Sbjct  403  NPQNMSYVVGFGERYPKHVHHRGASIPKNE-KVSCKGGWKWRDSKQENPNTIEGAMVAGP  461

Query  500  DAHDGFHDVRTNYNYTEPTla-gnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HDGFHDVR NYNYTEPTL      + A + ALS E   + D N++FSA+
Sbjct  462  DKHDGFHDVRANYNYTEPTLTGNAGLVTAVVAALSAEDKLKFDPNSMFSAL  512



>ref|XP_010448587.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=620

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YPK VHHRGASIP+N ++ +C GG+KW++SKK NPNI+ GAMVAGP
Sbjct  495  NPRKMSYVVGFGQRYPKQVHHRGASIPRN-MKESCTGGYKWKNSKKDNPNIIKGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +   IDKNT+FSAV
Sbjct  554  DKQDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGKEAVWGIDKNTMFSAV  604



>ref|NP_194157.1| endoglucanase 21 [Arabidopsis thaliana]
 sp|Q9STW8.1|GUN21_ARATH RecName: Full=Endoglucanase 21; AltName: Full=Endo-1,4-beta glucanase 
21 [Arabidopsis thaliana]
 emb|CAB45061.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 emb|CAB79336.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 gb|AEE84879.1| endoglucanase 21 [Arabidopsis thaliana]
Length=620

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+G  YPK VHHRGASIPKN ++  C GG+KW+ SKK NPN + GAMVAGP
Sbjct  495  NPRKMSYVVGYGQRYPKQVHHRGASIPKN-MKETCTGGFKWKKSKKNNPNAINGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGE++   IDKNT+FSAV
Sbjct  554  DKHDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGEKAVGGIDKNTMFSAV  604



>gb|KFK22234.1| hypothetical protein AALP_AAs42893U000400 [Arabis alpina]
Length=616

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR MSYVVGFG  YPKHVHHRGASIPKN  + +CKGGW WRD KK NPN + GAMVAGP
Sbjct  489  NPRGMSYVVGFGKRYPKHVHHRGASIPKNAKKQSCKGGWHWRDIKKENPNTIEGAMVAGP  548

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDKNTIFSAV  351
            D HDGFHD+R NYNYTEPTLAGNAGLVAALVAL+   ++   IDKNTIFSAV
Sbjct  549  DKHDGFHDLRINYNYTEPTLAGNAGLVAALVALTRPPNSFGTIDKNTIFSAV  600



>ref|XP_002867672.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=620

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+G  YPK VHHRGASIPKNK R  C GG KW+ SKK NPN + GAMVAGP
Sbjct  495  NPRKMSYVVGYGQRYPKQVHHRGASIPKNK-RETCTGGLKWKKSKKGNPNTIDGAMVAGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSGE+    IDKNT+FSAV
Sbjct  554  DKHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGEKPVGGIDKNTMFSAV  604



>gb|EPS66085.1| hypothetical protein M569_08689 [Genlisea aurea]
Length=615

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRK SYVVGFG+ YP HVHHRGASIPKN+ + +C GGWKWRD  KPNPN++ GAMVAGP
Sbjct  490  NPRKTSYVVGFGSRYPTHVHHRGASIPKNR-KASCAGGWKWRDGPKPNPNVIRGAMVAGP  548

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGE-RSTRIDKNTIFSAV  351
            D HDGF DVRTNYNYTEPTLAGNAGLVAAL++LS       +DKNT+FSAV
Sbjct  549  DRHDGFRDVRTNYNYTEPTLAGNAGLVAALISLSSSGDGVGVDKNTMFSAV  599



>ref|XP_010439066.1| PREDICTED: endoglucanase 21 [Camelina sativa]
Length=618

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVGFG  YPK VHHRGASIP+N ++ +C GG KW  SKK NPNI+ GAMVAGP
Sbjct  493  NPRKMSYVVGFGQRYPKQVHHRGASIPRN-MKESCTGGSKWEKSKKDNPNIIKGAMVAGP  551

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  351
            D HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +   IDKNT+FSAV
Sbjct  552  DKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGKEAVWGIDKNTMFSAV  602



>gb|EMS51342.1| Endoglucanase 9 [Triticum urartu]
Length=694

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG+G HYPK VHHRGASIPK K V   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  569  NPLKMSYVVGYGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAG  628

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF D+R N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  629  PDRHDGFKDIRKNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  678



>gb|KDP28223.1| hypothetical protein JCGZ_13994 [Jatropha curcas]
Length=564

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            N + +SYVVGFGNH+P+HVHHRGASIP +KV+Y C+GGWKWR++++PNPNI+VGAMV GP
Sbjct  450  NHQSISYVVGFGNHFPQHVHHRGASIPNDKVKYGCEGGWKWRNTRRPNPNIIVGAMVGGP  509

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG--ERSTRIDKNTIFSAV  351
            D  D F D+R+NYNYTE T+AGNAGLVAALVALS     S+ IDKNTIF A+
Sbjct  510  DQRDDFQDIRSNYNYTESTIAGNAGLVAALVALSDGPGNSSEIDKNTIFYAI  561



>ref|XP_008235173.1| PREDICTED: endoglucanase 9-like [Prunus mume]
Length=605

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR +SYVVGF  H+P+HVHHRGASIP NK++Y CKGG KWR S+ PNPN +VGAMVAGP
Sbjct  480  NPRGISYVVGFSEHFPQHVHHRGASIPHNKIKYGCKGGLKWRKSRTPNPNTIVGAMVAGP  539

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD F DVR NYNYTEP+L GNAGLVAALVALS    + ID+N++F AV
Sbjct  540  DKHDNFQDVRFNYNYTEPSLVGNAGLVAALVALSSGTPSGIDRNSMFYAV  589



>gb|EMT18790.1| Endoglucanase 9 [Aegilops tauschii]
Length=604

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  479  NPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAG  538

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  539  PDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  588



>ref|XP_002960146.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
 gb|EFJ37685.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
Length=620

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+GN YPK VHHR ASIPKNK +Y C+ GW++RDSKK NPN +VGAMV GP
Sbjct  494  NPRKMSYVVGYGNKYPKQVHHRAASIPKNKRKYGCQEGWRFRDSKKANPNTIVGAMVGGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS-GERSTRIDKNTIFSAV  351
            D  D FHDVR+NYN+TEPTLAGNAGL  ALVALS G+ S+ +D + IFSA+
Sbjct  554  DTKDRFHDVRSNYNFTEPTLAGNAGLAFALVALSGGDSSSGVDASNIFSAI  604



>gb|AGK26801.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  497  NPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAG  556

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  557  PDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  606



>gb|AGK26803.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  497  NPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAG  556

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  557  PDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  606



>gb|AGK26798.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26799.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26800.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  497  NPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAG  556

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  557  PDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  606



>gb|AGK26802.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  497  NPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAG  556

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  557  PDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  606



>dbj|BAK04500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAG  504
            NP KMSYVVG G HYPK VHHRGASIPK K +   CKGGW WRD+KKPNP+I+VGAMVAG
Sbjct  497  NPLKMSYVVGHGKHYPKRVHHRGASIPKKKGIHPGCKGGWTWRDTKKPNPHIIVGAMVAG  556

Query  503  PDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            PD HDGF D+R N NYTEPTLAGNAGLVAALVALSGE    +DKNT+FSAV
Sbjct  557  PDRHDGFKDIRKNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKNTMFSAV  606



>ref|XP_007199407.1| hypothetical protein PRUPE_ppa026228mg [Prunus persica]
 gb|EMJ00606.1| hypothetical protein PRUPE_ppa026228mg [Prunus persica]
Length=605

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR +SYVVGF  H+P+HVHHRGASIP NK++Y CKGG KW++S+ PNPN +VGAMVAGP
Sbjct  480  NPRGISYVVGFSEHFPQHVHHRGASIPHNKIKYGCKGGLKWKNSRTPNPNTIVGAMVAGP  539

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD F DVR NYNYTEP+L GNAGLVAALVALS      ID+N++F AV
Sbjct  540  DKHDNFQDVRFNYNYTEPSLVGNAGLVAALVALSSGTPAGIDRNSMFYAV  589



>gb|EYU33245.1| hypothetical protein MIMGU_mgv1a022358mg, partial [Erythranthe 
guttata]
Length=423

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPR M   VGFG+HYPKHVHHRG SIP + ++Y+CKGGW+WR+SKK NPN +VGAMVAGP
Sbjct  300  NPRNM---VGFGDHYPKHVHHRGPSIPNDNIKYSCKGGWRWRNSKKSNPNTIVGAMVAGP  356

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaa-lvaLSGERSTRIDKNTIFSAV  351
              HDGF D+R NYNYTEP + GNAGLVAA LVALSG+ S+ ID+NT+FSAV
Sbjct  357  YKHDGFEDLRENYNYTEPAITGNAGLVAAPLVALSGKESSGIDRNTVFSAV  407



>emb|CBI18623.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G  +PKHVHHRGASIP +  +Y+C GGWKWRDS+ PNP+ + GAMV GP
Sbjct  313  NPMKMSYLVGYGTKFPKHVHHRGASIPNDNKKYSCTGGWKWRDSRNPNPHNITGAMVGGP  372

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
               D F D+RTNYNYTEPTLAGNAGLVAALV+L+G     IDKNTIFSAV
Sbjct  373  IRTDNFQDIRTNYNYTEPTLAGNAGLVAALVSLTGSGGMSIDKNTIFSAV  422



>ref|XP_002312211.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE89578.1| endo-1 family protein [Populus trichocarpa]
 gb|AEO97187.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97214.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=620

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGAS P +K RY+C GGWKWRDS KPNP+ + GAMV GP
Sbjct  495  NPMKMSYVVGYGTKFPRHVHHRGASTPSDKTRYSCTGGWKWRDSSKPNPHNITGAMVGGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTNYN+TEPTLAGNAGLVAAL +L+      IDKN+IF+AV
Sbjct  555  DRFDQFRDVRTNYNFTEPTLAGNAGLVAALASLTSSGGIGIDKNSIFTAV  604



>ref|XP_002514768.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47322.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=624

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MSYVVG+G  +P+HVHHR ASIP +K RY+C GGWKWRDS+ PNPN + GAMV GP
Sbjct  499  NPMNMSYVVGYGTKFPRHVHHRAASIPHDKKRYSCTGGWKWRDSRNPNPNNITGAMVGGP  558

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRT+YNYTEPTLAGNAGLVAAL +L+      IDKNTIFSAV
Sbjct  559  DRFDKFHDVRTSYNYTEPTLAGNAGLVAALASLTVSGGHGIDKNTIFSAV  608



>gb|KDP32490.1| hypothetical protein JCGZ_13415 [Jatropha curcas]
Length=623

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MSYVVG+G  +P+HVHHRGASIP +K RY+CKGGWKWRD++ PNPN + GAMV GP
Sbjct  498  NPMNMSYVVGYGTKFPRHVHHRGASIPHDKNRYSCKGGWKWRDTRNPNPNNITGAMVGGP  557

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVR+NYN +EPTLAGNAGLVAAL +L+      IDKNTIFSAV
Sbjct  558  DRFDKFHDVRSNYNSSEPTLAGNAGLVAALASLTSSGGFGIDKNTIFSAV  607



>ref|XP_010646848.1| PREDICTED: endoglucanase 12 [Vitis vinifera]
Length=529

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G  +PKHVHHRGASIP +  +Y+C GGWKWRDS+ PNP+ + GAMV GP
Sbjct  404  NPMKMSYLVGYGTKFPKHVHHRGASIPNDNKKYSCTGGWKWRDSRNPNPHNITGAMVGGP  463

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
               D F D+RTNYNYTEPTLAGNAGLVAALV+L+G     IDKNTIFSAV
Sbjct  464  IRTDNFQDIRTNYNYTEPTLAGNAGLVAALVSLTGSGGMSIDKNTIFSAV  513



>ref|XP_002983992.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
 gb|EFJ15004.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
Length=610

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+GN YPK VHHR ASIPKNK +Y C+ GW++RDSKK NPN +VGAMV GP
Sbjct  484  NPRKMSYVVGYGNKYPKQVHHRAASIPKNKRKYGCQEGWRFRDSKKANPNTIVGAMVGGP  543

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS-GERSTRIDKNTIFS  357
            D  D FHDVR+NYN+TEPTLAGNAGL  ALVALS G+ S+ +D + IFS
Sbjct  544  DTKDRFHDVRSNYNFTEPTLAGNAGLAFALVALSGGDSSSGVDASNIFS  592



>gb|AFZ78629.1| korrigan [Populus tomentosa]
Length=621

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGAS P + VRY+C GGWKWRDS KPNP+ + GAMV GP
Sbjct  496  NPMKMSYVVGYGTKFPRHVHHRGASTPSDNVRYSCTGGWKWRDSSKPNPHNITGAMVGGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTNYN+TEPTLAGNAGLVAALV+L+      I+KN+IFSAV
Sbjct  556  DRFDQFRDVRTNYNFTEPTLAGNAGLVAALVSLTSSGGIGINKNSIFSAV  605



>ref|XP_011077092.1| PREDICTED: endoglucanase 12 [Sesamum indicum]
Length=620

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MSYVVG+G  YP+HVHHRGASIP NKV+Y+C GGW+WRD+  PNPN + GAMV GP
Sbjct  495  NPMNMSYVVGYGPKYPRHVHHRGASIPNNKVKYSCTGGWRWRDAATPNPNTISGAMVGGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTNY+YTEPT+AGNAGLVAALV+L+      +DKNTIF+ V
Sbjct  555  DRFDNFRDVRTNYSYTEPTVAGNAGLVAALVSLTSSGGIGVDKNTIFTNV  604



>ref|XP_004250089.1| PREDICTED: endoglucanase 12 [Solanum lycopersicum]
Length=635

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G+ +PKHVHHRGASIP  K +Y+C GGW+WRD+KKPN + + GAMV GP
Sbjct  510  NPLKMSYIVGYGDKFPKHVHHRGASIPTGKTKYSCTGGWRWRDTKKPNVHNMTGAMVGGP  569

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F D+RTN++YTEPTLAGNAGLVAALV+L+G     IDKNTIFSAV
Sbjct  570  DKFDKFKDLRTNFSYTEPTLAGNAGLVAALVSLTGTGGYGIDKNTIFSAV  619



>ref|XP_011010912.1| PREDICTED: endoglucanase 12 [Populus euphratica]
 ref|XP_011010993.1| PREDICTED: endoglucanase 12 [Populus euphratica]
Length=620

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+H+HHRGAS P +  RY+C GGWKWRDS KPNP+ + GAMV GP
Sbjct  495  NPMKMSYVVGYGTKFPRHIHHRGASTPSDNTRYSCTGGWKWRDSSKPNPHNITGAMVGGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTNYN+TEPTLAGNAGLVAAL +L+      IDKN+IFSAV
Sbjct  555  DRFDRFRDVRTNYNFTEPTLAGNAGLVAALASLTSSGGIGIDKNSIFSAV  604



>ref|XP_011014628.1| PREDICTED: endoglucanase 12-like isoform X3 [Populus euphratica]
Length=549

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGASIP +K  Y+C GGWKWRDS KPNPN + GAMV GP
Sbjct  424  NPMKMSYVVGYGTKFPRHVHHRGASIPNDKRTYSCTGGWKWRDSPKPNPNNITGAMVGGP  483

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN +FSAV
Sbjct  484  DRYDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGVGIDKNRMFSAV  533



>ref|XP_006468640.1| PREDICTED: endoglucanase 12-like [Citrus sinensis]
Length=637

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGASIP +  +Y+CKGGWKW ++ KPNP+ + GAMVAGP
Sbjct  512  NPMKMSYVVGYGKQFPRHVHHRGASIPSDGKKYSCKGGWKWSNNPKPNPHNITGAMVAGP  571

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRTN+NYTEPTLAGNAGLVAAL +L+      IDKNT+FSA+
Sbjct  572  DRFDKFHDVRTNHNYTEPTLAGNAGLVAALASLTTSAGIGIDKNTMFSAI  621



>ref|XP_008801082.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+G +YPKHVHHRGASIP N V+Y+C GG KW ++K PNPN++ GAMV GP
Sbjct  493  NPKKMSYVVGYGKNYPKHVHHRGASIPDNGVKYSCTGGRKWLNAKSPNPNVITGAMVGGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF DVR NY YTEPTLAGNAGLVAALV+L+      +DKNT+FSAV
Sbjct  553  DRSDGFVDVRKNYGYTEPTLAGNAGLVAALVSLTSSGGAGVDKNTMFSAV  602



>ref|XP_010929679.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=619

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ +SYVVG+G +YP+ VHHRGASIP +++ Y+C  GWKWRDSK PNPN++ GAMV GP
Sbjct  495  NPKNISYVVGYGKNYPRQVHHRGASIPHDRIAYSCTAGWKWRDSKSPNPNVITGAMVGGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            +  DGF DVR N NYTEPTLAGNAGL+AALV+L+     RIDKN IFS+V
Sbjct  555  NRFDGFSDVRNNKNYTEPTLAGNAGLIAALVSLTSSGGDRIDKNAIFSSV  604



>ref|XP_011014603.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014609.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014618.1| PREDICTED: endoglucanase 12-like isoform X2 [Populus euphratica]
Length=621

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGASIP +K  Y+C GGWKWRDS KPNPN + GAMV GP
Sbjct  496  NPMKMSYVVGYGTKFPRHVHHRGASIPNDKRTYSCTGGWKWRDSPKPNPNNITGAMVGGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN +FSAV
Sbjct  556  DRYDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGVGIDKNRMFSAV  605



>gb|KDO77086.1| hypothetical protein CISIN_1g013288mg [Citrus sinensis]
Length=446

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGASIP +  +Y+CKGGWKW ++ KPNP+ + GAMVAGP
Sbjct  321  NPMKMSYVVGYGKQFPRHVHHRGASIPSDGKKYSCKGGWKWSNNPKPNPHNITGAMVAGP  380

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F+DVRTN+NYTEPTLAGNAGLVAAL +L+      IDKNT+FSA+
Sbjct  381  DRFDKFNDVRTNHNYTEPTLAGNAGLVAALASLTTSAGIGIDKNTMFSAI  430



>ref|XP_006448516.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
 gb|ESR61756.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
Length=637

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+HVHHRGASIP +  +Y+CKGGWKW ++ KPNP+ + GAMVAGP
Sbjct  512  NPTKMSYVVGYGKKFPRHVHHRGASIPSDGKKYSCKGGWKWSNNPKPNPHNITGAMVAGP  571

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHDVRTN+NYTEPTLAGNAGLVAAL +L+      IDKNT+FSA+
Sbjct  572  DRFDKFHDVRTNHNYTEPTLAGNAGLVAALASLTTSAGIGIDKNTMFSAI  621



>ref|XP_002315101.2| hypothetical protein POPTR_0010s18480g [Populus trichocarpa]
 gb|EEF01272.2| hypothetical protein POPTR_0010s18480g [Populus trichocarpa]
Length=505

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+H+HHRGASIP +K  Y+C GGWKWRDS KPNPN + GAMV GP
Sbjct  380  NPMKMSYVVGYGTKFPRHIHHRGASIPNDKRSYSCTGGWKWRDSPKPNPNNITGAMVGGP  439

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN +FSAV
Sbjct  440  DRFDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGIGIDKNRMFSAV  489



>ref|XP_006858738.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
 gb|ERN20205.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
Length=619

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NPRKMSYVVG+G++YPKHVHHRGASIP N+ +  C GGWKWRDS  PNPN + GAMV GP
Sbjct  495  NPRKMSYVVGYGSNYPKHVHHRGASIPNNQ-KTTCTGGWKWRDSNNPNPNTITGAMVGGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVR+NYNYTEPTLAGNAGLVAAL++L+G     ID N IFS +
Sbjct  554  DRFDQFRDVRSNYNYTEPTLAGNAGLVAALISLTGSGGGGIDTNKIFSGI  603



>gb|AEO97186.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97213.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=621

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+H+HHRGASIP +K  Y+C GGWKWRDS KPNPN + GAMV GP
Sbjct  496  NPMKMSYVVGYGTKFPRHIHHRGASIPNDKRSYSCTGGWKWRDSPKPNPNNITGAMVGGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN +FSAV
Sbjct  556  DRFDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGIGIDKNRMFSAV  605



>gb|AFZ78628.1| korrigan [Populus tomentosa]
Length=691

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G  +P+H+HHRGASIP +K RY+C GGWKWRD  KPNPN + GAMV GP
Sbjct  496  NPMKMSYVVGYGTKFPRHIHHRGASIPNDKRRYSCTGGWKWRDRPKPNPNNITGAMVGGP  555

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVR NYN+TEPTLAGNAGLVAALV+L+      I+KN+IFSAV
Sbjct  556  DRFDRFRDVRKNYNFTEPTLAGNAGLVAALVSLTSSGGIGINKNSIFSAV  605



>ref|XP_010065082.1| PREDICTED: endoglucanase 12 [Eucalyptus grandis]
 gb|KCW87984.1| hypothetical protein EUGRSUZ_A00393 [Eucalyptus grandis]
Length=629

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFG  YPKHVHHRGASIP +  +Y+C GGWKWRD++  NPN + GAMV GP
Sbjct  497  NPMKMSYVVGFGAKYPKHVHHRGASIPNDHKKYSCTGGWKWRDTRNNNPNTINGAMVGGP  556

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTNY+YTEPTLAGNAGLVAALV+L+      IDKN+IFSAV
Sbjct  557  DRFDKFKDVRTNYSYTEPTLAGNAGLVAALVSLTESGGRAIDKNSIFSAV  606



>ref|XP_009141938.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
Length=566

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  +SYVVG+G  YPKHVHHRGASIPKN+ + +CKGGWKWR+S K NPN++ GAMVAGP
Sbjct  444  NPENISYVVGYGERYPKHVHHRGASIPKNR-KESCKGGWKWRESSKENPNVIEGAMVAGP  502

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D HD FHDVRT  NYTEPTL GNAGLVAALVALSGE+   +DKN +FS V
Sbjct  503  DGHDVFHDVRTA-NYTEPTLTGNAGLVAALVALSGEKHM-LDKNRMFSGV  550



>ref|XP_004502103.1| PREDICTED: endoglucanase 12-like [Cicer arietinum]
Length=620

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MSY+VG+GN++P+HVHHRGAS PK+   Y+C GGWKWRD+ KPNP+ + GAMV GP
Sbjct  495  NPMNMSYIVGYGNNFPRHVHHRGASTPKDHKHYSCTGGWKWRDTHKPNPHNITGAMVGGP  554

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            +  D FHD R NYNYTEPTLAGNAGLVAAL++L+   ST ID NTIFSA+
Sbjct  555  NRFDQFHDSRINYNYTEPTLAGNAGLVAALISLTSTPSTGIDINTIFSAI  604



>ref|XP_007028162.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
 gb|EOY08664.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
Length=619

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MSYVVG+   +P+HVHHRGASIP N ++Y+C GGWKWRDS+ PNPN + GAMV GP
Sbjct  494  NPMNMSYVVGYDKKFPRHVHHRGASIPHNNIKYSCTGGWKWRDSQNPNPNNITGAMVGGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVRTN NYTEPTLAGNAGL+AAL +L+      IDKNTIFSAV
Sbjct  554  DRFDHFRDVRTNSNYTEPTLAGNAGLIAALASLTRSGGHGIDKNTIFSAV  603



>ref|XP_009782313.1| PREDICTED: endoglucanase 12 [Nicotiana sylvestris]
Length=634

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+GN +P+HVHHRGASIP  K +Y+C GGWKWRD+  PNP+ + GAMV GP
Sbjct  509  NPLKMSYVVGYGNKFPRHVHHRGASIPSGKTKYSCTGGWKWRDTSNPNPHNITGAMVGGP  568

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F D R N++YTEPTLAGNAGLVAALV+L+      +DKNTIFSAV
Sbjct  569  DKFDRFKDARKNFSYTEPTLAGNAGLVAALVSLTSSGGYGVDKNTIFSAV  618



>ref|XP_003556773.1| PREDICTED: endoglucanase 12-like [Glycine max]
Length=630

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VGFGN +PKHVHHRGASIP +    +C GGWKWRD+  PNPN + GAMV GP
Sbjct  502  NPMKMSYIVGFGNKFPKHVHHRGASIPNDHKHRSCTGGWKWRDTPNPNPNTITGAMVGGP  561

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F D R NYN+TEPTLAGNAGLVAAL++L+    + ID+NTIFSA+
Sbjct  562  DRFDQFRDSRKNYNFTEPTLAGNAGLVAALISLTSTTGSGIDRNTIFSAI  611



>gb|KHN09941.1| Endoglucanase 7 [Glycine soja]
Length=630

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VGFGN +PKHVHHRGASIP +    +C GGWKWRD+  PNPN + GAMV GP
Sbjct  502  NPMKMSYIVGFGNKFPKHVHHRGASIPNDHKHRSCTGGWKWRDTPNPNPNTITGAMVGGP  561

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F D R NYN+TEPTLAGNAGLVAAL++L+    + ID+NTIFSA+
Sbjct  562  DRFDQFRDSRKNYNFTEPTLAGNAGLVAALISLTSTTGSGIDRNTIFSAI  611



>ref|XP_009602898.1| PREDICTED: endoglucanase 12 [Nicotiana tomentosiformis]
Length=635

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+GN +P+HVHHRGASIP  K +Y+C GGWKWRD+K PNP+ + GAMV GP
Sbjct  510  NPLKMSYVVGYGNKFPRHVHHRGASIPSGKTKYSCTGGWKWRDTKNPNPHNITGAMVGGP  569

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F D R N++YTEPTLAGNAGLVAALV+L+      +DKN IFSAV
Sbjct  570  DKFDKFKDARKNFSYTEPTLAGNAGLVAALVSLTSSGGYGVDKNAIFSAV  619



>ref|XP_010930303.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=618

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+GN YPK VHHRGASIP N V+Y+C GG KW  +K  NPN++ GAMV GP
Sbjct  493  NPKKMSYVVGYGNKYPKQVHHRGASIPDNGVKYSCTGGRKWLYAKSSNPNVITGAMVGGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  DGF DVR +Y YTEPTLAGNAGLVAALV+L+      +DKNTIFSAV
Sbjct  553  DRFDGFMDVRKDYGYTEPTLAGNAGLVAALVSLTSSGGAGVDKNTIFSAV  602



>ref|XP_007146006.1| hypothetical protein PHAVU_006G0049001g, partial [Phaseolus vulgaris]
 gb|ESW18000.1| hypothetical protein PHAVU_006G0049001g, partial [Phaseolus vulgaris]
Length=495

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VGFGN +P+HVHHRGASIP +   ++C GGWKWRD+   NPN + GAMV GP
Sbjct  366  NPMKMSYIVGFGNKFPRHVHHRGASIPNDHKHHSCTGGWKWRDTSNNNPNTITGAMVGGP  425

Query  500  DAHDGFHDVRTNYNYTEPTla-gnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D FHD R NYN+TEPTLA     + A +   S   S+ ID+NTIFSA+
Sbjct  426  DRFDQFHDSRKNYNFTEPTLAGNAGIVAALISLTSTTGSSVIDRNTIFSAI  476



>ref|XP_009385674.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G +YPKHVHHRGASIP N V+Y+C GGWKWRD+K  NPN + GAMV GP
Sbjct  491  NPMKMSYVVGYGRNYPKHVHHRGASIPHNGVKYSCTGGWKWRDAKTANPNTITGAMVGGP  550

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKNTIFSAV  351
            D  D F D R NYNYTEPTLAGNAGLVAALV+L+   S+  +D NTIFSAV
Sbjct  551  DRFDRFSDSRPNYNYTEPTLAGNAGLVAALVSLTSTSSSSGVDTNTIFSAV  601



>ref|XP_010912745.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=446

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVG+G +YPKHVHHRGASIP + V+Y+C  GWKW  +K PNPN++ GAMV GP
Sbjct  321  NPKKMSYVVGYGKNYPKHVHHRGASIPDDGVKYSCTIGWKWFHAKSPNPNVITGAMVGGP  380

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFS  357
            D  DGF D R +Y YTEPTLAGNAGLVAALV+++      +DKNT+FS
Sbjct  381  DRFDGFKDARQSYGYTEPTLAGNAGLVAALVSVTSSGGAGVDKNTMFS  428



>ref|XP_006353239.1| PREDICTED: endoglucanase 12-like [Solanum tuberosum]
Length=634

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSY+VG+G+ +P HVHHRGASIP  K +Y+C GGW+WRD+K PN + + GAMV GP
Sbjct  509  NPLKMSYIVGYGDKFPNHVHHRGASIPTGKTKYSCTGGWRWRDTKNPNVHNITGAMVGGP  568

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F DVR N++YTEPTLAGNAGLVAALV+L+G     IDKNT+FSAV
Sbjct  569  DKFDKFKDVRANFSYTEPTLAGNAGLVAALVSLTGTGGYGIDKNTMFSAV  618



>emb|CDP09829.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+ MSYVVG+G  YP HVHHRGASIP N ++Y+C GGWKWRD+ K NPN +VGA+VAGP
Sbjct  414  NPQNMSYVVGYGIKYPLHVHHRGASIPHNGIKYSCTGGWKWRDTPKANPNTIVGALVAGP  473

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D +DGF D R   NYT+P LAGNAGLV ALVALSG+ S RI+K+++FS V
Sbjct  474  DENDGFKDNRRMMNYTQPRLAGNAGLVGALVALSGDGSIRINKSSMFSFV  523



>gb|ACF87544.1| unknown [Zea mays]
 gb|ACN34482.1| unknown [Zea mays]
Length=450

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 4/114 (4%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG+ YP+HVHHRGAS P N V+Y+C GG+KWRDSKK +PN+L GAMV GP
Sbjct  321  NPKKMSYVVGFGSKYPRHVHHRGASTPHNGVKYSCTGGYKWRDSKKADPNLLAGAMVGGP  380

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS----GERSTRIDKNTIFSAV  351
            D +DGF D R  +   EPTL GNAGLVAALVAL+    G   T +DKNT+FSAV
Sbjct  381  DKNDGFKDSRNTFGQNEPTLVGNAGLVAALVALTNSGRGAGVTTVDKNTMFSAV  434



>tpg|DAA36812.1| TPA: hypothetical protein ZEAMMB73_340402, partial [Zea mays]
Length=496

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 4/114 (4%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG+ YP+HVHHRGAS P N V+Y+C GG+KWRDSKK +PN+L GAMV GP
Sbjct  367  NPKKMSYVVGFGSKYPRHVHHRGASTPHNGVKYSCTGGYKWRDSKKADPNLLAGAMVGGP  426

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS----GERSTRIDKNTIFSAV  351
            D +DGF D R  +   EPTL GNAGLVAALVAL+    G   T +DKNT+FSAV
Sbjct  427  DKNDGFKDSRNTFGQNEPTLVGNAGLVAALVALTNSGRGAGVTTVDKNTMFSAV  480



>gb|ACT54547.1| endo-1,4-beta-glucanase [Dimocarpus longan]
Length=628

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVGFGN +P+HVHHR ASIP +K  Y+C GG+KWRD++ PNPN + GAMV GP
Sbjct  503  NPMKMSYVVGFGNKFPRHVHHRAASIPHDKKYYSCTGGFKWRDTRNPNPNNITGAMVGGP  562

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            D  D F D+R+NY+YTEPTLAGNAGLVAALV+L+      I+KNT+FSAV
Sbjct  563  DRFDQFRDLRSNYSYTEPTLAGNAGLVAALVSLTSSGGRGINKNTMFSAV  612



>ref|NP_001147970.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|ACG29288.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
Length=623

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 4/114 (4%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP+KMSYVVGFG+ YP+HVHHRGAS P N V+Y+C GG+KWRDSKK +PN+L GAMV GP
Sbjct  494  NPKKMSYVVGFGSKYPRHVHHRGASTPHNGVKYSCTGGYKWRDSKKADPNLLAGAMVGGP  553

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS----GERSTRIDKNTIFSAV  351
            D +DGF D R  +   EPTL GNAGLVAALVAL+    G   T +DKNT+FSAV
Sbjct  554  DKNDGFKDSRNTFGQNEPTLVGNAGLVAALVALTNSGRGAGVTTVDKNTMFSAV  607



>ref|XP_008813788.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP KMSYVVG+G +YPKHVHHRGASIP N V+Y+C  GWKW  +K PNPN++ GAMV GP
Sbjct  493  NPEKMSYVVGYGENYPKHVHHRGASIPDNGVKYSCAAGWKWFHAKSPNPNVIAGAMVGGP  552

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFS  357
            D  D F D R NY YTEPTLAGNAGLVAALV+L+      +DKN +FS
Sbjct  553  DRFDVFKDARQNYGYTEPTLAGNAGLVAALVSLTSSGGAGVDKNAMFS  600



>ref|XP_010528623.1| PREDICTED: endoglucanase 7 [Tarenaya hassleriana]
Length=632

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  NPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGP  501
            NP  MS+VVGFG+ +P+HVHHRGA+IP ++ R +C  GW+WRD+K PNPN +VGAMV GP
Sbjct  507  NPLNMSFVVGFGSKFPRHVHHRGATIPSDRKRRSCSEGWQWRDTKNPNPNNIVGAMVGGP  566

Query  500  DAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  351
            ++ D FHD+R NYN +EPTLAGN+GLVAALV+L+   S  IDKNTIF+AV
Sbjct  567  NSFDQFHDLRHNYNASEPTLAGNSGLVAALVSLTNSESHGIDKNTIFNAV  616



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060