BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034M16

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010101303.1|  Alcohol dehydrogenase-like 7                       357   6e-119   Morus notabilis
ref|XP_009762562.1|  PREDICTED: alcohol dehydrogenase-like 7            356   1e-118   Nicotiana sylvestris
ref|XP_009613178.1|  PREDICTED: alcohol dehydrogenase-like 7            352   4e-117   Nicotiana tomentosiformis
ref|XP_009774475.1|  PREDICTED: alcohol dehydrogenase-like 7            352   5e-117   Nicotiana sylvestris
ref|XP_011099657.1|  PREDICTED: alcohol dehydrogenase-like 7            351   1e-116   Sesamum indicum [beniseed]
ref|XP_009605587.1|  PREDICTED: alcohol dehydrogenase-like 7            350   2e-116   Nicotiana tomentosiformis
ref|XP_006342106.1|  PREDICTED: alcohol dehydrogenase-like 7-like       349   7e-116   Solanum tuberosum [potatoes]
ref|XP_006342549.1|  PREDICTED: alcohol dehydrogenase-like 7-like       348   7e-116   Solanum tuberosum [potatoes]
gb|AAB33480.2|  alcohol dehydrogenase ADH                               348   8e-116   Solanum lycopersicum
ref|XP_004238409.1|  PREDICTED: alcohol dehydrogenase-like 7            348   1e-115   
gb|KDP36844.1|  hypothetical protein JCGZ_08135                         348   2e-115   Jatropha curcas
gb|EYU17538.1|  hypothetical protein MIMGU_mgv1a007994mg                347   4e-115   Erythranthe guttata [common monkey flower]
ref|XP_004238410.1|  PREDICTED: alcohol dehydrogenase-like 7            346   8e-115   
ref|XP_002285916.1|  PREDICTED: alcohol dehydrogenase-like 7            343   7e-114   Vitis vinifera
ref|XP_002510634.1|  alcohol dehydrogenase, putative                    343   9e-114   Ricinus communis
gb|KHN26031.1|  Alcohol dehydrogenase-like 7                            343   9e-114   Glycine soja [wild soybean]
ref|XP_003545495.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    343   1e-113   Glycine max [soybeans]
gb|KDO85031.1|  hypothetical protein CISIN_1g016507mg                   338   1e-113   Citrus sinensis [apfelsine]
emb|CDP07305.1|  unnamed protein product                                343   2e-113   Coffea canephora [robusta coffee]
ref|XP_004501981.1|  PREDICTED: alcohol dehydrogenase-like 7-like       341   7e-113   Cicer arietinum [garbanzo]
ref|XP_003555362.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    340   1e-112   Glycine max [soybeans]
ref|XP_004491172.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    340   2e-112   Cicer arietinum [garbanzo]
gb|KDO85030.1|  hypothetical protein CISIN_1g016507mg                   337   5e-112   Citrus sinensis [apfelsine]
ref|XP_007017963.1|  Zinc-binding alcohol dehydrogenase family pr...    337   6e-112   
gb|KDO85025.1|  hypothetical protein CISIN_1g016507mg                   337   6e-112   Citrus sinensis [apfelsine]
gb|EYU17539.1|  hypothetical protein MIMGU_mgv1a007994mg                338   6e-112   Erythranthe guttata [common monkey flower]
ref|XP_006473751.1|  PREDICTED: alcohol dehydrogenase-like 7-like       337   2e-111   Citrus sinensis [apfelsine]
ref|XP_004253128.1|  PREDICTED: alcohol dehydrogenase-like 7            337   3e-111   Solanum lycopersicum
ref|XP_006435310.1|  hypothetical protein CICLE_v10001457mg             336   5e-111   Citrus clementina [clementine]
ref|XP_007146069.1|  hypothetical protein PHAVU_006G0103001g            333   1e-110   Phaseolus vulgaris [French bean]
gb|KJB11816.1|  hypothetical protein B456_002G1197001                   330   2e-110   Gossypium raimondii
ref|XP_010530336.1|  PREDICTED: alcohol dehydrogenase-like 7            334   3e-110   Tarenaya hassleriana [spider flower]
gb|KHN41317.1|  Alcohol dehydrogenase-like 7                            334   4e-110   Glycine soja [wild soybean]
ref|XP_007017962.1|  Zinc-binding alcohol dehydrogenase family pr...    334   6e-110   
ref|XP_009334355.1|  PREDICTED: alcohol dehydrogenase-like 7            333   7e-110   Pyrus x bretschneideri [bai li]
ref|XP_003617079.1|  Alcohol dehydrogenase-like protein                 333   7e-110   Medicago truncatula
ref|XP_008464877.1|  PREDICTED: alcohol dehydrogenase-like 7            333   1e-109   Cucumis melo [Oriental melon]
ref|XP_008387882.1|  PREDICTED: alcohol dehydrogenase-like 7            332   2e-109   
ref|XP_008464876.1|  PREDICTED: alcohol dehydrogenase-like 7            332   3e-109   Cucumis melo [Oriental melon]
ref|XP_008221165.1|  PREDICTED: alcohol dehydrogenase-like 7            332   4e-109   Prunus mume [ume]
ref|XP_004144219.1|  PREDICTED: alcohol dehydrogenase-like 7-like       331   5e-109   Cucumis sativus [cucumbers]
ref|XP_010101304.1|  Alcohol dehydrogenase-like 7                       330   6e-109   
ref|XP_003519482.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    329   4e-108   Glycine max [soybeans]
ref|XP_006280555.1|  hypothetical protein CARUB_v10026496mg             330   4e-108   
ref|XP_006575597.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    328   4e-108   Glycine max [soybeans]
gb|KJB11814.1|  hypothetical protein B456_002G1197001                   329   4e-108   Gossypium raimondii
ref|XP_009101606.1|  PREDICTED: alcohol dehydrogenase-like 7            329   5e-108   Brassica rapa
ref|XP_004158271.1|  PREDICTED: alcohol dehydrogenase-like 7-like       328   1e-107   
gb|KGN47563.1|  hypothetical protein Csa_6G361250                       328   1e-107   Cucumis sativus [cucumbers]
ref|XP_010266956.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    328   2e-107   
gb|AAB33481.2|  alcohol dehydrogenase ADH                               327   2e-107   Solanum lycopersicum
ref|XP_003519481.1|  PREDICTED: alcohol dehydrogenase-like 7-like       327   2e-107   Glycine max [soybeans]
ref|XP_004291243.1|  PREDICTED: alcohol dehydrogenase-like 7            327   2e-107   Fragaria vesca subsp. vesca
ref|XP_007223044.1|  hypothetical protein PRUPE_ppa006932mg             327   3e-107   Prunus persica
gb|KDO85024.1|  hypothetical protein CISIN_1g016507mg                   327   3e-107   Citrus sinensis [apfelsine]
ref|XP_007141577.1|  hypothetical protein PHAVU_008G207700g             326   4e-107   Phaseolus vulgaris [French bean]
emb|CDY39423.1|  BnaAnng05540D                                          326   4e-107   Brassica napus [oilseed rape]
ref|XP_010666439.1|  PREDICTED: alcohol dehydrogenase-like 7            326   5e-107   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY64947.1|  BnaCnng45600D                                          325   9e-107   Brassica napus [oilseed rape]
gb|KFK32944.1|  hypothetical protein AALP_AA6G309700                    325   1e-106   Arabis alpina [alpine rockcress]
gb|KCW68039.1|  hypothetical protein EUGRSUZ_F01715                     321   2e-106   Eucalyptus grandis [rose gum]
ref|XP_010482004.1|  PREDICTED: alcohol dehydrogenase-like 7            324   3e-106   Camelina sativa [gold-of-pleasure]
ref|XP_003601300.1|  Alcohol dehydrogenase-like protein                 322   2e-105   Medicago truncatula
ref|XP_002865545.1|  hypothetical protein ARALYDRAFT_494804             322   3e-105   
ref|XP_010061139.1|  PREDICTED: alcohol dehydrogenase-like 7            320   7e-105   Eucalyptus grandis [rose gum]
ref|XP_002301931.2|  alcohol dehydrogenase family protein               321   8e-105   
ref|XP_004144283.1|  PREDICTED: alcohol dehydrogenase-like 7-like       328   2e-104   
gb|KJB11817.1|  hypothetical protein B456_002G1197001                   319   3e-104   Gossypium raimondii
ref|XP_011459084.1|  PREDICTED: alcohol dehydrogenase-like 7            319   4e-104   Fragaria vesca subsp. vesca
ref|XP_003601299.1|  Alcohol dehydrogenase ADH                          314   7e-104   
ref|XP_007141580.1|  hypothetical protein PHAVU_008G2078000g            317   1e-103   Phaseolus vulgaris [French bean]
ref|XP_007141579.1|  hypothetical protein PHAVU_008G2078000g            317   2e-103   Phaseolus vulgaris [French bean]
ref|XP_007224791.1|  hypothetical protein PRUPE_ppa023795mg             316   2e-103   
ref|XP_004291255.1|  PREDICTED: alcohol dehydrogenase-like 7            317   2e-103   Fragaria vesca subsp. vesca
ref|NP_199040.1|  alcohol dehydrogenase-like 7                          317   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291254.1|  PREDICTED: alcohol dehydrogenase-like 7            314   2e-102   Fragaria vesca subsp. vesca
ref|XP_010442151.1|  PREDICTED: alcohol dehydrogenase-like 7            313   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010666441.1|  PREDICTED: alcohol dehydrogenase-like 7            313   8e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667181.1|  PREDICTED: alcohol dehydrogenase-like 7            312   1e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010509865.1|  PREDICTED: alcohol dehydrogenase-like 7            311   3e-101   Camelina sativa [gold-of-pleasure]
ref|XP_011034915.1|  PREDICTED: alcohol dehydrogenase-like 7            310   1e-100   Populus euphratica
ref|XP_002285917.2|  PREDICTED: alcohol dehydrogenase-like 7            310   1e-100   
ref|XP_009409164.1|  PREDICTED: alcohol dehydrogenase-like 7            309   2e-100   
ref|XP_008219143.1|  PREDICTED: LOW QUALITY PROTEIN: alcohol dehy...    307   1e-99    
ref|XP_010493867.1|  PREDICTED: alcohol dehydrogenase-like 7            307   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009409158.1|  PREDICTED: alcohol dehydrogenase-like 7            306   3e-99    
ref|XP_004985405.1|  PREDICTED: alcohol dehydrogenase-like 7-like       301   3e-97    Setaria italica
ref|XP_010916712.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    299   2e-96    Elaeis guineensis
gb|ACG35040.1|  alcohol dehydrogenase 1                                 298   3e-96    Zea mays [maize]
ref|XP_007141581.1|  hypothetical protein PHAVU_008G207900g             298   6e-96    Phaseolus vulgaris [French bean]
dbj|BAK06271.1|  predicted protein                                      298   6e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007018719.1|  GroES-like zinc-binding dehydrogenase family...    297   7e-96    
ref|XP_006433934.1|  hypothetical protein CICLE_v10001399mg             298   9e-96    Citrus clementina [clementine]
ref|XP_006649531.1|  PREDICTED: alcohol dehydrogenase-like 7-like       297   1e-95    Oryza brachyantha
ref|XP_007018718.1|  GroES-like zinc-binding dehydrogenase family...    297   1e-95    
ref|NP_001132441.1|  putative alcohol dehydrogenase superfamily p...    296   1e-95    Zea mays [maize]
ref|XP_010098631.1|  Alcohol dehydrogenase-like 2                       297   2e-95    Morus notabilis
ref|XP_006433937.1|  hypothetical protein CICLE_v10001446mg             292   2e-95    
ref|XP_006472563.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    296   2e-95    
ref|XP_003558622.1|  PREDICTED: alcohol dehydrogenase-like 7            295   8e-95    Brachypodium distachyon [annual false brome]
ref|XP_010664347.1|  PREDICTED: alcohol dehydrogenase-like 1            294   1e-94    Vitis vinifera
gb|EEC74658.1|  hypothetical protein OsI_10321                          291   3e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_010916714.1|  PREDICTED: alcohol dehydrogenase-like 7            292   6e-94    Elaeis guineensis
emb|CDP15696.1|  unnamed protein product                                294   7e-94    Coffea canephora [robusta coffee]
ref|XP_004158272.1|  PREDICTED: alcohol dehydrogenase-like 7-like       291   1e-93    
ref|XP_010493542.1|  PREDICTED: alcohol dehydrogenase-like 7            294   1e-93    
gb|KGN47562.1|  hypothetical protein Csa_6G361240                       291   1e-93    Cucumis sativus [cucumbers]
ref|NP_001049222.1|  Os03g0189400                                       291   2e-93    
ref|XP_008804784.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    291   2e-93    Phoenix dactylifera
gb|KDO81036.1|  hypothetical protein CISIN_1g016363mg                   291   2e-93    Citrus sinensis [apfelsine]
gb|KDP41414.1|  hypothetical protein JCGZ_15821                         291   3e-93    Jatropha curcas
ref|XP_008804783.1|  PREDICTED: LOW QUALITY PROTEIN: alcohol dehy...    290   4e-93    
ref|XP_006433936.1|  hypothetical protein CICLE_v10001446mg             290   4e-93    Citrus clementina [clementine]
emb|CDP04608.1|  unnamed protein product                                288   4e-92    Coffea canephora [robusta coffee]
ref|XP_002465730.1|  hypothetical protein SORBIDRAFT_01g044590          286   5e-92    
gb|KJB11818.1|  hypothetical protein B456_002G1197001                   286   6e-92    Gossypium raimondii
gb|EEC82469.1|  hypothetical protein OsI_26910                          287   1e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001060310.1|  Os07g0621800                                       287   1e-91    
ref|XP_008464881.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    284   5e-91    
ref|XP_007018717.1|  GroES-like zinc-binding dehydrogenase family...    285   7e-91    
ref|XP_008464879.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    284   1e-90    
ref|XP_008464878.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    285   1e-90    Cucumis melo [Oriental melon]
ref|XP_010272993.1|  PREDICTED: alcohol dehydrogenase-like 7            284   1e-90    Nelumbo nucifera [Indian lotus]
ref|XP_004491173.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    283   2e-90    
ref|XP_003562679.1|  PREDICTED: alcohol dehydrogenase-like 2            284   2e-90    Brachypodium distachyon [annual false brome]
ref|XP_006828009.1|  hypothetical protein AMTR_s00008p00243660          282   7e-90    Amborella trichopoda
ref|XP_004958351.1|  PREDICTED: alcohol dehydrogenase-like 5-like       280   1e-89    
emb|CDP09730.1|  unnamed protein product                                281   2e-89    Coffea canephora [robusta coffee]
ref|XP_010025911.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    280   2e-89    Eucalyptus grandis [rose gum]
ref|XP_010025906.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    280   3e-89    Eucalyptus grandis [rose gum]
gb|EEC82468.1|  hypothetical protein OsI_26909                          280   4e-89    Oryza sativa Indica Group [Indian rice]
emb|CDP09728.1|  unnamed protein product                                280   5e-89    Coffea canephora [robusta coffee]
emb|CDP15613.1|  unnamed protein product                                280   6e-89    Coffea canephora [robusta coffee]
ref|XP_010025924.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    278   1e-88    Eucalyptus grandis [rose gum]
emb|CDP15616.1|  unnamed protein product                                280   1e-88    Coffea canephora [robusta coffee]
ref|XP_004958352.1|  PREDICTED: alcohol dehydrogenase-like 2-like       279   1e-88    Setaria italica
ref|XP_006363286.1|  PREDICTED: alcohol dehydrogenase-like 1-like       279   2e-88    Solanum tuberosum [potatoes]
dbj|BAJ90549.1|  predicted protein                                      279   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009103237.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    278   2e-88    Brassica rapa
gb|KFK44338.1|  hypothetical protein AALP_AA1G245100                    278   2e-88    Arabis alpina [alpine rockcress]
ref|XP_010025916.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    278   2e-88    Eucalyptus grandis [rose gum]
gb|EPS73677.1|  hypothetical protein M569_01082                         274   6e-88    Genlisea aurea
ref|XP_006363284.1|  PREDICTED: alcohol dehydrogenase-like 1-like...    277   6e-88    
gb|KJB64116.1|  hypothetical protein B456_010G038400                    274   7e-88    Gossypium raimondii
ref|XP_004238533.1|  PREDICTED: alcohol dehydrogenase-like 1            276   9e-88    
tpg|DAA43801.1|  TPA: putative alcohol dehydrogenase superfamily ...    272   1e-87    
emb|CDP09731.1|  unnamed protein product                                277   1e-87    Coffea canephora [robusta coffee]
ref|XP_006828005.1|  hypothetical protein AMTR_s00008p00242230          276   1e-87    Amborella trichopoda
gb|EMS47035.1|  Alcohol dehydrogenase-like 7                            277   2e-87    Triticum urartu
ref|XP_006416200.1|  hypothetical protein EUTSA_v10007878mg             275   3e-87    Eutrema salsugineum [saltwater cress]
ref|XP_010320184.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    275   4e-87    
emb|CAA18114.1|  alcohol dehydrogenase like protein                     275   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284083.1|  hypothetical protein CARUB_v10005213mg             273   4e-87    
ref|XP_009145341.1|  PREDICTED: alcohol dehydrogenase-like 1            275   5e-87    Brassica rapa
ref|XP_004238532.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    275   5e-87    Solanum lycopersicum
gb|KDO85026.1|  hypothetical protein CISIN_1g016507mg                   274   5e-87    Citrus sinensis [apfelsine]
ref|NP_567645.1|  GroES-like zinc-binding dehydrogenase family pr...    275   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649532.1|  PREDICTED: alcohol dehydrogenase-like 2-like       274   7e-87    
ref|XP_006658830.1|  PREDICTED: alcohol dehydrogenase-like 2-like       274   2e-86    Oryza brachyantha
gb|KJB64120.1|  hypothetical protein B456_010G038400                    273   2e-86    Gossypium raimondii
ref|XP_003561960.1|  PREDICTED: alcohol dehydrogenase-like 2            273   2e-86    Brachypodium distachyon [annual false brome]
gb|KJB64121.1|  hypothetical protein B456_010G038400                    273   2e-86    Gossypium raimondii
ref|XP_006363285.1|  PREDICTED: alcohol dehydrogenase-like 1-like...    273   4e-86    
gb|AAM67260.1|  alcohol dehydrogenase-like protein                      272   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141131.1|  uncharacterized protein LOC100273217               272   5e-86    Zea mays [maize]
gb|KFK44339.1|  hypothetical protein AALP_AA1G245200                    272   9e-86    Arabis alpina [alpine rockcress]
emb|CDY00452.1|  BnaC07g13740D                                          271   2e-85    
ref|XP_002465729.1|  hypothetical protein SORBIDRAFT_01g044580          271   2e-85    
emb|CDY21362.1|  BnaA09g30650D                                          271   2e-85    Brassica napus [oilseed rape]
ref|XP_010459996.1|  PREDICTED: alcohol dehydrogenase-like 1            270   4e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006849437.1|  hypothetical protein AMTR_s00024p00046470          270   6e-85    Amborella trichopoda
ref|XP_010448937.1|  PREDICTED: alcohol dehydrogenase-like 5 isof...    270   7e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006413691.1|  hypothetical protein EUTSA_v10025421mg             269   9e-85    
ref|XP_002890513.1|  hypothetical protein ARALYDRAFT_472482             268   2e-84    Arabidopsis lyrata subsp. lyrata
ref|XP_004985403.1|  PREDICTED: alcohol dehydrogenase-like 2-like       268   2e-84    Setaria italica
ref|XP_006416199.1|  hypothetical protein EUTSA_v10007889mg             267   7e-84    Eutrema salsugineum [saltwater cress]
emb|CDX79124.1|  BnaA01g11910D                                          266   7e-84    
gb|KHG05239.1|  hypothetical protein F383_30798                         266   1e-83    Gossypium arboreum [tree cotton]
emb|CDY04816.1|  BnaC05g17730D                                          266   1e-83    
emb|CDX82904.1|  BnaC01g13540D                                          266   1e-83    
ref|XP_010459997.1|  PREDICTED: alcohol dehydrogenase-like 2            266   1e-83    Camelina sativa [gold-of-pleasure]
gb|EMS47036.1|  Alcohol dehydrogenase-like 7                            269   2e-83    Triticum urartu
ref|XP_009135576.1|  PREDICTED: alcohol dehydrogenase-like 5            266   2e-83    Brassica rapa
gb|KJB64122.1|  hypothetical protein B456_010G038400                    265   3e-83    Gossypium raimondii
ref|NP_173659.1|  GroES-like zinc-binding dehydrogenase family pr...    265   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162243.1|  PREDICTED: alcohol dehydrogenase-like 2-like       265   5e-83    
ref|XP_010064576.1|  PREDICTED: LOW QUALITY PROTEIN: alcohol dehy...    263   5e-83    
ref|XP_004152752.1|  PREDICTED: alcohol dehydrogenase-like 2-like       265   5e-83    
ref|XP_010448935.1|  PREDICTED: alcohol dehydrogenase-like 5 isof...    265   6e-83    
ref|XP_010266957.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    263   1e-82    
ref|XP_010675994.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    264   2e-82    
ref|XP_002890514.1|  hypothetical protein ARALYDRAFT_472484             263   2e-82    
ref|NP_001049223.1|  Os03g0189600                                       263   3e-82    
ref|XP_009110138.1|  PREDICTED: alcohol dehydrogenase-like 2            262   4e-82    Brassica rapa
ref|XP_010498712.1|  PREDICTED: alcohol dehydrogenase-like 2            262   5e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010477503.1|  PREDICTED: alcohol dehydrogenase-like 2            262   5e-82    Camelina sativa [gold-of-pleasure]
gb|EEC74659.1|  hypothetical protein OsI_10323                          261   1e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_008444855.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    261   2e-81    Cucumis melo [Oriental melon]
ref|XP_006305040.1|  hypothetical protein CARUB_v10009406mg             261   2e-81    Capsella rubella
gb|AAN64148.1|  Putative alcohol dehydrogenase                          258   2e-81    Oryza sativa Japonica Group [Japonica rice]
emb|CDX91678.1|  BnaC08g05970D                                          260   2e-81    
ref|XP_010477502.1|  PREDICTED: alcohol dehydrogenase-like 1            260   4e-81    Camelina sativa [gold-of-pleasure]
ref|NP_173660.1|  alcohol dehydrogenase-like 2                          259   5e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CDP01100.1|  unnamed protein product                                260   6e-81    Coffea canephora [robusta coffee]
emb|CDY41481.1|  BnaA08g20830D                                          258   2e-80    Brassica napus [oilseed rape]
ref|XP_010448936.1|  PREDICTED: alcohol dehydrogenase-like 5 isof...    258   2e-80    
gb|KEH35716.1|  zinc-binding alcohol dehydrogenase family protein       256   3e-80    Medicago truncatula
ref|XP_006405265.1|  hypothetical protein EUTSA_v10028276mg             256   1e-79    
gb|KEH35713.1|  zinc-binding alcohol dehydrogenase family protein       255   3e-79    Medicago truncatula
ref|XP_003602833.1|  Alcohol dehydrogenase-like protein                 254   5e-79    Medicago truncatula
ref|XP_004985404.1|  PREDICTED: alcohol dehydrogenase-like 5-like       254   5e-79    Setaria italica
emb|CDP09729.1|  unnamed protein product                                256   6e-79    Coffea canephora [robusta coffee]
ref|XP_004501693.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    252   5e-78    Cicer arietinum [garbanzo]
gb|EEE58467.1|  hypothetical protein OsJ_09715                          248   2e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EMS67661.1|  Alcohol dehydrogenase-like 2                            252   2e-77    Triticum urartu
ref|XP_004501694.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    248   1e-76    
ref|XP_006386151.1|  hypothetical protein POPTR_0002s01480g             248   5e-76    
ref|XP_010676005.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    244   3e-75    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB11813.1|  hypothetical protein B456_002G1197001                   241   1e-74    Gossypium raimondii
gb|EMT16703.1|  Alcohol dehydrogenase-like protein 7                    243   4e-74    
gb|EMT04315.1|  Alcohol dehydrogenase-like protein 2                    235   6e-72    
gb|KJB26825.1|  hypothetical protein B456_004G262400                    231   2e-71    Gossypium raimondii
ref|XP_007018720.1|  GroES-like zinc-binding dehydrogenase family...    233   5e-71    
dbj|BAK06008.1|  predicted protein                                      233   1e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD25091.1|  putative alcohol dehydrogenase                         228   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002263525.1|  PREDICTED: alcohol dehydrogenase-like 6            231   4e-70    Vitis vinifera
gb|KJB26827.1|  hypothetical protein B456_004G262400                    231   6e-70    Gossypium raimondii
ref|XP_010421318.1|  PREDICTED: alcohol dehydrogenase-like 6 isof...    231   7e-70    Camelina sativa [gold-of-pleasure]
gb|KJB26824.1|  hypothetical protein B456_004G262400                    231   7e-70    Gossypium raimondii
ref|XP_006472567.1|  PREDICTED: alcohol dehydrogenase-like 2-like       230   7e-70    Citrus sinensis [apfelsine]
ref|XP_006647577.1|  PREDICTED: alcohol dehydrogenase-like 6-like       230   1e-69    Oryza brachyantha
ref|XP_010421317.1|  PREDICTED: alcohol dehydrogenase-like 6 isof...    230   2e-69    
ref|XP_004953221.1|  PREDICTED: alcohol dehydrogenase-like 6-like...    229   3e-69    Setaria italica
ref|XP_006287936.1|  hypothetical protein CARUB_v10001171mg             229   3e-69    
ref|XP_007209256.1|  hypothetical protein PRUPE_ppa007260mg             228   4e-69    
gb|EAY86827.1|  hypothetical protein OsI_08208                          229   4e-69    Oryza sativa Indica Group [Indian rice]
ref|NP_001047528.1|  Os02g0637700                                       228   9e-69    
gb|AAM62747.1|  alcohol dehydrogenase-like protein                      228   9e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493721.1|  PREDICTED: alcohol dehydrogenase-like 6            228   1e-68    Camelina sativa [gold-of-pleasure]
gb|ACL53051.1|  unknown                                                 224   1e-68    Zea mays [maize]
ref|XP_002874221.1|  hypothetical protein ARALYDRAFT_489336             227   1e-68    
ref|XP_008239269.1|  PREDICTED: alcohol dehydrogenase-like 4            228   1e-68    Prunus mume [ume]
ref|NP_974831.1|  alcohol dehydrogenase-like 6                          226   1e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398007.1|  PREDICTED: alcohol dehydrogenase-like 6            227   1e-68    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP45829.1|  hypothetical protein JCGZ_17436                         223   2e-68    Jatropha curcas
ref|XP_008464880.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    227   2e-68    
ref|NP_568453.1|  alcohol dehydrogenase-like 6                          227   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454800.1|  PREDICTED: alcohol dehydrogenase-like 6            227   2e-68    Camelina sativa [gold-of-pleasure]
ref|XP_009360201.1|  PREDICTED: alcohol dehydrogenase-like 4            227   2e-68    Pyrus x bretschneideri [bai li]
ref|XP_007029344.1|  GroES-like zinc-binding dehydrogenase family...    226   3e-68    Theobroma cacao [chocolate]
gb|KDO81033.1|  hypothetical protein CISIN_1g016363mg                   226   4e-68    Citrus sinensis [apfelsine]
gb|EPS58543.1|  hypothetical protein M569_16269                         226   5e-68    Genlisea aurea
ref|XP_010235759.1|  PREDICTED: alcohol dehydrogenase-like 6            226   5e-68    Brachypodium distachyon [annual false brome]
gb|EYU22310.1|  hypothetical protein MIMGU_mgv1a008308mg                225   7e-68    Erythranthe guttata [common monkey flower]
ref|XP_007029343.1|  GroES-like zinc-binding dehydrogenase family...    226   8e-68    
ref|XP_008374132.1|  PREDICTED: alcohol dehydrogenase-like 4            226   9e-68    Malus domestica [apple tree]
ref|XP_010248788.1|  PREDICTED: alcohol dehydrogenase-like 6            225   9e-68    Nelumbo nucifera [Indian lotus]
ref|XP_010933295.1|  PREDICTED: LOW QUALITY PROTEIN: alcohol dehy...    225   9e-68    Elaeis guineensis
gb|AFW63128.1|  putative alcohol dehydrogenase superfamily protein      223   1e-67    
ref|XP_004152434.1|  PREDICTED: alcohol dehydrogenase-like 6-like       225   1e-67    Cucumis sativus [cucumbers]
ref|XP_004165028.1|  PREDICTED: alcohol dehydrogenase-like 6-like       224   2e-67    
ref|XP_008797217.1|  PREDICTED: alcohol dehydrogenase-like 6            224   2e-67    Phoenix dactylifera
gb|ACF84933.1|  unknown                                                 224   2e-67    Zea mays [maize]
ref|NP_001140515.1|  uncharacterized protein LOC100272578               224   2e-67    Zea mays [maize]
ref|XP_006661644.1|  PREDICTED: alcohol dehydrogenase-like 3-like       224   3e-67    Oryza brachyantha
ref|WP_016916325.1|  S-(hydroxymethyl)glutathione dehydrogenase         223   3e-67    Halomonas stevensii
gb|ACG32355.1|  alcohol dehydrogenase 1                                 224   4e-67    Zea mays [maize]
ref|XP_008437315.1|  PREDICTED: alcohol dehydrogenase-like 6            223   4e-67    Cucumis melo [Oriental melon]
ref|XP_010251993.1|  PREDICTED: alcohol dehydrogenase-like 4            223   6e-67    Nelumbo nucifera [Indian lotus]
ref|XP_004309528.1|  PREDICTED: alcohol dehydrogenase-like 4            223   7e-67    Fragaria vesca subsp. vesca
ref|WP_016416927.1|  S-(hydroxymethyl)glutathione dehydrogenase         223   7e-67    Halomonas anticariensis
ref|WP_016417259.1|  S-(hydroxymethyl)glutathione dehydrogenase         223   7e-67    Halomonas anticariensis
ref|XP_002454226.1|  hypothetical protein SORBIDRAFT_04g027090          223   7e-67    Sorghum bicolor [broomcorn]
gb|KJB26826.1|  hypothetical protein B456_004G262400                    223   8e-67    Gossypium raimondii
ref|WP_009100342.1|  S-(hydroxymethyl)glutathione dehydrogenase         222   9e-67    Halomonas sp. GFAJ-1
ref|XP_011072086.1|  PREDICTED: alcohol dehydrogenase-like 6            222   1e-66    Sesamum indicum [beniseed]
ref|WP_043517068.1|  S-(hydroxymethyl)glutathione dehydrogenase         222   1e-66    Halomonas sp. BC04
ref|WP_009833926.1|  S-(hydroxymethyl)glutathione dehydrogenase         222   1e-66    Marinomonas sp. MED121
gb|ADE77753.1|  unknown                                                 218   2e-66    Picea sitchensis
ref|XP_010037040.1|  PREDICTED: alcohol dehydrogenase-like 6            221   2e-66    
ref|XP_007039362.1|  Alcohol dehydrogenase, putative isoform 1          222   2e-66    
ref|XP_007039363.1|  Alcohol dehydrogenase, putative isoform 2          222   2e-66    
ref|WP_012488916.1|  S-(hydroxymethyl)glutathione dehydrogenase         221   3e-66    
ref|XP_002305695.1|  alcohol dehydrogenase family protein               221   3e-66    
ref|WP_029797595.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   3e-66    
ref|XP_009355914.1|  PREDICTED: alcohol dehydrogenase-like 6 isof...    220   3e-66    
ref|WP_009721440.1|  S-(hydroxymethyl)glutathione dehydrogenase         221   4e-66    
gb|AAC49548.1|  alcohol dehydrogenase                                   221   5e-66    
ref|WP_039175638.1|  S-(hydroxymethyl)glutathione dehydrogenase         220   5e-66    
ref|XP_011035415.1|  PREDICTED: alcohol dehydrogenase-like 6            220   6e-66    
ref|XP_004299450.1|  PREDICTED: alcohol dehydrogenase-like 6            220   6e-66    
ref|WP_043527898.1|  S-(hydroxymethyl)glutathione dehydrogenase         220   7e-66    
ref|WP_043516709.1|  S-(hydroxymethyl)glutathione dehydrogenase         220   7e-66    
gb|AAC49542.1|  alcohol dehydrogenase                                   220   8e-66    
ref|XP_010911728.1|  PREDICTED: alcohol dehydrogenase 2-like            220   8e-66    
ref|WP_027853794.1|  S-(hydroxymethyl)glutathione dehydrogenase         219   1e-65    
ref|WP_021818423.1|  S-(hydroxymethyl)glutathione dehydrogenase         219   1e-65    
ref|XP_008676744.1|  PREDICTED: uncharacterized protein LOC100272...    220   1e-65    
dbj|BAJ92604.1|  predicted protein                                      220   1e-65    
ref|NP_001064203.1|  Os10g0159800                                       220   1e-65    
ref|XP_009355913.1|  PREDICTED: alcohol dehydrogenase-like 6 isof...    220   1e-65    
ref|WP_039915717.1|  S-(hydroxymethyl)glutathione dehydrogenase         219   1e-65    
ref|WP_025635707.1|  S-(hydroxymethyl)glutathione dehydrogenase         219   2e-65    
ref|XP_009404957.1|  PREDICTED: alcohol dehydrogenase 3-like            219   2e-65    
gb|EMS68285.1|  Alcohol dehydrogenase-like 6                            219   2e-65    
ref|WP_029801416.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   2e-65    
gb|AFK43653.1|  unknown                                                 216   2e-65    
gb|KJB24123.1|  hypothetical protein B456_004G129000                    217   2e-65    
ref|WP_030073780.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   3e-65    
ref|XP_003619782.1|  Alcohol dehydrogenase                              219   3e-65    
ref|WP_007639640.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   3e-65    
emb|CDP20440.1|  unnamed protein product                                219   3e-65    
ref|XP_002991527.1|  hypothetical protein SELMODRAFT_236308             219   3e-65    
ref|WP_044629657.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   3e-65    
ref|WP_027336533.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   3e-65    
ref|XP_002979053.1|  hypothetical protein SELMODRAFT_109935             218   4e-65    
ref|WP_025626233.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   4e-65    
ref|WP_035474924.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   4e-65    
ref|WP_036183939.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   4e-65    
emb|CDP12243.1|  unnamed protein product                                218   5e-65    
gb|AAC49547.1|  alcohol dehydrogenase                                   218   5e-65    
gb|EAY77769.1|  hypothetical protein OsI_32807                          219   5e-65    
ref|XP_008240327.1|  PREDICTED: alcohol dehydrogenase-like 6 isof...    217   5e-65    
gb|ABR17509.1|  unknown                                                 218   6e-65    
ref|WP_019018948.1|  S-(hydroxymethyl)glutathione dehydrogenase         218   6e-65    
ref|XP_004983362.1|  PREDICTED: alcohol dehydrogenase-like 3-like...    218   6e-65    
ref|XP_008375076.1|  PREDICTED: alcohol dehydrogenase-like 6            218   6e-65    
gb|KJB24125.1|  hypothetical protein B456_004G129000                    216   7e-65    
ref|WP_031384588.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   7e-65    
ref|XP_006848654.1|  hypothetical protein AMTR_s00171p00060310          218   8e-65    
ref|WP_025534865.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
gb|AAC49541.1|  alcohol dehydrogenase                                   217   1e-64    
ref|WP_025540080.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
ref|WP_027966224.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
ref|WP_042770791.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
ref|NP_001169684.1|  uncharacterized protein LOC100383565               218   1e-64    
ref|XP_010100218.1|  Alcohol dehydrogenase-like 3                       217   1e-64    
ref|WP_038477575.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   1e-64    
ref|WP_025574077.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
ref|WP_025524181.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
ref|WP_042772501.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
ref|WP_005464962.1|  S-(hydroxymethyl)glutathione dehydrogenase         217   1e-64    
gb|KJB24126.1|  hypothetical protein B456_004G129000                    217   2e-64    
ref|XP_010461094.1|  PREDICTED: alcohol dehydrogenase-like 3 isof...    217   2e-64    
gb|EMT32052.1|  Alcohol dehydrogenase-like protein 6                    218   2e-64    
ref|XP_008240325.1|  PREDICTED: alcohol dehydrogenase-like 6 isof...    217   2e-64    
ref|WP_026377219.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
ref|XP_002464720.1|  hypothetical protein SORBIDRAFT_01g025580          217   2e-64    
ref|XP_004492437.1|  PREDICTED: alcohol dehydrogenase-like 3-like...    217   2e-64    
gb|KFK45027.1|  hypothetical protein AALP_AA1G334700                    217   2e-64    
ref|WP_042779805.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
sp|P25141.1|ADH1_PETHY  RecName: Full=Alcohol dehydrogenase 1           216   2e-64    
ref|WP_029838335.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
ref|WP_014249435.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
gb|AAC49543.1|  alcohol dehydrogenase                                   216   2e-64    
ref|WP_004226722.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
ref|XP_006478148.1|  PREDICTED: alcohol dehydrogenase-like 6-like       216   2e-64    
ref|XP_006305007.1|  hypothetical protein CARUB_v10009372mg             217   2e-64    
ref|WP_040134931.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
ref|WP_014197521.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
ref|WP_010324940.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   2e-64    
ref|WP_016853723.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   3e-64    
ref|WP_040480830.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   3e-64    
gb|EPS74119.1|  alcohol dehydrogenase 1                                 216   3e-64    
ref|WP_021706490.1|  putative S-(hydroxymethyl)glutathione dehydr...    216   3e-64    
gb|EHJ92726.1|  S-(hydroxymethyl)glutathione dehydrogenase              216   3e-64    
ref|WP_035597919.1|  S-(hydroxymethyl)glutathione dehydrogenase         216   3e-64    
ref|XP_006415150.1|  hypothetical protein EUTSA_v10007838mg             216   4e-64    
ref|WP_008955516.1|  MULTISPECIES: S-(hydroxymethyl)glutathione d...    216   4e-64    
ref|WP_035558881.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   4e-64    
ref|XP_007048342.1|  Alcohol dehydrogenase 1                            216   4e-64    
gb|ABK22362.1|  unknown                                                 216   5e-64    
gb|KDO55970.1|  hypothetical protein CISIN_1g017052mg                   215   5e-64    
ref|WP_042704431.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   5e-64    
ref|XP_006441485.1|  hypothetical protein CICLE_v10020629mg             215   5e-64    
ref|WP_029845192.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   5e-64    
ref|WP_024302040.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   5e-64    
ref|WP_019016860.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   5e-64    
ref|WP_016353435.1|  alcohol dehydrogenase GroES-like protein           215   5e-64    
ref|WP_042762794.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   5e-64    
gb|AFQ33010.1|  Adh3                                                    214   5e-64    
ref|XP_010906060.1|  PREDICTED: alcohol dehydrogenase-like 3            216   5e-64    
gb|ABK21597.1|  unknown                                                 215   6e-64    
gb|ABK24617.1|  unknown                                                 215   6e-64    
ref|WP_021448222.1|  S-(hydroxymethyl)glutathione dehydrogenase/c...    215   7e-64    
ref|XP_004983360.1|  PREDICTED: alcohol dehydrogenase-like 3-like...    216   7e-64    
ref|XP_010245834.1|  PREDICTED: alcohol dehydrogenase 1-like            215   7e-64    
ref|WP_029827659.1|  S-(hydroxymethyl)glutathione dehydrogenase         215   7e-64    
tpg|DAA46748.1|  TPA: putative alcohol dehydrogenase superfamily ...    211   8e-64    
ref|WP_035677036.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   8e-64    
ref|WP_036162778.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   8e-64    
ref|WP_012977382.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   9e-64    
ref|WP_018916457.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
ref|WP_025631372.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
gb|ABK24000.1|  unknown                                                 214   1e-63    
gb|EPS61782.1|  hypothetical protein M569_13006                         214   1e-63    
ref|XP_002272348.1|  PREDICTED: alcohol dehydrogenase-like 3            215   1e-63    
ref|WP_019795275.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
ref|XP_003530282.2|  PREDICTED: alcohol dehydrogenase-like 3-like       215   1e-63    
ref|WP_041025897.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
ref|WP_028115190.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
ref|XP_002464718.1|  hypothetical protein SORBIDRAFT_01g025570          215   1e-63    
ref|WP_035585046.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
gb|KHN11890.1|  Alcohol dehydrogenase-like 3                            215   1e-63    
gb|ABK26386.1|  unknown                                                 214   1e-63    
ref|XP_002893741.1|  hypothetical protein ARALYDRAFT_473464             214   1e-63    
ref|XP_007209245.1|  hypothetical protein PRUPE_ppa007182mg             214   1e-63    
ref|WP_008956357.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   1e-63    
ref|XP_009389519.1|  PREDICTED: alcohol dehydrogenase 1                 214   2e-63    
ref|WP_031854242.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   2e-63    
gb|ABK25078.1|  unknown                                                 216   2e-63    
ref|XP_010499820.1|  PREDICTED: alcohol dehydrogenase-like 3            214   2e-63    
ref|XP_010912628.1|  PREDICTED: alcohol dehydrogenase 3-like isof...    215   2e-63    
ref|XP_010478698.1|  PREDICTED: alcohol dehydrogenase-like 3            214   2e-63    
emb|CAB61764.1|  alcohol dehydrogenase                                  209   2e-63    
ref|WP_005374381.1|  S-(hydroxymethyl)glutathione dehydrogenase         214   2e-63    
ref|XP_010529668.1|  PREDICTED: alcohol dehydrogenase-like 3 isof...    214   2e-63    
ref|WP_017633834.1|  MULTISPECIES: S-(hydroxymethyl)glutathione d...    214   2e-63    
gb|KJB29049.1|  hypothetical protein B456_005G081700                    214   2e-63    
ref|XP_005800653.1|  PREDICTED: alcohol dehydrogenase class-3-like      213   3e-63    
gb|KHM99754.1|  Alcohol dehydrogenase-like 6                            213   3e-63    
ref|XP_010912627.1|  PREDICTED: alcohol dehydrogenase 3-like isof...    215   3e-63    
ref|WP_011391152.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   3e-63    
sp|A2XAZ3.1|ADHX_ORYSI  RecName: Full=Alcohol dehydrogenase class...    213   3e-63    
ref|NP_001048503.1|  Os02g0815500                                       213   3e-63    
gb|AAB19117.1|  class III ADH enzyme                                    213   3e-63    
ref|WP_007947408.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   3e-63    
ref|XP_006804610.1|  PREDICTED: alcohol dehydrogenase class-3-like      213   3e-63    
gb|AAM64605.1|  alcohol dehydrogenase, putative                         214   3e-63    
ref|WP_029131729.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   3e-63    
ref|XP_006280634.1|  hypothetical protein CARUB_v10026595mg             213   4e-63    
ref|XP_007140349.1|  hypothetical protein PHAVU_008G1047001g            207   4e-63    
ref|XP_007152515.1|  hypothetical protein PHAVU_004G136700g             213   4e-63    
gb|KHG11877.1|  Alcohol dehydrogenase class-P -like protein             213   4e-63    
ref|XP_010556868.1|  PREDICTED: alcohol dehydrogenase class-3           213   4e-63    
dbj|GAJ74348.1|  S-(hydroxymethyl)glutathione dehydrogenase             213   4e-63    
ref|XP_006394728.1|  hypothetical protein EUTSA_v10004400mg             213   4e-63    
ref|NP_564409.1|  GroES-like zinc-binding dehydrogenase family pr...    213   4e-63    
ref|WP_021269580.1|  S-(hydroxymethyl)glutathione dehydrogenase/c...    213   4e-63    
ref|WP_011381570.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   4e-63    
ref|WP_008483679.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   4e-63    
gb|AAB39597.1|  alcohol dehydrogenase B                                 213   4e-63    
dbj|BAF98546.1|  alcohol dehydrogenase                                  211   4e-63    
gb|ADF80914.1|  alcohol dehydrogenase I                                 213   4e-63    
emb|CDQ33501.1|  S-(hydroxymethyl)glutathione dehydrogenase             213   5e-63    
ref|XP_008811874.1|  PREDICTED: alcohol dehydrogenase-like 4            214   5e-63    
gb|ADF80911.1|  alcohol dehydrogenase I                                 213   5e-63    
ref|WP_028110991.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   5e-63    
gb|AAC49539.1|  alcohol dehydrogenase                                   213   5e-63    
ref|WP_005391984.1|  MULTISPECIES: S-(hydroxymethyl)glutathione d...    213   5e-63    
ref|XP_010912629.1|  PREDICTED: alcohol dehydrogenase 3-like            214   5e-63    
ref|WP_017821027.1|  MULTISPECIES: S-(hydroxymethyl)glutathione d...    213   5e-63    
dbj|BAF98539.1|  alcohol dehydrogenase                                  211   5e-63    
ref|WP_005383271.1|  S-(hydroxymethyl)glutathione dehydrogenase         213   5e-63    
dbj|BAF98557.1|  alcohol dehydrogenase                                  211   5e-63    
ref|XP_003571647.1|  PREDICTED: alcohol dehydrogenase-like 3            213   5e-63    
dbj|BAF98504.1|  alcohol dehydrogenase                                  211   6e-63    
emb|CAC08250.1|  alcohol dehydrogenase-like protein                     213   6e-63    
dbj|BAF98489.1|  alcohol dehydrogenase                                  211   6e-63    
dbj|BAF98483.1|  alcohol dehydrogenase                                  211   6e-63    
ref|XP_006403161.1|  hypothetical protein EUTSA_v10003230mg             212   6e-63    
gb|ACF81000.2|  unknown                                                 213   6e-63    
dbj|BAF98506.1|  alcohol dehydrogenase                                  211   6e-63    
ref|XP_007551129.1|  PREDICTED: alcohol dehydrogenase class-3           213   6e-63    
gb|KIT32009.1|  S-(hydroxymethyl)glutathione dehydrogenase              213   6e-63    
ref|XP_010244042.1|  PREDICTED: alcohol dehydrogenase 3-like            213   6e-63    
gb|AAA98984.1|  alcohol dehydrogenase 2d                                213   6e-63    
dbj|BAF98532.1|  alcohol dehydrogenase                                  211   6e-63    
ref|WP_019557843.1|  S-(hydroxymethyl)glutathione dehydrogenase         212   6e-63    
ref|WP_023006706.1|  S-(hydroxymethyl)glutathione dehydrogenase         212   6e-63    
dbj|BAF98530.1|  alcohol dehydrogenase                                  211   6e-63    
ref|XP_004512682.1|  PREDICTED: alcohol dehydrogenase-like 6-like       213   6e-63    
ref|XP_011074782.1|  PREDICTED: alcohol dehydrogenase 1                 213   7e-63    
dbj|BAF98505.1|  alcohol dehydrogenase                                  211   7e-63    
gb|KCW69232.1|  hypothetical protein EUGRSUZ_F02744                     211   7e-63    
ref|XP_003537123.1|  PREDICTED: alcohol dehydrogenase class-3-like      212   8e-63    
gb|KJB29056.1|  hypothetical protein B456_005G082300                    212   8e-63    
ref|XP_010244039.1|  PREDICTED: alcohol dehydrogenase-like              212   8e-63    
ref|WP_008017320.1|  S-(hydroxymethyl)glutathione dehydrogenase         212   8e-63    
gb|ADF80905.1|  alcohol dehydrogenase I                                 212   8e-63    
gb|KDP35777.1|  hypothetical protein JCGZ_10413                         208   9e-63    
gb|KCW69231.1|  hypothetical protein EUGRSUZ_F02744                     211   9e-63    
ref|XP_006403162.1|  hypothetical protein EUTSA_v10003230mg             212   9e-63    
ref|XP_010037038.1|  PREDICTED: alcohol dehydrogenase-like 6            212   9e-63    
ref|WP_027958011.1|  MULTISPECIES: S-(hydroxymethyl)glutathione d...    212   9e-63    
ref|WP_040185588.1|  S-(hydroxymethyl)glutathione dehydrogenase         212   1e-62    
dbj|BAF98573.1|  alcohol dehydrogenase                                  210   1e-62    
gb|KJB29052.1|  hypothetical protein B456_005G081900                    212   1e-62    
ref|XP_010684796.1|  PREDICTED: alcohol dehydrogenase class-3           212   1e-62    
gb|AAC49545.1|  alcohol dehydrogenase                                   212   1e-62    
gb|EZQ19264.1|  S-(hydroxymethyl)glutathione dehydrogenase              212   1e-62    
ref|WP_022522388.1|  S-(hydroxymethyl)glutathione dehydrogenase         212   1e-62    
ref|XP_006830617.1|  hypothetical protein AMTR_s00120p00067860          212   1e-62    
ref|XP_003534074.1|  PREDICTED: alcohol dehydrogenase-like 6-like       212   1e-62    
ref|XP_010910557.1|  PREDICTED: alcohol dehydrogenase 1                 212   1e-62    
gb|KJB24124.1|  hypothetical protein B456_004G129000                    212   1e-62    
ref|WP_043045879.1|  S-(hydroxymethyl)glutathione dehydrogenase         212   1e-62    
gb|ADF80907.1|  alcohol dehydrogenase I                                 212   1e-62    
ref|XP_002317673.2|  hypothetical protein POPTR_0011s15610g             213   1e-62    
ref|XP_010679876.1|  PREDICTED: alcohol dehydrogenase 3                 212   1e-62    



>ref|XP_010101303.1| Alcohol dehydrogenase-like 7 [Morus notabilis]
 gb|EXB88238.1| Alcohol dehydrogenase-like 7 [Morus notabilis]
Length=390

 Score =   357 bits (915),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA RSA+VE GSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+NPDK
Sbjct  181  ACLLSCGISTGVGAAWRSADVEAGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN    G+KSVSQVI EMTGGGADYCFECVG+A+LVQEAYA CRKGWG
Sbjct  241  FEVGKKFGVTDFVNGANSGDKSVSQVINEMTGGGADYCFECVGRASLVQEAYACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKPG+Q++L++ +VLHSGKTL GSLFGGLKPKSDIPVL KRY+D ELELDKFV
Sbjct  301  KTVVLGVDKPGSQVTLSATDVLHSGKTLQGSLFGGLKPKSDIPVLLKRYTDKELELDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+GF+DINKAFDLL++G  LRCVIWMDK
Sbjct  361  THEIGFDDINKAFDLLLEGCCLRCVIWMDK  390



>ref|XP_009762562.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana sylvestris]
Length=390

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTGVGAA ++ANVEPGSTV IFGLG+IGLAVAEGARLCGA RIIGVDIN DK
Sbjct  181  ACLFSCGVSTGVGAAWKTANVEPGSTVVIFGLGAIGLAVAEGARLCGATRIIGVDINSDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DF+NS + G+K +SQVI EMT GGADYCFECVG  TLVQEA+A CRKGWG
Sbjct  241  FEIGKQFGVTDFINSNSCGDKPISQVIIEMTNGGADYCFECVGLGTLVQEAFACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKPGAQL+LNSFEVL S KTL G+LFGGLKPKSD+P+L KRY D EL+LDKFV
Sbjct  301  KTVVLGVDKPGAQLNLNSFEVLTSRKTLTGALFGGLKPKSDVPILVKRYLDKELQLDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLLIQGKSLRCVIWMDK
Sbjct  361  THEVNFEDINKAFDLLIQGKSLRCVIWMDK  390



>ref|XP_009613178.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana tomentosiformis]
Length=389

 Score =   352 bits (903),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTG+GAA+++ANVEPGSTV IFGLG+IGLAVAEGAR+CGA RIIGVDIN DK
Sbjct  180  ACLFSCGVSTGLGAALKTANVEPGSTVVIFGLGAIGLAVAEGARICGATRIIGVDINSDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVNS + G+K +SQVI EMT GGADYCFECVG  T+VQEAYA CRKGWG
Sbjct  240  FEIGKQFGVTDFVNSNSFGDKPISQVINEMTNGGADYCFECVGLGTVVQEAYACCRKGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA L+  SF+VLHSGKTL+GSLFGGLKPKSDIP+L KRY D E +LDKFV
Sbjct  300  KTIVLGVDKPGADLTFKSFDVLHSGKTLMGSLFGGLKPKSDIPLLVKRYLDKEFQLDKFV  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL QGKSLRCVIWMDK
Sbjct  360  THEVSFQDINKAFDLLAQGKSLRCVIWMDK  389



>ref|XP_009774475.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana sylvestris]
Length=388

 Score =   352 bits (902),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTG+GAA ++ANVEPGSTV IFGLG+IGLAVAEGAR+CGA RIIGVDIN DK
Sbjct  179  ACLFSCGVSTGLGAAFKTANVEPGSTVVIFGLGAIGLAVAEGARICGATRIIGVDINSDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVNS + G+K +SQ+I EMT GGADYCFECVG  T+VQEAYA CRKGWG
Sbjct  239  FEIGKQFGVTDFVNSNSFGDKPISQLINEMTNGGADYCFECVGLGTVVQEAYACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA L+  SF+VLHSGKTL+GSLFGGLKPKSDIP+L KRY D EL+LDKFV
Sbjct  299  KTIVLGVDKPGADLTFKSFDVLHSGKTLMGSLFGGLKPKSDIPLLVKRYLDKELQLDKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL QGKSLRCVIWMDK
Sbjct  359  THEVSFQDINKAFDLLAQGKSLRCVIWMDK  388



>ref|XP_011099657.1| PREDICTED: alcohol dehydrogenase-like 7 [Sesamum indicum]
Length=383

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA RSANVE GSTVAIFGLGSIGLAVAEGARLCGA +IIG+D+NP+K
Sbjct  174  ACLLSCGVSTGVGAAWRSANVEAGSTVAIFGLGSIGLAVAEGARLCGATKIIGIDVNPEK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FGV+DFV++ + G + +S++I EMTGGGADYCFECVG+A+LV+EAYA CRKGWG
Sbjct  234  YEIGKRFGVTDFVDTRSCGERRLSEIINEMTGGGADYCFECVGKASLVEEAYACCRKGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKPGAQL+L+SFEVLH+GK L+GSLFGGLKPKSDIP+L KRY D ELELDKFV
Sbjct  294  KTVVLGVDKPGAQLTLSSFEVLHTGKALLGSLFGGLKPKSDIPILIKRYIDQELELDKFV  353

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  +DINKA DLL++GKSLRCVIWMDK
Sbjct  354  THEVSLDDINKAIDLLLEGKSLRCVIWMDK  383



>ref|XP_009605587.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana tomentosiformis]
Length=391

 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTGVGAA ++A+VEPGSTV IFGLG+IGLAVAEGARLCGA RIIGVDIN DK
Sbjct  181  ACLFSCGVSTGVGAAWKTADVEPGSTVVIFGLGAIGLAVAEGARLCGATRIIGVDINSDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DF+NS   G+K +SQVI EMT GGADYCFECVG  TLVQEA+A CRKGWG
Sbjct  241  FEIGKQFGVTDFINSNNCGDKPISQVIIEMTNGGADYCFECVGLGTLVQEAFACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
             TVVLGVDKPGAQL+LNSFEVL S KTL G+LFGGLKPKSD+P+L KRY D EL+LDKFV
Sbjct  301  ITVVLGVDKPGAQLNLNSFEVLTSKKTLTGALFGGLKPKSDVPILVKRYLDKELQLDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLLIQGKSLRCVIWMDK
Sbjct  361  THEVNFEDINKAFDLLIQGKSLRCVIWMDK  390



>ref|XP_006342106.1| PREDICTED: alcohol dehydrogenase-like 7-like [Solanum tuberosum]
Length=388

 Score =   349 bits (895),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVEPGSTV IFGLGS+GLAVAEGARLCGA RIIGV  N DK
Sbjct  179  ACLLSCGVSTGVGAAWKTANVEPGSTVVIFGLGSVGLAVAEGARLCGATRIIGVGRNSDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS + G+K VSQVI EMT GGADYCFECVG ATLVQEA+A CRKGWG
Sbjct  239  FEIGKQFGVTEFVNSKSCGDKPVSQVIIEMTNGGADYCFECVGLATLVQEAFACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKP AQL+L+SFEVL S KTL GS FGGLKPKSD+P+L KRY D ELELDKFV
Sbjct  299  KTIVLGVDKPDAQLNLSSFEVLQSQKTLTGSFFGGLKPKSDVPILVKRYLDKELELDKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLLIQGKSLRCVIWMDK
Sbjct  359  THEVNFKDINKAFDLLIQGKSLRCVIWMDK  388



>ref|XP_006342549.1| PREDICTED: alcohol dehydrogenase-like 7-like [Solanum tuberosum]
Length=389

 Score =   348 bits (894),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTGVGAA+++ANVE GSTV IFGLG IGLAVAEG+R+CGA+RIIGVDIN DK
Sbjct  180  ACLFSCGVSTGVGAALKTANVEQGSTVVIFGLGGIGLAVAEGSRICGASRIIGVDINTDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVNS + G+K +SQVI EMT GGADYCFECVG  TLVQEAYA CRKGWG
Sbjct  240  FEIGKQFGVTDFVNSNSYGDKPISQVINEMTNGGADYCFECVGMGTLVQEAYACCRKGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA L+  SF++LH GKT++GSLFGGLKPKSD+P+L KRY D ELELDKFV
Sbjct  300  KTIVLGVDKPGAMLTFKSFDILHMGKTIMGSLFGGLKPKSDVPLLVKRYLDKELELDKFV  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL++GKSLRCVIWMDK
Sbjct  360  THEVSFQDINKAFDLLVEGKSLRCVIWMDK  389



>gb|AAB33480.2| alcohol dehydrogenase ADH [Solanum lycopersicum]
Length=389

 Score =   348 bits (894),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVEPGSTV IFGLGSIGLAVAEGARLCGA RIIGVDIN +K
Sbjct  179  ACLLSCGVSTGVGAAWKTANVEPGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDINSNK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG+++FVNS +  +K +SQVI EMT GGADYCFECVG ATLVQEA+  CRKGWG
Sbjct  239  FEIGKQFGITEFVNSKSCVDKPISQVIIEMTDGGADYCFECVGLATLVQEAFTCCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKP A L+LNSFEVL S KTL G+LFGGLKPKSD+P+L KRY D EL+L+KFV
Sbjct  299  KTVVLGVDKPDAHLNLNSFEVLQSQKTLTGALFGGLKPKSDVPILVKRYLDKELQLNKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLLIQGKSLRCVIWMDK
Sbjct  359  THEVNFEDINKAFDLLIQGKSLRCVIWMDK  388



>ref|XP_004238409.1| PREDICTED: alcohol dehydrogenase-like 7 [Solanum lycopersicum]
Length=389

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVEPGSTV IFGLGSIGLAVAEGARLCGA RIIGVDIN +K
Sbjct  179  ACLLSCGVSTGVGAAWKTANVEPGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDINSNK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG+++FVNS +  +K +SQVI EMT GGADYCFECVG ATLVQEA+  CRKGWG
Sbjct  239  FEIGKQFGITEFVNSKSCVDKPISQVIIEMTDGGADYCFECVGLATLVQEAFTCCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKP A L+LNSFEVL S KTL G+LFGGLKPKSD+P+L KRY D EL+L+KFV
Sbjct  299  KTVVLGVDKPDAHLNLNSFEVLQSQKTLTGALFGGLKPKSDVPILVKRYLDKELQLNKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLLIQGKSLRCVIWMDK
Sbjct  359  THEVNFEDINKAFDLLIQGKSLRCVIWMDK  388



>gb|KDP36844.1| hypothetical protein JCGZ_08135 [Jatropha curcas]
Length=395

 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGARLCGAARIIG+D+NPDK
Sbjct  177  ACLLSCGVSTGVGAAWRTANVESGSTVAIFGLGSIGLAVAEGARLCGAARIIGIDMNPDK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN+   G+KSVSQVI EMTGGGADYCFEC+G A+LVQEAY+ CRKGWG
Sbjct  237  FEIGKKFGVTDFVNTGDCGSKSVSQVINEMTGGGADYCFECIGLASLVQEAYSCCRKGWG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA+LSL+SF+VLH GK L GSLFGG+K KSDIP L KRY D EL LD+FV
Sbjct  297  KTIVLGVDKPGAKLSLSSFDVLHHGKILTGSLFGGIKAKSDIPTLLKRYMDKELHLDEFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDINKAFDLLIQGK LRCVIWM
Sbjct  357  THEMNFEDINKAFDLLIQGKCLRCVIWM  384



>gb|EYU17538.1| hypothetical protein MIMGU_mgv1a007994mg [Erythranthe guttata]
Length=388

 Score =   347 bits (890),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA +SANVE GSTVAIFGLGSIGLAVAEGARLCGAA+IIG+D+NP+K
Sbjct  179  ACLLSCGVSTGVGAAWKSANVEAGSTVAIFGLGSIGLAVAEGARLCGAAKIIGIDVNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E  K FGV+DFV+S   G K VSQ++ EMTGGGADYCFECVG+A+LV+EAY+ CRKGWG
Sbjct  239  IEISKKFGVTDFVDSKNCGEKRVSQIVNEMTGGGADYCFECVGKASLVEEAYSCCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVD+PG++L+ +S EVLH GKTL+GSLFGGLKPKSDIP+L +RY D ELELDKFV
Sbjct  299  KTVVLGVDQPGSKLTFSSHEVLHRGKTLMGSLFGGLKPKSDIPILIQRYMDKELELDKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAFDLL+ GKSLRCVIWM+K
Sbjct  359  THEVGFEDINKAFDLLVVGKSLRCVIWMNK  388



>ref|XP_004238410.1| PREDICTED: alcohol dehydrogenase-like 7 [Solanum lycopersicum]
Length=390

 Score =   346 bits (888),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVEPGSTV IFGLGS+GLAVAEGARLCGA RIIGV  N DK
Sbjct  181  ACLLSCGVSTGVGAAWKTANVEPGSTVVIFGLGSVGLAVAEGARLCGATRIIGVGRNSDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS + G+K VSQVI EMT GGADYCFECVG  TLVQEA+A CRKGWG
Sbjct  241  FEIGKQFGVTEFVNSKSCGDKPVSQVIIEMTNGGADYCFECVGLGTLVQEAFACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKP A+L+LNSFEVL S KTL+GS FGGLKPKSD+P+L KRY D ELELDKFV
Sbjct  301  KTIVLGVDKPDARLNLNSFEVLQSNKTLMGSFFGGLKPKSDVPILVKRYLDKELELDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  EDINKAFDLLIQGKSLRCVIWM+K
Sbjct  361  THEVNLEDINKAFDLLIQGKSLRCVIWMEK  390



>ref|XP_002285916.1| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera]
 ref|XP_010664091.1| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera]
 emb|CBI18886.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   343 bits (881),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTGVGAA ++ANVE GSTVAIFGLG+IGLAVAEGARLCGA+RIIGVD+NPDK
Sbjct  175  ACLFSCGVSTGVGAAWKTANVEKGSTVAIFGLGAIGLAVAEGARLCGASRIIGVDLNPDK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVNS   GNK V QVI EMT GGADYCFECVG A+LV EA+A CRKGWG
Sbjct  235  FEIGKKFGVTDFVNSGNCGNKPVKQVIMEMTDGGADYCFECVGAASLVHEAFACCRKGWG  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+ L+  SF++LHSGK+L+GSL+GG+KPKSDIP+L KRY D EL++DKFV
Sbjct  295  KTIVLGVDRPGSMLNFLSFDILHSGKSLMGSLYGGVKPKSDIPILLKRYMDKELDVDKFV  354

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAFDLLIQGKSLRCV+WMDK
Sbjct  355  THEMRFEDINKAFDLLIQGKSLRCVLWMDK  384



>ref|XP_002510634.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF52821.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=386

 Score =   343 bits (881),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD NP+K
Sbjct  177  ACLLSCGVSTGVGAAWRTANVEAGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDTNPNK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FV++  +GNKS SQVI EMTGGGADYCFECVG A+LV+EAY+ CRKGWG
Sbjct  237  FEIGKKFGVTEFVSAGDLGNKSASQVINEMTGGGADYCFECVGLASLVREAYSCCRKGWG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGAQLSL+SF+VLHSGK L GSLFGGLK KSDIPVL KRY+  EL+LD+FV
Sbjct  297  KTIVLGVDKPGAQLSLSSFDVLHSGKILTGSLFGGLKAKSDIPVLLKRYTAKELQLDEFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAFDLLI G+SLRCVIWM+K
Sbjct  357  THEINFEDINKAFDLLIGGESLRCVIWMNK  386



>gb|KHN26031.1| Alcohol dehydrogenase-like 7 [Glycine soja]
Length=387

 Score =   343 bits (881),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VEPGSTV IFGLGSIGLAVAEGARLCGA RIIGVD+NP+K
Sbjct  178  ACLLSCGVSTGVGAAWRTAGVEPGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVNPEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV++    NKSVSQVI EMTGGGADYCFECVG ATLVQEAYASCRKGWG
Sbjct  238  YETGKKFGLTDFVHAGESENKSVSQVIIEMTGGGADYCFECVGMATLVQEAYASCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K +VLGV+KPG+ LSL+  EVLHSGK+L+G LFGGLKPKSD+P+L KRY D EL LD+FV
Sbjct  298  KAIVLGVEKPGSMLSLSCNEVLHSGKSLVGCLFGGLKPKSDVPILLKRYMDKELNLDEFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLLI+G+ LRCVIWMD+
Sbjct  358  THEVEFKDINKAFDLLIEGQCLRCVIWMDR  387



>ref|XP_003545495.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform 1 [Glycine 
max]
Length=387

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VEPGSTV IFGLGSIGLAVAEGARLCGA RIIGVD+NP+K
Sbjct  178  ACLLSCGVSTGVGAAWRTAGVEPGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVNPEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV++    NKSVSQVI EMTGGGADYCFECVG ATLVQEAYASCRKGWG
Sbjct  238  YETGKKFGLTDFVHAGESENKSVSQVIIEMTGGGADYCFECVGMATLVQEAYASCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K +VLGV+KPG+ LSL+  EVLHSGK+L+G LFGGLKPKSD+P+L KRY D EL LD+FV
Sbjct  298  KAIVLGVEKPGSMLSLSCNEVLHSGKSLVGCLFGGLKPKSDVPILLKRYMDKELNLDEFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLLI+G+ LRCVIWMD+
Sbjct  358  THEVEFKDINKAFDLLIEGQCLRCVIWMDR  387



>gb|KDO85031.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=258

 Score =   338 bits (867),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  49   ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  108

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KSVSQ+I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  109  FEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  168

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  169  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFV  228

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AFDLLI+GK LRCVIWM
Sbjct  229  THEMKFEEINSAFDLLIKGKCLRCVIWM  256



>emb|CDP07305.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 191/214 (89%), Gaps = 4/214 (2%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA+R+ANVE GSTVAIFGLG+IGLAVAEGAR+ GA RIIGVDINPDK
Sbjct  180  ACLLSCGVSTGVGAALRTANVESGSTVAIFGLGAIGLAVAEGARIAGAKRIIGVDINPDK  239

Query  540  FERGK----TFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCR  373
             E GK     FG++DFV+S + GNKS+SQVI +MT GGADYCFECVG A+LV EAYA CR
Sbjct  240  REIGKYNWKKFGLTDFVDSRSCGNKSISQVITDMTDGGADYCFECVGLASLVHEAYACCR  299

Query  372  KGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELEL  193
            KGWGKTVV+GVDKPG+QL+ NS+EVLH GKTL+GSL+GGLKPK+D+P+L K+Y D ELEL
Sbjct  300  KGWGKTVVVGVDKPGSQLTFNSYEVLHMGKTLVGSLYGGLKPKTDVPMLIKKYLDKELEL  359

Query  192  DKFVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            DKFVTHEV FE+IN+AF+LL+QGKSLRCVIWMDK
Sbjct  360  DKFVTHEVNFEEINRAFELLLQGKSLRCVIWMDK  393



>ref|XP_004501981.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cicer arietinum]
Length=390

 Score =   341 bits (875),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VEPGSTVAIFGLGS+GLAVAEGARLCGA RIIGVD+ P+K
Sbjct  181  ACLLSCGVSTGVGAAWRTAGVEPGSTVAIFGLGSVGLAVAEGARLCGATRIIGVDVIPEK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+++L  GNK VSQVI EMT GGADYCFECVG A+LV EAYASCRKGWG
Sbjct  241  FEIGKKFGLTDFIHALECGNKPVSQVIIEMTNGGADYCFECVGTASLVHEAYASCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+V+GVDKPGA+LSL+S EVLH GK+L GSL+GGLKPKS +P+L KRY D EL+LDKFV
Sbjct  301  KTIVVGVDKPGAKLSLSSSEVLHDGKSLTGSLYGGLKPKSHVPILLKRYMDKELQLDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL  G+ LRCVIWMDK
Sbjct  361  THEVEFKDINKAFDLLNNGQCLRCVIWMDK  390



>ref|XP_003555362.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform 1 [Glycine 
max]
Length=392

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVDINP+K
Sbjct  183  ACLLGCGVSTGVGAAWRTAGVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDINPEK  242

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN+   G K V QVI E+T GGADYCFECVG A+LV EAYASCRKGWG
Sbjct  243  FEIGKKFGVTDFVNAGECGGKPVGQVIIEITDGGADYCFECVGMASLVHEAYASCRKGWG  302

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA+++L+S+EVLH GK+L+GSLFGGLKPKS +P+L KRY D EL+LDKFV
Sbjct  303  KTIVLGVDKPGARINLSSYEVLHDGKSLMGSLFGGLKPKSHVPILLKRYMDKELQLDKFV  362

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL +G+ LRCVIWMDK
Sbjct  363  THEVEFKDINKAFDLLSKGECLRCVIWMDK  392



>ref|XP_004491172.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X1 [Cicer 
arietinum]
Length=388

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVEPGSTVA+FGLG IGLAVAEGARLCGA RIIGVDINP K
Sbjct  179  ACLLSCGVSTGVGAAWRTANVEPGSTVAVFGLGCIGLAVAEGARLCGATRIIGVDINPQK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ GK FG++DFV++    NKSVSQVI EMTGGGADYCFECVG A+LV EAYASCRKGWG
Sbjct  239  FDIGKKFGLTDFVHAGECENKSVSQVIMEMTGGGADYCFECVGMASLVHEAYASCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+V+GVDKPG++LS NS +VL  GKTL+GSLFGGLKPK+D+P+L KRY D EL LD FV
Sbjct  299  KTIVVGVDKPGSKLSFNSSDVLFQGKTLMGSLFGGLKPKTDVPILLKRYIDKELNLDDFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLLI+G+SLRC+IWM K
Sbjct  359  THEVEFKDINKAFDLLIKGQSLRCLIWMHK  388



>gb|KDO85030.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=326

 Score =   337 bits (863),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  117  ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  176

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KSVSQ+I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  177  FEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  236

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  237  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFV  296

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AFDLLI+GK LRCVIWM
Sbjct  297  THEMKFEEINSAFDLLIKGKCLRCVIWM  324



>ref|XP_007017963.1| Zinc-binding alcohol dehydrogenase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY15188.1| Zinc-binding alcohol dehydrogenase family protein isoform 2 [Theobroma 
cacao]
Length=354

 Score =   337 bits (865),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C VSTGVGAA ++ANVE GSTVAIFGLGSIGLAVA+GARLCGA RIIGVDINP+K
Sbjct  145  ACLFGCCVSTGVGAACKTANVEAGSTVAIFGLGSIGLAVAKGARLCGAKRIIGVDINPEK  204

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++F+NS   GNKS+SQVI EMT GGADYCFECVG  +LVQEAYASCRKGWG
Sbjct  205  FEIGKNFGVTEFINSKDCGNKSLSQVIIEMTEGGADYCFECVGLGSLVQEAYASCRKGWG  264

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+V+GVDKPGAQL+ +SF+VLHSGK L GSLFGG+K KSD+PVL KRY D EL+LD+FV
Sbjct  265  KTIVVGVDKPGAQLNFSSFDVLHSGKVLTGSLFGGVKAKSDLPVLIKRYMDKELQLDEFV  324

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAF+LLI+GK +RCVIWMDK
Sbjct  325  THEVKFEDINKAFELLIEGKCIRCVIWMDK  354



>gb|KDO85025.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=339

 Score =   337 bits (864),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  130  ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  189

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KSVSQ+I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  190  FEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  249

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  250  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFV  309

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AFDLLI+GK LRCVIWM
Sbjct  310  THEMKFEEINSAFDLLIKGKCLRCVIWM  337



>gb|EYU17539.1| hypothetical protein MIMGU_mgv1a007994mg [Erythranthe guttata]
Length=386

 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG  AA +SANVE GSTVAIFGLGSIGLAVAEGARLCGAA+IIG+D+NP+K
Sbjct  179  ACLLSCGVSTG--AAWKSANVEAGSTVAIFGLGSIGLAVAEGARLCGAAKIIGIDVNPEK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E  K FGV+DFV+S   G K VSQ++ EMTGGGADYCFECVG+A+LV+EAY+ CRKGWG
Sbjct  237  IEISKKFGVTDFVDSKNCGEKRVSQIVNEMTGGGADYCFECVGKASLVEEAYSCCRKGWG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVD+PG++L+ +S EVLH GKTL+GSLFGGLKPKSDIP+L +RY D ELELDKFV
Sbjct  297  KTVVLGVDQPGSKLTFSSHEVLHRGKTLMGSLFGGLKPKSDIPILIQRYMDKELELDKFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAFDLL+ GKSLRCVIWM+K
Sbjct  357  THEVGFEDINKAFDLLVVGKSLRCVIWMNK  386



>ref|XP_006473751.1| PREDICTED: alcohol dehydrogenase-like 7-like [Citrus sinensis]
 gb|KDO85023.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=388

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  179  ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KSVSQ+I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  239  FEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  299  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AFDLLI+GK LRCVIWM
Sbjct  359  THEMKFEEINSAFDLLIKGKCLRCVIWM  386



>ref|XP_004253128.1| PREDICTED: alcohol dehydrogenase-like 7 [Solanum lycopersicum]
Length=389

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTGVGAA+++ANVE GSTV IFGLG IGLAVAEGAR+CGA+RIIGVDIN DK
Sbjct  180  ACLFSCGVSTGVGAALKTANVEQGSTVVIFGLGGIGLAVAEGARICGASRIIGVDINTDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFV+S + G+K +SQVI EMT GGADYCFECVG  TLV+EAYA CRKGWG
Sbjct  240  FEIGKQFGVTDFVDSNSYGDKPISQVINEMTNGGADYCFECVGMGTLVEEAYACCRKGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+V+GVDKPGA L+  S ++LH GKT++GSLFGGLKPKSDIP+L KRY D ELELDKFV
Sbjct  300  KTIVVGVDKPGATLTFKSSDILHLGKTIMGSLFGGLKPKSDIPLLVKRYLDKELELDKFV  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+ IN AFDLL++GKSLRCVIWMDK
Sbjct  360  THEVSFQHINTAFDLLVEGKSLRCVIWMDK  389



>ref|XP_006435310.1| hypothetical protein CICLE_v10001457mg [Citrus clementina]
 gb|ESR48550.1| hypothetical protein CICLE_v10001457mg [Citrus clementina]
Length=388

 Score =   336 bits (862),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  179  ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KSVSQ+I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  239  FEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  299  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AFDLL++GK LRCVIWM
Sbjct  359  THEMKFEEINSAFDLLMKGKCLRCVIWM  386



>ref|XP_007146069.1| hypothetical protein PHAVU_006G0103001g, partial [Phaseolus vulgaris]
 ref|XP_007146070.1| hypothetical protein PHAVU_006G0103001g, partial [Phaseolus vulgaris]
 gb|ESW18063.1| hypothetical protein PHAVU_006G0103001g, partial [Phaseolus vulgaris]
 gb|ESW18064.1| hypothetical protein PHAVU_006G0103001g, partial [Phaseolus vulgaris]
Length=308

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVDI P+K
Sbjct  99   ACLLGCGVSTGVGAAWRTAGVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDIYPEK  158

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFV++   G K VSQ I EMTGGGADYCFECVG A++V EAYASCRKGWG
Sbjct  159  FEIGKKFGVTDFVHAGECGGKPVSQFIIEMTGGGADYCFECVGTASVVLEAYASCRKGWG  218

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+V+GVDKPGA+++L+S EVLH GK+L+GSLFGGLKPKS +P+L KRY D EL+LD+FV
Sbjct  219  KTIVIGVDKPGARINLSSHEVLHDGKSLMGSLFGGLKPKSHVPILLKRYVDKELQLDEFV  278

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL  GK LRCVIWMDK
Sbjct  279  THEVEFKDINKAFDLLSTGKCLRCVIWMDK  308



>gb|KJB11816.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=258

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C ++TGVGAA + ANVE GSTV IFGLGSIGLAVA+GA+LCGA RIIGVD+NPDK
Sbjct  49   ACLFGCCIATGVGAACKVANVEAGSTVVIFGLGSIGLAVAKGAKLCGANRIIGVDVNPDK  108

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++F+NS   GN+S+SQV+ EMTGGGADYCFECVG A+LVQEAYASCRKGWG
Sbjct  109  FEIAKKFGVTEFINSKDCGNESLSQVVKEMTGGGADYCFECVGLASLVQEAYASCRKGWG  168

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGV KPG+QLSL+SFEVLHSGKTL G+LFGG+K KSD+P+L KRY+D EL++D+FV
Sbjct  169  KTIVLGVQKPGSQLSLSSFEVLHSGKTLTGALFGGVKAKSDLPLLLKRYTDNELQVDEFV  228

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DIN+AF+LL+ GK +RCVIWMDK
Sbjct  229  THEVKFQDINRAFELLMGGKCIRCVIWMDK  258



>ref|XP_010530336.1| PREDICTED: alcohol dehydrogenase-like 7 [Tarenaya hassleriana]
Length=391

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VE GSTVAIFGLGSIGLAVAEGARLCGA+RIIGVDINP+K
Sbjct  182  ACLLSCGVSTGVGAAWETAKVEEGSTVAIFGLGSIGLAVAEGARLCGASRIIGVDINPEK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+ FGV+DF+NS T  ++ VS+VI +MTGGGADYCFECVG ++LVQEAYASCR+GWG
Sbjct  242  FEVGRKFGVTDFINSKTCVDEPVSEVIKDMTGGGADYCFECVGSSSLVQEAYASCRQGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV KPG+Q+ L+SF+VLH GKTL+GSLFGGLK K+ IP+L KRY D ELELDKFV
Sbjct  302  KTVMLGVAKPGSQICLDSFDVLHHGKTLVGSLFGGLKAKTHIPLLLKRYQDNELELDKFV  361

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAF+LL+ GK +RCV+WMDK
Sbjct  362  THEMKFEDINKAFELLMDGKCIRCVLWMDK  391



>gb|KHN41317.1| Alcohol dehydrogenase-like 7 [Glycine soja]
Length=397

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 186/215 (87%), Gaps = 5/215 (2%)
 Frame = -2

Query  720  ACLLSCGVSTG-----VGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVD  556
            ACLL CGVSTG     VGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVD
Sbjct  183  ACLLGCGVSTGNFLTRVGAAWRTAGVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVD  242

Query  555  INPDKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASC  376
            INP+KFE GK FGV+DFVN+   G K V QVI E+T GGADYCFECVG A+LV EAYASC
Sbjct  243  INPEKFEIGKKFGVTDFVNAGECGGKPVGQVIIEITDGGADYCFECVGMASLVHEAYASC  302

Query  375  RKGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELE  196
            RKGWGKT+VLGVDKPGA+++L+S+EVLH GK+L+GSLFGGLKPKS +P+L KRY D EL+
Sbjct  303  RKGWGKTIVLGVDKPGARINLSSYEVLHDGKSLMGSLFGGLKPKSHVPILLKRYMDKELQ  362

Query  195  LDKFVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            LDKFVTHEV F+DINKAFDLL +G+ LRCVIWMDK
Sbjct  363  LDKFVTHEVEFKDINKAFDLLSKGECLRCVIWMDK  397



>ref|XP_007017962.1| Zinc-binding alcohol dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY15187.1| Zinc-binding alcohol dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=389

 Score =   334 bits (856),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 186/211 (88%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C VSTGVGAA ++ANVE GSTVAIFGLGSIGLAVA+GARLCGA RIIGVDINP+K
Sbjct  179  ACLFGCCVSTGVGAACKTANVEAGSTVAIFGLGSIGLAVAKGARLCGAKRIIGVDINPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQ-VICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE GK FGV++F+NS   GNKS+SQ VI EMT GGADYCFECVG  +LVQEAYASCRKGW
Sbjct  239  FEIGKNFGVTEFINSKDCGNKSLSQQVIIEMTEGGADYCFECVGLGSLVQEAYASCRKGW  298

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT+V+GVDKPGAQL+ +SF+VLHSGK L GSLFGG+K KSD+PVL KRY D EL+LD+F
Sbjct  299  GKTIVVGVDKPGAQLNFSSFDVLHSGKVLTGSLFGGVKAKSDLPVLIKRYMDKELQLDEF  358

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHEV FEDINKAF+LLI+GK +RCVIWMDK
Sbjct  359  VTHEVKFEDINKAFELLIEGKCIRCVIWMDK  389



>ref|XP_009334355.1| PREDICTED: alcohol dehydrogenase-like 7 [Pyrus x bretschneideri]
Length=391

 Score =   333 bits (855),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++ANVE GSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+NPDK
Sbjct  181  ACLLGCGVSTGVGAAWKTANVEKGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK  G++DFVN+ T  NKS SQVI EMTGGGADYCFECVG A+LVQEAYA  RKGWG
Sbjct  241  FEIGKKLGLTDFVNAATCENKSASQVIIEMTGGGADYCFECVGLASLVQEAYACSRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPG+++SL S ++LHSGKTL+GSLFGGLKPKSDIP L  RY D EL+LD+FV
Sbjct  301  KTIVLGVDKPGSKVSLPSSDILHSGKTLMGSLFGGLKPKSDIPALINRYMDKELQLDEFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THEV FEDIN AFDLLI+G+ LRCVI+M
Sbjct  361  THEVRFEDINSAFDLLIEGQCLRCVIYM  388



>ref|XP_003617079.1| Alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AET00038.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=391

 Score =   333 bits (855),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVE GSTVAIFGLG IGLAVAEGARLCGA RIIGVDI P+K
Sbjct  182  ACLLSCGVSTGVGAAWKTANVELGSTVAIFGLGCIGLAVAEGARLCGATRIIGVDIKPEK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV+DFVN   + NKSVSQVI EMTGGGADYCFECVG A+LV EAYASCRKGWG
Sbjct  242  FEIAKKFGVTDFVNPGELENKSVSQVIIEMTGGGADYCFECVGMASLVHEAYASCRKGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGVDKPG++LS+NS +VL  GKTL+GS+FGGLKPKSD+P+L KRY D EL LD FV
Sbjct  302  KTIMLGVDKPGSKLSINSTDVLFQGKTLMGSIFGGLKPKSDVPILFKRYMDKELNLDDFV  361

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL +G+ LR VIWMDK
Sbjct  362  THEVEFKDINKAFDLLTKGECLRSVIWMDK  391



>ref|XP_008464877.1| PREDICTED: alcohol dehydrogenase-like 7 [Cucumis melo]
Length=387

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGA  R+ANVE GSTVAIFGLGSIGLAVAEGAR+CGA+RIIG+DINP++
Sbjct  178  ACLLSCGVTTGVGATWRTANVEKGSTVAIFGLGSIGLAVAEGARICGASRIIGIDINPER  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS T+G+KSVSQ I EMT GGADYCFECVG+A+LV+EA+   R+GWG
Sbjct  238  FETAKKFGVTEFVNSRTLGDKSVSQAIIEMTDGGADYCFECVGRASLVEEAFTCSRQGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PGA L+ +SF+VLH GKT+ GSLFGG KPKSD+P L   Y+D +LELDKFV
Sbjct  298  KTIVLGVDQPGALLNFSSFDVLHRGKTVTGSLFGGAKPKSDVPTLVNWYTDKKLELDKFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDIN+AF+LLI+GKSLRCVIWM+K
Sbjct  358  THEVGFEDINEAFNLLIEGKSLRCVIWMNK  387



>ref|XP_008387882.1| PREDICTED: alcohol dehydrogenase-like 7 [Malus domestica]
Length=391

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++ANVE GSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+NPDK
Sbjct  181  ACLLGCGVSTGVGAAWKTANVEKGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK  G++DFVN+ T  NKS SQVI EMTGGGADYCFECVG A+LVQEAYA  RKGWG
Sbjct  241  FEIGKKLGLTDFVNAATCENKSASQVIIEMTGGGADYCFECVGLASLVQEAYACSRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPG+++SL S ++LHSGKTL+GSLFGGLKPKSDIP L  RY D EL+LD+FV
Sbjct  301  KTIVLGVDKPGSRVSLPSSDILHSGKTLMGSLFGGLKPKSDIPALINRYMDKELQLDEFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            T+EV FEDINKAFDLLI+G+ LRCVI+M
Sbjct  361  TNEVRFEDINKAFDLLIEGQCLRCVIYM  388



>ref|XP_008464876.1| PREDICTED: alcohol dehydrogenase-like 7 [Cucumis melo]
Length=388

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGAR+CGA+RIIG+D+NPDK
Sbjct  178  ACLLSCGVATGVGAAWRTANVEKGSTVAIFGLGSIGLAVAEGARICGASRIIGIDVNPDK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS ++G+KS+S+VI EMT GGADYCFECVG A+LVQEA++ CR+GWG
Sbjct  238  FEAAKKFGVTEFVNSRSLGDKSLSEVIKEMTNGGADYCFECVGAASLVQEAFSCCRQGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K +VLGVDKPGA LSL+S ++L  GK+L+GSL+GGLKPKSDIP L K Y+D +LELDKFV
Sbjct  298  KAIVLGVDKPGAILSLSSSDMLFHGKSLMGSLYGGLKPKSDIPTLLKWYTDKKLELDKFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDIN+AF +LI+GK LRCVIWM+K
Sbjct  358  THEVGFEDINEAFKMLIEGKCLRCVIWMNK  387



>ref|XP_008221165.1| PREDICTED: alcohol dehydrogenase-like 7 [Prunus mume]
 ref|XP_008221166.1| PREDICTED: alcohol dehydrogenase-like 7 [Prunus mume]
 ref|XP_008221167.1| PREDICTED: alcohol dehydrogenase-like 7 [Prunus mume]
Length=389

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CG+STGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+N  K
Sbjct  179  ACLLGCGISTGVGAAWRTANVEEGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNQQK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFV+     NKSVS+VI EMTGGGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  239  FEIGKKFGLTDFVDPANCENKSVSEVIIEMTGGGADYCFECVGLASLVQEAYACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKPG+Q+SL S E+LHSGK L+GSLFGGLKPKSDIP+L  RY D EL+LD+FV
Sbjct  299  KTVVLGVDKPGSQVSLPSGEILHSGKNLMGSLFGGLKPKSDIPLLLNRYMDKELQLDEFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THEV FEDINKAFDLLI+G+ LRCVI M
Sbjct  359  THEVRFEDINKAFDLLIEGQCLRCVISM  386



>ref|XP_004144219.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
 gb|KGN47564.1| hypothetical protein Csa_6G361260 [Cucumis sativus]
Length=384

 Score =   331 bits (849),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGAR+CGA+RIIG+DINPDK
Sbjct  174  ACLLSCGVATGVGAAWRTANVEKGSTVAIFGLGSIGLAVAEGARICGASRIIGIDINPDK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS ++G+KS+S+VI EMT GGADYCFECVG A+LV+EA++ CR+GWG
Sbjct  234  FEVAKKFGVTEFVNSRSLGDKSLSEVINEMTDGGADYCFECVGVASLVEEAFSCCRQGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PGA LSL+SF++L  GK+L+GSL+GGLKPKSD+P L K Y+D +LELDKFV
Sbjct  294  KTIVLGVDEPGAVLSLSSFDILFHGKSLMGSLYGGLKPKSDVPTLLKWYTDKKLELDKFV  353

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDIN+AF + I+GK LRCVIWM K
Sbjct  354  THEVGFEDINEAFKMFIEGKCLRCVIWMKK  383



>ref|XP_010101304.1| Alcohol dehydrogenase-like 7 [Morus notabilis]
 gb|EXB88239.1| Alcohol dehydrogenase-like 7 [Morus notabilis]
Length=350

 Score =   330 bits (845),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL C VSTGV AA + ANVE GSTVAIFGLGS+GLAVAEGARLCGA RIIGVD+NP K
Sbjct  141  ACLLGCEVSTGVAAAWKKANVEAGSTVAIFGLGSVGLAVAEGARLCGATRIIGVDLNPHK  200

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K VS++I EMTG GADYCFECVG A+LVQEAYA CRKGWG
Sbjct  201  FEVGKKFGITDFVNPKNTGGKPVSEMIMEMTGVGADYCFECVGNASLVQEAYACCRKGWG  260

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGVDKPG+Q++L S+ +LH GKTL+ SLFGG+KPKSDIP+L KRY D EL+LD+FV
Sbjct  261  KTIMLGVDKPGSQVTLPSYNILHHGKTLLASLFGGIKPKSDIPILLKRYLDKELQLDEFV  320

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE  FEDINKAFDLL +GK LRCVIWM+K
Sbjct  321  THEFKFEDINKAFDLLTEGKCLRCVIWMNK  350



>ref|XP_003519482.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X1 [Glycine 
max]
Length=387

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL+SCG+S G+GAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA +IIGVD+NP++
Sbjct  178  ACLISCGISAGIGAAWRAAGVEPGSTVAIFGLGSIGLAVAEGARLCGATKIIGVDVNPER  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV+S    NKSVSQVI EMTGGGADYCFECVG A+L+ EAYASCRKGWG
Sbjct  238  YEIGKRFGLTDFVHSGECENKSVSQVIIEMTGGGADYCFECVGMASLMHEAYASCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPG++L+L+  EVL SGK+L G LFGGLKPKS +P+L KRY D EL LD+FV
Sbjct  298  KTIVLGVDKPGSKLNLSCSEVLVSGKSLRGCLFGGLKPKSHVPILLKRYMDKELNLDEFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F+DINKAFDLLI+G+ LRCVIWMDK
Sbjct  358  THEMEFKDINKAFDLLIEGQCLRCVIWMDK  387



>ref|XP_006280555.1| hypothetical protein CARUB_v10026496mg, partial [Capsella rubella]
 gb|EOA13453.1| hypothetical protein CARUB_v10026496mg, partial [Capsella rubella]
Length=412

 Score =   330 bits (845),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA+ +A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  204  ACLLSCGVSTGVGAALETAKVEQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPAK  263

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+  + FGV++FVNS+T GNK VS+VI EMTGGGADYCFECVG + LVQEAYA CR+GWG
Sbjct  264  FQVAQKFGVTEFVNSMTCGNKRVSEVINEMTGGGADYCFECVGISALVQEAYACCRQGWG  323

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+Q+ L+SF+VLH GKTL+GSLFGGLK K+ IPVL KRY   ELELDKFV
Sbjct  324  KTITLGVDKPGSQICLDSFDVLHHGKTLVGSLFGGLKAKTHIPVLLKRYLSNELELDKFV  383

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDIN AF LLI+GK +RCV+WM
Sbjct  384  THEMKFEDINDAFQLLIEGKCIRCVLWM  411



>ref|XP_006575597.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X2 [Glycine 
max]
Length=380

 Score =   328 bits (842),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL+SCG+S G+GAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA +IIGVD+NP++
Sbjct  171  ACLISCGISAGIGAAWRAAGVEPGSTVAIFGLGSIGLAVAEGARLCGATKIIGVDVNPER  230

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV+S    NKSVSQVI EMTGGGADYCFECVG A+L+ EAYASCRKGWG
Sbjct  231  YEIGKRFGLTDFVHSGECENKSVSQVIIEMTGGGADYCFECVGMASLMHEAYASCRKGWG  290

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPG++L+L+  EVL SGK+L G LFGGLKPKS +P+L KRY D EL LD+FV
Sbjct  291  KTIVLGVDKPGSKLNLSCSEVLVSGKSLRGCLFGGLKPKSHVPILLKRYMDKELNLDEFV  350

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F+DINKAFDLLI+G+ LRCVIWMDK
Sbjct  351  THEMEFKDINKAFDLLIEGQCLRCVIWMDK  380



>gb|KJB11814.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
 gb|KJB11815.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=388

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C ++TGVGAA + ANVE GSTV IFGLGSIGLAVA+GA+LCGA RIIGVD+NPDK
Sbjct  179  ACLFGCCIATGVGAACKVANVEAGSTVVIFGLGSIGLAVAKGAKLCGANRIIGVDVNPDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++F+NS   GN+S+SQV+ EMTGGGADYCFECVG A+LVQEAYASCRKGWG
Sbjct  239  FEIAKKFGVTEFINSKDCGNESLSQVVKEMTGGGADYCFECVGLASLVQEAYASCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGV KPG+QLSL+SFEVLHSGKTL G+LFGG+K KSD+P+L KRY+D EL++D+FV
Sbjct  299  KTIVLGVQKPGSQLSLSSFEVLHSGKTLTGALFGGVKAKSDLPLLLKRYTDNELQVDEFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DIN+AF+LL+ GK +RCVIWMDK
Sbjct  359  THEVKFQDINRAFELLMGGKCIRCVIWMDK  388



>ref|XP_009101606.1| PREDICTED: alcohol dehydrogenase-like 7 [Brassica rapa]
Length=389

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  181  ACLLSCGVSTGVGAAWKTAQVEQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPTK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+ FG+++FVNS+T GNK VS+VI EMTGGGADYCFECVG ++LVQEAYA CRKGWG
Sbjct  241  FEVGQKFGITEFVNSMTCGNKRVSEVINEMTGGGADYCFECVGSSSLVQEAYACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+++ LNS +VLH+GKTL+GSLFGGLK KS IP+L KRY   ELELDKFV
Sbjct  301  KTITLGVDKPGSEICLNSSDVLHNGKTLMGSLFGGLKAKSHIPLLLKRYMSKELELDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDIN AF LL+ G+ +RCV+WM
Sbjct  361  THEMKFEDINDAFQLLLDGRCIRCVLWM  388



>ref|XP_004158271.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
Length=384

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGAR+CGA+RIIG+DINPDK
Sbjct  174  ACLLSCGVATGVGAAWRTANVEKGSTVAIFGLGSIGLAVAEGARICGASRIIGIDINPDK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS ++G+KS+S+VI EMT GGADYCFECVG A+LV+EA++ CR+GWG
Sbjct  234  FEVAKKFGVTEFVNSRSLGDKSLSEVINEMTDGGADYCFECVGVASLVEEAFSCCRQGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PGA LSL+SF++L  GK+L+GSL+GGLKPKSD+P L K Y+D +LELDKFV
Sbjct  294  KTIVLGVDEPGAVLSLSSFDILFHGKSLMGSLYGGLKPKSDVPTLLKWYTDKKLELDKFV  353

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            T EVGFEDIN+AF + I+GK LRCVIWM K
Sbjct  354  TREVGFEDINEAFKMFIEGKCLRCVIWMKK  383



>gb|KGN47563.1| hypothetical protein Csa_6G361250 [Cucumis sativus]
Length=386

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGA  R+ANVE GSTVAIFGLGSIGLAVAEGAR+CGA+RIIG+D+NP+K
Sbjct  178  ACLLSCGVTTGVGATWRTANVEKGSTVAIFGLGSIGLAVAEGARICGASRIIGIDVNPEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS T+G+K +SQ + EMT GGADYCFECVG A LV+EA+  CR+GWG
Sbjct  238  FETAKKFGVTEFVNSRTLGDK-LSQAVIEMTDGGADYCFECVGMAFLVEEAFKCCRQGWG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA L+  S++VLH GKT++GSLFGG  PKSDIP L K Y+D +LELDKFV
Sbjct  297  KTIVLGVDKPGAVLNFRSYDVLHRGKTVMGSLFGGASPKSDIPTLLKWYTDKKLELDKFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDIN+AF+LLI+GKSLRCVIWM+K
Sbjct  357  THEVGFEDINEAFNLLIEGKSLRCVIWMNK  386



>ref|XP_010266956.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Nelumbo nucifera]
Length=407

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA+++A VE GSTVAIFGLG+IGLAVAEGARLCGA+RI+GVD+NP+K
Sbjct  198  ACLLSCGISTGVGAALKTAKVEAGSTVAIFGLGAIGLAVAEGARLCGASRIVGVDVNPNK  257

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DF+N    G++ +S+VI +MT GGADYCFECVG A+LV EA+A CR GWG
Sbjct  258  FEIGKKFGVTDFINPKECGSRRISEVILDMTDGGADYCFECVGLASLVHEAFACCRMGWG  317

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPG QLS++S+E+LH GK L+GSLFG +K KSDIP+L  RY D ELELDKFV
Sbjct  318  KTIVLGVDKPGTQLSISSYEILHHGKCLMGSLFGDIKAKSDIPLLLNRYMDKELELDKFV  377

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDIN AFDLLI GKS+R VIWMDK
Sbjct  378  THEVHFEDINTAFDLLIHGKSIRSVIWMDK  407



>gb|AAB33481.2| alcohol dehydrogenase ADH [Solanum lycopersicum]
Length=390

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVEPGSTV IFGLGS+GLAVAEGARLCGA RIIGV  N DK
Sbjct  181  ACLLSCGVSTGVGAAWKTANVEPGSTVVIFGLGSVGLAVAEGARLCGATRIIGVGRNSDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS + G+K VSQVI EMT GGADYC ECVG   +VQEA+A CRKGWG
Sbjct  241  FEIGKQFGVTEFVNSKSCGDKPVSQVIIEMTNGGADYCNECVGLGRVVQEAFACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKP A+L+LNSFEVL S KTL+GS FGGLKPKSD+    KRY D ELELDKFV
Sbjct  301  KTIVLGVDKPDARLNLNSFEVLQSNKTLMGSFFGGLKPKSDVHTSLKRYLDKELELDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  EDINKAFDLLIQ K+LRCVIWM+K
Sbjct  361  THEVNLEDINKAFDLLIQLKTLRCVIWMEK  390



>ref|XP_003519481.1| PREDICTED: alcohol dehydrogenase-like 7-like [Glycine max]
Length=386

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVDIN +K
Sbjct  177  ACLLSCGVSTGVGAAWRTAGVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDINSEK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV+S    NKS SQVI EMT GGADYCFECVG A+L+ EAYASCRKGWG
Sbjct  237  YEIGKKFGITDFVHSGECENKSASQVIIEMTDGGADYCFECVGNASLMHEAYASCRKGWG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG DKPG++LSL+  E+L SGK+L+G +FGGLKPKS +P+L KRY D EL LD FV
Sbjct  297  KTIVLGSDKPGSKLSLSCSEILVSGKSLVGCMFGGLKPKSHVPILIKRYLDKELNLDGFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDL+I+G+ LRCVIWMDK
Sbjct  357  THEVEFKDINKAFDLMIKGQCLRCVIWMDK  386



>ref|XP_004291243.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=394

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            LL CGVSTGVGAA R+ANVEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+N DKFE
Sbjct  185  LLGCGVSTGVGAAWRTANVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNQDKFE  244

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
             GK FGV+DF+N     NKSV++++ EMT GGADYCFECVG ++LVQ+AYA CRKGWGK 
Sbjct  245  IGKKFGVTDFINPANCENKSVTELMIEMTKGGADYCFECVGNSSLVQQAYACCRKGWGKA  304

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            +VLGVD+PG+QL+L S++VLH GKTL+GS FGGLKPKSDIPVL  RY + EL+LD+FVTH
Sbjct  305  IVLGVDQPGSQLTLPSYDVLHKGKTLMGSFFGGLKPKSDIPVLLNRYINKELQLDEFVTH  364

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWMD  94
            E+ FEDINKAFDLLI+GK LRCVI M+
Sbjct  365  EMTFEDINKAFDLLIEGKCLRCVICMN  391



>ref|XP_007223044.1| hypothetical protein PRUPE_ppa006932mg [Prunus persica]
 gb|EMJ24243.1| hypothetical protein PRUPE_ppa006932mg [Prunus persica]
Length=389

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CG+STGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+N  K
Sbjct  179  ACLLGCGISTGVGAAWRTANVEEGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNQQK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFV+     NKSVSQVI EMTGGGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  239  FEIGKKFGLTDFVDPANCENKSVSQVIIEMTGGGADYCFECVGLASLVQEAYACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVDKP + +SL S E+LH GK L+GSLFGGLKPKSDIP+L  RY D EL+LD+FV
Sbjct  299  KTVVLGVDKPASLVSLPSQEILHGGKNLMGSLFGGLKPKSDIPLLLNRYMDKELQLDEFV  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THEV FEDINKAFDLLI+G+ LRCVI M
Sbjct  359  THEVRFEDINKAFDLLIEGQCLRCVISM  386



>gb|KDO85024.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=385

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 182/208 (88%), Gaps = 3/208 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  179  ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KS+   I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  239  FEIGKRFGVTEFVNSKNCGDKSI---IIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  295

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  296  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKELELDKFV  355

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AFDLLI+GK LRCVIWM
Sbjct  356  THEMKFEEINSAFDLLIKGKCLRCVIWM  383



>ref|XP_007141577.1| hypothetical protein PHAVU_008G207700g, partial [Phaseolus vulgaris]
 gb|ESW13571.1| hypothetical protein PHAVU_008G207700g, partial [Phaseolus vulgaris]
Length=384

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VEPGSTVA+FGLGSIGLAVAEGARLCGA +IIGVD+NP+K
Sbjct  175  ACLLSCGVSTGVGAAWIAAGVEPGSTVAVFGLGSIGLAVAEGARLCGATKIIGVDVNPEK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV++    +KSVSQVI EMT GGADYCFECVG+ +L++EAYASCRKGWG
Sbjct  235  YEIGKKFGLTDFVHAGESEDKSVSQVIIEMTDGGADYCFECVGKTSLMEEAYASCRKGWG  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG++KPG++LSL+  EVL SGK+L G LFGGLKPKS +P+L KRY D EL LD+FV
Sbjct  295  KTIVLGLEKPGSKLSLSCSEVLVSGKSLEGCLFGGLKPKSHVPILVKRYMDKELNLDEFV  354

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLLIQG SLRCVIWMDK
Sbjct  355  THEVQFQDINKAFDLLIQGNSLRCVIWMDK  384



>emb|CDY39423.1| BnaAnng05540D [Brassica napus]
Length=389

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  181  ACLLSCGVSTGVGAAWKTAQVEQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPTK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+ FG+++FVNS+T  NK VS+VI EMTGGGADYCFECVG ++LVQEAYA CRKGWG
Sbjct  241  FEVGQKFGITEFVNSMTCENKRVSEVINEMTGGGADYCFECVGSSSLVQEAYACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+++ LNS +VLH+GKTL+GSLFGGLK KS IP+L KRY   ELELDKFV
Sbjct  301  KTITLGVDKPGSEICLNSSDVLHNGKTLMGSLFGGLKAKSHIPLLLKRYMSKELELDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDIN AF LL+ G+ +RCV+WM
Sbjct  361  THEMKFEDINDAFQLLLDGRCIRCVLWM  388



>ref|XP_010666439.1| PREDICTED: alcohol dehydrogenase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   326 bits (836),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA R+ANV+PGS+VAIFGLG+IGLAVAEGARLCGA +IIGVD+NP+K
Sbjct  180  ACLLSCGVSTGIGAAWRAANVQPGSSVAIFGLGAIGLAVAEGARLCGATKIIGVDVNPEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
               GK FGV+DF+N  +  +KSVSQVI EMT GGADYCFECVG A+LVQEAYASCRKGWG
Sbjct  240  IVIGKKFGVTDFINPNSCEDKSVSQVINEMTNGGADYCFECVGMASLVQEAYASCRKGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGVD+P +QLSLNS +VL SGKTL+GSLFGGLK KSDIP+LAKRY D E+ LD FV
Sbjct  300  KTIMLGVDRPDSQLSLNSVDVLCSGKTLVGSLFGGLKAKSDIPILAKRYMDKEVRLDDFV  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ F++INKAF LL+ G  LRCV+WMD
Sbjct  360  THEMKFDEINKAFKLLLDGNCLRCVMWMD  388



>emb|CDY64947.1| BnaCnng45600D [Brassica napus]
Length=389

 Score =   325 bits (834),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  181  ACLLSCGVSTGVGAAWKTAQVEQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPTK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+ FG+++FVNS+T  NK +S+VI EMTGGGADYCFECVG ++LVQEAYA CRKGWG
Sbjct  241  FEVGQKFGITEFVNSMTCENKRLSEVINEMTGGGADYCFECVGSSSLVQEAYACCRKGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+++ LNS +VLH+GKTLIGSLFGGLK KS IP+L KRY   ELELDKFV
Sbjct  301  KTITLGVDKPGSEICLNSSDVLHNGKTLIGSLFGGLKAKSHIPLLLKRYMSKELELDKFV  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDIN AF LL+ G+ +RCV+WM
Sbjct  361  THEMKFEDINDAFQLLLDGRCIRCVLWM  388



>gb|KFK32944.1| hypothetical protein AALP_AA6G309700 [Arabis alpina]
Length=391

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VE GSTV IFGLGSIGLAVAEG+RLCGA+R+IGVDINPDK
Sbjct  183  ACLLSCGVSTGVGAAWETAKVEQGSTVVIFGLGSIGLAVAEGSRLCGASRVIGVDINPDK  242

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ G+ FGV++FVNS+T GNK V +VI EMTGGGADYCFECVG + LVQEAYA CR+GWG
Sbjct  243  FQIGQKFGVTEFVNSMTCGNKRVCEVINEMTGGGADYCFECVGSSALVQEAYACCRQGWG  302

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+Q+ L+SF+VLH GKTLIGSLFGGLK K+ IP+L KRY   ELELDKFV
Sbjct  303  KTITLGVDKPGSQICLDSFDVLHHGKTLIGSLFGGLKAKTHIPLLLKRYLSNELELDKFV  362

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE  FE+IN AF LL++GK +RCV+WM
Sbjct  363  THEKKFEEINDAFQLLLEGKCIRCVLWM  390



>gb|KCW68039.1| hypothetical protein EUGRSUZ_F01715 [Eucalyptus grandis]
Length=279

 Score =   321 bits (822),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 182/210 (87%), Gaps = 7/210 (3%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL+ CGVSTGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGARLCGAARIIGVD NPDK
Sbjct  77   ACLIGCGVSTGVGAAWRTANVEAGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDTNPDK  136

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN+    NK++SQVI EMTGGGA       G A+LV EAYA CRKGWG
Sbjct  137  FEIGKKFGVTDFVNAGNCDNKALSQVINEMTGGGA-------GLASLVHEAYACCRKGWG  189

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVD+PG+QL+ +SF+VLHSGK+L+GSLFGGLK KSDIP+L +RY+D EL LD+FV
Sbjct  190  KTVVLGVDRPGSQLTFSSFDVLHSGKSLMGSLFGGLKAKSDIPILLRRYADKELRLDEFV  249

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF+LLI+GK LRCVIWM K
Sbjct  250  THEVGFEDINKAFELLIEGKCLRCVIWMGK  279



>ref|XP_010482004.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=390

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  182  ACLLSCGVSTGVGAAWETAKVEQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPAK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ G+ FGV++FVNSLT  NK V++VI EMTGGGADYCFECVG ++LV+EAYA CRKGWG
Sbjct  242  FQVGQKFGVTEFVNSLTCENKRVNEVINEMTGGGADYCFECVGSSSLVEEAYACCRKGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+Q+ LNS +VLH GK L+GSLFGGLK K+ IP+L KRY   ELELDKFV
Sbjct  302  KTITLGVDKPGSQICLNSSDVLHQGKILMGSLFGGLKAKTHIPLLLKRYLSNELELDKFV  361

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDIN AF LL++GKS+RCV+WM
Sbjct  362  THEMKFEDINDAFQLLVEGKSIRCVLWM  389



>ref|XP_003601300.1| Alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AES71551.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=386

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+  GVGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA +IIGVD+NP+K
Sbjct  177  ACLLSCGIGAGVGAAWRTAGVEPGSTVAIFGLGSIGLAVAEGARLCGATKIIGVDVNPEK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFV++   G+K VSQVI EMT GGADYCFECVG A+LVQ+AYASCRKGWG
Sbjct  237  FEVGKKFGLTDFVHAGECGSKPVSQVITEMTDGGADYCFECVGMASLVQDAYASCRKGWG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+DKPG+++SL+  EVLH GKT+ G+LFGGLKPKS + +L KRY D EL+LD+FV
Sbjct  297  KTIVLGLDKPGSRISLSCSEVLHGGKTIQGNLFGGLKPKSHVSILLKRYMDKELQLDEFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLL  G+ LRC+IWMD 
Sbjct  357  THEVSFKDINKAFDLLRNGQCLRCMIWMDN  386



>ref|XP_002865545.1| hypothetical protein ARALYDRAFT_494804 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41804.1| hypothetical protein ARALYDRAFT_494804 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  182  ACLLSCGVSTGVGAAWETAKVEQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPAK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ G+ FG+++FVNS+T   KSVS+VI EMTGGGADYCFECVG ++LVQEAYA CR+GWG
Sbjct  242  FQVGQNFGITEFVNSMTCEKKSVSEVINEMTGGGADYCFECVGSSSLVQEAYACCRQGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+Q+ L+SF+VLH GK L+GSLFGGLK K+ IP+L KRY   ELELDKFV
Sbjct  302  KTITLGVDKPGSQICLDSFDVLHHGKILMGSLFGGLKAKTHIPLLLKRYLSNELELDKFV  361

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AF LL++GK +RCV+WM
Sbjct  362  THEMKFEEINDAFQLLLEGKCIRCVLWM  389



>ref|XP_010061139.1| PREDICTED: alcohol dehydrogenase-like 7 [Eucalyptus grandis]
 gb|KCW68036.1| hypothetical protein EUGRSUZ_F01715 [Eucalyptus grandis]
Length=381

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 182/210 (87%), Gaps = 7/210 (3%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL+ CGVSTGVGAA R+ANVE GSTVAIFGLGSIGLAVAEGARLCGAARIIGVD NPDK
Sbjct  179  ACLIGCGVSTGVGAAWRTANVEAGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDTNPDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN+    NK++SQVI EMTGGGA       G A+LV EAYA CRKGWG
Sbjct  239  FEIGKKFGVTDFVNAGNCDNKALSQVINEMTGGGA-------GLASLVHEAYACCRKGWG  291

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVD+PG+QL+ +SF+VLHSGK+L+GSLFGGLK KSDIP+L +RY+D EL LD+FV
Sbjct  292  KTVVLGVDRPGSQLTFSSFDVLHSGKSLMGSLFGGLKAKSDIPILLRRYADKELRLDEFV  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF+LLI+GK LRCVIWM K
Sbjct  352  THEVGFEDINKAFELLIEGKCLRCVIWMGK  381



>ref|XP_002301931.2| alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE81204.2| alcohol dehydrogenase family protein [Populus trichocarpa]
Length=398

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGAR+ GA +IIGVD+N +K
Sbjct  178  ACLLSCGVSTGVGAAWRTANVEAGSTVVIFGLGSIGLAVAEGARISGATKIIGVDVNQEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV+DFVN    G+K VSQVI EMTGGGADYCFECVG  +L+++AYA CRKGWG
Sbjct  238  FEIAKKFGVTDFVNVGECGDKPVSQVINEMTGGGADYCFECVGLVSLMEQAYACCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+KP +++SL   +VL SGKTL G+LFGGLK KSDIP+L KRY D ELELDKFV
Sbjct  298  KTIILGVEKPESRVSLPCADVLQSGKTLTGALFGGLKAKSDIPILLKRYMDKELELDKFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F+DINKAFDLL++GKSLRCVIWMDK
Sbjct  358  THEINFKDINKAFDLLLEGKSLRCVIWMDK  387



>ref|XP_004144283.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
Length=676

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGA  R+ANVE GSTVAIFGLGSIGLAVAEGAR+CGA+RIIG+D+NP+K
Sbjct  178  ACLLSCGVTTGVGATWRTANVEKGSTVAIFGLGSIGLAVAEGARICGASRIIGIDVNPEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS T+G+K   Q + EMT GGADYCFECVG A LV+EA+  CR+GWG
Sbjct  238  FETAKKFGVTEFVNSRTLGDKLSQQAVIEMTDGGADYCFECVGMAFLVEEAFKCCRQGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA L+  S++VLH GKT++GSLFGG  PKSDIP L K Y+D +LELDKFV
Sbjct  298  KTIVLGVDKPGAVLNFRSYDVLHRGKTVMGSLFGGASPKSDIPTLLKWYTDKKLELDKFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDIN+AF+LLI+GKSLRCVIWM+K
Sbjct  358  THEVGFEDINEAFNLLIEGKSLRCVIWMNK  387


 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  690  GVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFERGKTFGVS  511
            GVGAA R+ANVE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D+NP K    K FGV+
Sbjct  477  GVGAAWRTANVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVNPHKLTLAKEFGVT  536

Query  510  DFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKTVVLGVDKP  331
            + VNS  IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWGKT++ GV+  
Sbjct  537  EVVNSGNIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWGKTILFGVEDQ  596

Query  330  GAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTHEVGFEDIN  151
             + L +   + +  GK LIG ++GGLKPKSDIP L + Y D +LELD F+THEVGFEDIN
Sbjct  597  ASLLGVKCIDAIFQGKMLIGCIYGGLKPKSDIPTLLQWYIDKKLELDLFITHEVGFEDIN  656

Query  150  KAFDLLIQGKSLRCVIWMDK  91
            KAF LL +G+ LRCVIWM K
Sbjct  657  KAFSLLSEGQCLRCVIWMTK  676



>gb|KJB11817.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=385

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 183/210 (87%), Gaps = 3/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C ++TGVGAA + ANVE GSTV IFGLGSIGLAVA+GA+LCGA RIIGVD+NPDK
Sbjct  179  ACLFGCCIATGVGAACKVANVEAGSTVVIFGLGSIGLAVAKGAKLCGANRIIGVDVNPDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++F+NS   GN+S+SQV+ EMTGGGADYCFECVG A+LVQEAYASCRKGWG
Sbjct  239  FEIAKKFGVTEFINSKDCGNESLSQVVKEMTGGGADYCFECVGLASLVQEAYASCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGV KPG+QLSL+SFEVLHSGKTL G+LFGG+K KSD+P+L KRY+D    +D+FV
Sbjct  299  KTIVLGVQKPGSQLSLSSFEVLHSGKTLTGALFGGVKAKSDLPLLLKRYTDN---VDEFV  355

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DIN+AF+LL+ GK +RCVIWMDK
Sbjct  356  THEVKFQDINRAFELLMGGKCIRCVIWMDK  385



>ref|XP_011459084.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=391

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            LL CGVSTGVGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+N DKFE
Sbjct  183  LLGCGVSTGVGAAWRTAKVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNQDKFE  242

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
             GK FG++DFVN+    NKS S+VI EMT GGADYCFECVG A++VQEAYA CRKGWGKT
Sbjct  243  VGKKFGLTDFVNAANSENKSASEVIIEMTDGGADYCFECVGMASVVQEAYACCRKGWGKT  302

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            +VLGVDKPG+Q+S+ S  +L +GK+L+G LFGGLKPKSDIP+L  RY + EL+LD+F+TH
Sbjct  303  IVLGVDKPGSQVSIPSASILCTGKSLMGVLFGGLKPKSDIPILLNRYINKELQLDEFITH  362

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWMD  94
            EV FEDINKAFDLLI+GK LRCVI M+
Sbjct  363  EVTFEDINKAFDLLIEGKCLRCVICMN  389



>ref|XP_003601299.1| Alcohol dehydrogenase ADH [Medicago truncatula]
 gb|AES71550.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=283

 Score =   314 bits (805),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA R+A VEPGS+VAIFGLGS+GLAVAEGARLCGA RIIGVD+N +K
Sbjct  83   ACLLGCGVSTGVGAAWRTAGVEPGSSVAIFGLGSVGLAVAEGARLCGATRIIGVDVNHEK  142

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFV+    GNKSVSQ+I EMT GGADYCFECVG A+LV EAYASCRKGWG
Sbjct  143  FEIGKKFGLTDFVHGEECGNKSVSQIIIEMTDGGADYCFECVGMASLVHEAYASCRKGWG  202

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPGA+LSL+S EVLH GK+L+GS++GGLKPKS +P+L KRY D EL+LD+FV
Sbjct  203  KTIVLGVDKPGARLSLSSSEVLHDGKSLMGSVYGGLKPKSHVPILLKRYMDKELQLDEFV  262

Query  180  THEVGFEDINKAFDLLIQG  124
            THE+ F+DINKAFDLL +G
Sbjct  263  THELEFKDINKAFDLLSKG  281



>ref|XP_007141580.1| hypothetical protein PHAVU_008G2078000g, partial [Phaseolus vulgaris]
 gb|ESW13574.1| hypothetical protein PHAVU_008G2078000g, partial [Phaseolus vulgaris]
Length=371

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 183/210 (87%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVS GVGAA  +A VEPGSTVA+FGLGSIGLAVAEGARLCGA +IIGVD+NP+K
Sbjct  160  ACLLSCGVSVGVGAASITAGVEPGSTVAVFGLGSIGLAVAEGARLCGATKIIGVDVNPEK  219

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV++    +KSVSQ+I EMTGGGADYCFEC G+A+L++EAY SCRKGWG
Sbjct  220  YEIGKKFGLTDFVHAGESEDKSVSQIIIEMTGGGADYCFECAGKASLMEEAYTSCRKGWG  279

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+DKP ++L+L+  E+L SGK+L G LFGGLKPKS +P+L KRY D EL LD+FV
Sbjct  280  KTIVLGMDKP-SKLTLSCSELLVSGKSLKGCLFGGLKPKSHVPILIKRYMDKELNLDEFV  338

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLLI+G SLRCVIWMDK
Sbjct  339  THEVQFEDINKAFDLLIEGNSLRCVIWMDK  368



>ref|XP_007141579.1| hypothetical protein PHAVU_008G2078000g [Phaseolus vulgaris]
 gb|ESW13573.1| hypothetical protein PHAVU_008G2078000g [Phaseolus vulgaris]
Length=389

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 183/210 (87%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVS GVGAA  +A VEPGSTVA+FGLGSIGLAVAEGARLCGA +IIGVD+NP+K
Sbjct  178  ACLLSCGVSVGVGAASITAGVEPGSTVAVFGLGSIGLAVAEGARLCGATKIIGVDVNPEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E GK FG++DFV++    +KSVSQ+I EMTGGGADYCFEC G+A+L++EAY SCRKGWG
Sbjct  238  YEIGKKFGLTDFVHAGESEDKSVSQIIIEMTGGGADYCFECAGKASLMEEAYTSCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+DKP ++L+L+  E+L SGK+L G LFGGLKPKS +P+L KRY D EL LD+FV
Sbjct  298  KTIVLGMDKP-SKLTLSCSELLVSGKSLKGCLFGGLKPKSHVPILIKRYMDKELNLDEFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLLI+G SLRCVIWMDK
Sbjct  357  THEVQFEDINKAFDLLIEGNSLRCVIWMDK  386



>ref|XP_007224791.1| hypothetical protein PRUPE_ppa023795mg [Prunus persica]
 gb|EMJ25990.1| hypothetical protein PRUPE_ppa023795mg [Prunus persica]
Length=371

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VE GSTVAIFGLGSIGLAVAEGARLCGAARIIGVD+N DK
Sbjct  162  ACLLSCGVSTGVGAAWRTAKVEKGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDVNRDK  221

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFV+     N SVS+VI EMTGGGADYCFECVG  TL+QEAYA CRKGWG
Sbjct  222  FEIGKKFGLTDFVDPANCENNSVSEVIKEMTGGGADYCFECVGLITLMQEAYACCRKGWG  281

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+D PG+Q++L S +++  GKTL GSLFGGLKPKSDI VL  RY D EL+LD+FV
Sbjct  282  KTVVLGMDGPGSQVTLPSLDIIF-GKTLTGSLFGGLKPKSDIAVLINRYKDKELQLDEFV  340

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+INKAFDLLI+GK LRCVI+M
Sbjct  341  THEIRFEEINKAFDLLIEGKCLRCVIYM  368



>ref|XP_004291255.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=393

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            LL CGVSTG GAA R+ANVEPGSTVAIFGLGS+GLAVAEGARLCGA RIIGVD+N DKFE
Sbjct  185  LLGCGVSTGFGAACRTANVEPGSTVAIFGLGSVGLAVAEGARLCGATRIIGVDVNEDKFE  244

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
             GK FG++DFV +    NKS S+ I EMT GGADYCFECVG A+LVQEAYA CRKGWGKT
Sbjct  245  VGKKFGLTDFVKAANSENKSASESIIEMTDGGADYCFECVGMASLVQEAYACCRKGWGKT  304

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            +VLGVDKPG+Q+ ++S ++L +GK+L G +FGGLKPKSDIP+L  RY + EL+LD+FVTH
Sbjct  305  IVLGVDKPGSQVIISSSDILTTGKSLTGVIFGGLKPKSDIPILLNRYINKELQLDEFVTH  364

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWMD  94
            EV FEDINKAFDLLI+GKSLRCVI M+
Sbjct  365  EVTFEDINKAFDLLIEGKSLRCVICMN  391



>ref|NP_199040.1| alcohol dehydrogenase-like 7 [Arabidopsis thaliana]
 sp|Q9FH04.1|ADHL7_ARATH RecName: Full=Alcohol dehydrogenase-like 7 [Arabidopsis thaliana]
 dbj|BAB10198.1| alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAL91221.1| alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAM91227.1| alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AED94788.1| alcohol dehydrogenase-like 7 [Arabidopsis thaliana]
Length=390

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VE GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  182  ACLLSCGVSTGVGAAWETAKVEKGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPTK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ G+ FGV++FVNS+T     VS+VI EMT GGADYCFECVG ++LVQEAYA CR+GWG
Sbjct  242  FQVGQKFGVTEFVNSMTCEKNRVSEVINEMTDGGADYCFECVGSSSLVQEAYACCRQGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+Q+ L+SF+VLH GK L+GSLFGGLK K+ IP+L KRY   ELELDKFV
Sbjct  302  KTITLGVDKPGSQICLDSFDVLHHGKILMGSLFGGLKAKTHIPILLKRYLSNELELDKFV  361

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+IN AF LL++GK +RCV+WM
Sbjct  362  THEMKFEEINDAFQLLLEGKCIRCVLWM  389



>ref|XP_004291254.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=389

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            LL CGVSTGVGAA R+A VEPGSTVAIFGLGSIGLAVAEGARLCGA RIIGVD+N DKFE
Sbjct  181  LLGCGVSTGVGAAWRTAKVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNQDKFE  240

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
             GK FG++DFV +    NKS S+VI EMT GGADYCFECVG A++VQEAYA CRKGWGKT
Sbjct  241  VGKKFGLTDFVKAANSENKSASEVIIEMTDGGADYCFECVGMASVVQEAYACCRKGWGKT  300

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            +VLGVDKPG+ +S+ S  +L +GK+L+G LFGGLKPKSDIP+L  RY + EL+LD+FVTH
Sbjct  301  IVLGVDKPGSHVSIPSASILSTGKSLMGVLFGGLKPKSDIPILLNRYINKELQLDEFVTH  360

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWMD  94
            EV FEDINKAFDLLI+GK LRCVI ++
Sbjct  361  EVTFEDINKAFDLLIEGKCLRCVICIN  387



>ref|XP_010442151.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=392

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAA--IRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINP  547
            ACLLSCGVSTG   +  +  A VE GSTV IFGLGSIGLAVAEGARLCGA+RI+GVDINP
Sbjct  182  ACLLSCGVSTGTSLSWNLEFAKVEQGSTVVIFGLGSIGLAVAEGARLCGASRIVGVDINP  241

Query  546  DKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKG  367
             KF+ G+ FGV+DFVNSLT  NK VS+VI EMTGGGADYCFECVG + LV+EAYA CRKG
Sbjct  242  SKFQVGQKFGVTDFVNSLTCENKRVSEVINEMTGGGADYCFECVGSSYLVEEAYACCRKG  301

Query  366  WGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDK  187
            WGKT+ LGVDKPG+Q+ LNS +VLH GK L+GSLFGGLK K+ IP+L KRY + ELELDK
Sbjct  302  WGKTITLGVDKPGSQICLNSSDVLHQGKILMGSLFGGLKAKTHIPLLLKRYLNNELELDK  361

Query  186  FVTHEVGFEDINKAFDLLIQGKSLRCVIWM  97
            FVTHE+ FEDIN AF LL++GK +RCV+WM
Sbjct  362  FVTHEMKFEDINDAFQLLVEGKCIRCVLWM  391



>ref|XP_010666441.1| PREDICTED: alcohol dehydrogenase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=382

 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A VE GSTVAIFGLG+IGLAVAEGAR+CGA RIIGVD+N  K
Sbjct  173  ACLLSCGVSTGVGAAWITAQVEEGSTVAIFGLGAIGLAVAEGARICGATRIIGVDVNASK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN +    KS S++I EMT GGADYCFECVG A+LV+EA+A CRKGWG
Sbjct  233  FEIGKKFGVTDFVNPMDNATKSTSEIINEMTDGGADYCFECVGMASLVEEAFACCRKGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVD+P ++LSL+S +VLH+GKTL GSLFGGLK KSDI  L K Y D +L+LD+FV
Sbjct  293  KTVVLGVDRPMSKLSLSSHDVLHNGKTLTGSLFGGLKAKSDISTLVKWYLDKKLQLDEFV  352

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FEDINKAF+LL++GKSLRCV+WM
Sbjct  353  THEMKFEDINKAFELLLEGKSLRCVLWM  380



>ref|XP_010667181.1| PREDICTED: alcohol dehydrogenase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=382

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VE GSTVAIFGLG+IGLAVAEGARLCGA RIIGVD+N  K
Sbjct  173  ACLLSCGVSTGVGAAWRTAQVEEGSTVAIFGLGAIGLAVAEGARLCGATRIIGVDVNASK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN +    KS S++I EMT GGADYCFECVG A+LV+EA+A CRKGWG
Sbjct  233  FEIGKKFGVTDFVNPMDNATKSASEIINEMTDGGADYCFECVGMASLVEEAFACCRKGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGVD+P ++LSL+S +VL +GK L GSLFGGLK KSDI  L K Y D +L+LD+FV
Sbjct  293  KTVVLGVDRPMSKLSLSSHDVLQNGKILTGSLFGGLKAKSDISTLVKWYLDKKLQLDEFV  352

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ FEDINKAF+LL++GKSLRCV+WM+
Sbjct  353  THEMKFEDINKAFELLLEGKSLRCVLWMN  381



>ref|XP_010509865.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=392

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 178/210 (85%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA  +A V+ G TV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  182  ACLLSCGVSTGVGAAWETAKVKQGPTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPAK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQ--VICEMTGGGADYCFECVGQATLVQEAYASCRKG  367
            F+ G+ FGV++FVNSLT  NKSVS+  VI EMTGGGADYCFECVG + LV+EAYA CRKG
Sbjct  242  FQVGQKFGVTEFVNSLTCENKSVSEIMVINEMTGGGADYCFECVGSSFLVEEAYACCRKG  301

Query  366  WGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDK  187
            WGKT+ LGVDKPG+Q+ LNS +VLH GK L+GSLFGGLK K+ IP+L KRY + ELELDK
Sbjct  302  WGKTITLGVDKPGSQICLNSSDVLHQGKILMGSLFGGLKAKTHIPLLLKRYLNKELELDK  361

Query  186  FVTHEVGFEDINKAFDLLIQGKSLRCVIWM  97
            FVT E+ FEDIN AF LL++GK +RCV+WM
Sbjct  362  FVTLEMKFEDINDAFQLLVEGKCIRCVLWM  391



>ref|XP_011034915.1| PREDICTED: alcohol dehydrogenase-like 7 [Populus euphratica]
Length=398

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGAR+ GA +IIGVD+N +K
Sbjct  178  ACLLSCGVSTGVGAAWRTANVEAGSTVVIFGLGSIGLAVAEGARISGATKIIGVDVNQEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV+DFVN    G+K VSQVI EMTGGGADYCFECVG  +L+++AYA  RKGWG
Sbjct  238  FEIAKKFGVTDFVNVGECGDKPVSQVINEMTGGGADYCFECVGLVSLMEQAYACSRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+K  + +SL   +V+ +GKTL G+LFGGLK KSDIP L KRY D ELELDKFV
Sbjct  298  KTVILGVEKSDSLISLRCADVVGNGKTLTGALFGGLKAKSDIPTLLKRYMDKELELDKFV  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLL++GKSLRCVIWMDK
Sbjct  358  THEVDFEDINKAFDLLLEGKSLRCVIWMDK  387



>ref|XP_002285917.2| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera]
 emb|CBI18887.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL SCGVSTGVGAA R+A VE GSTV IFGLG+IGLAVAEGARLCGA+RIIGVD N +K
Sbjct  186  ACLFSCGVSTGVGAAWRTAKVEKGSTVVIFGLGAIGLAVAEGARLCGASRIIGVDTNLEK  245

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+  K FGV++FVN    G+K VSQ I EMT GGADYCFECVG A+LVQ+A+ASCRKGWG
Sbjct  246  FDVAKKFGVTEFVNPRNCGDKPVSQAIVEMTDGGADYCFECVGFASLVQDAFASCRKGWG  305

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K +++GVDKPGA L+ +S E+LH GK+++GS++GGLKPKS IPVL +R  D EL +D F+
Sbjct  306  KAIMVGVDKPGAMLNFSSVEMLHCGKSVMGSIYGGLKPKSHIPVLLQRLVDKELNVDNFI  365

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAFDLL +GKS+RCV+WMDK
Sbjct  366  THEMKFEDINKAFDLLAKGKSIRCVMWMDK  395



>ref|XP_009409164.1| PREDICTED: alcohol dehydrogenase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=382

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 180/210 (86%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VEP STVA+FGLGS+GLAVAEGARL GA RIIGVD+NPDK
Sbjct  174  ACLLSCGVSTGVGAAWKVAAVEPKSTVAVFGLGSVGLAVAEGARLQGAGRIIGVDLNPDK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GKTFGV+DFVN + IG +S+S+VI EMTGGGADYCFEC+G A+L+ +A+ SCR GWG
Sbjct  234  FEIGKTFGVTDFVNPMDIGERSISEVIKEMTGGGADYCFECIGLASLMSDAFQSCRPGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+   + +S+N +E+L  GKT++GSLFGG+K K+DIP+L  RY + EL LD+F+
Sbjct  294  KTIILGVEMHFSPVSINPYEILQ-GKTIMGSLFGGIKAKTDIPILMNRYLNKELHLDEFI  352

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGF DINKAF+LL+ GKSLRC+IWMD+
Sbjct  353  THEVGFHDINKAFELLMAGKSLRCIIWMDR  382



>ref|XP_008219143.1| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 7 
[Prunus mume]
Length=390

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+A VE GSTVAIFGLGSIGLAVAEGARLCGAARIIGVD+N DK
Sbjct  181  ACLLSCGVSTGVGAAWRTAKVEKGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDVNRDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFV+     N SVS++I EMTGGGADYCFECVG  +L+QEAYA CRKG G
Sbjct  241  FEIGKKFGLTDFVDPANCENNSVSEMIKEMTGGGADYCFECVGLISLMQEAYACCRKGSG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+D PG+Q++L S +++  GKTL GSLFGGLKPKSDI VL  RY D EL+LD+FV
Sbjct  301  KTVVLGMDGPGSQVTLPSLDIIF-GKTLTGSLFGGLKPKSDIAVLINRYKDKELQLDEFV  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWM  97
            THE+ FE+INKAFDLLI+GK LRCVI++
Sbjct  360  THEIRFEEINKAFDLLIEGKCLRCVIYI  387



>ref|XP_010493867.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=392

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 176/209 (84%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS GVGAA  +A V+ GS + IFGLGSIGLAVAEGARLCGA+RIIGVDINP KF
Sbjct  183  CLLSCGVSAGVGAAWETAKVKQGSAIVIFGLGSIGLAVAEGARLCGASRIIGVDINPAKF  242

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQ--VICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            + G+ FGV++FVNSLT  NKSVS+  VI EMTGGGADYCFECVG ++LV+EA A CR GW
Sbjct  243  QVGQKFGVTEFVNSLTCENKSVSEIMVINEMTGGGADYCFECVGSSSLVEEADACCRNGW  302

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT+ LGVDKPG+Q+ LNS +VLH GK L+GSLFGGLK K+ IP+L KRY + ELELDKF
Sbjct  303  GKTITLGVDKPGSQICLNSSDVLHQGKILMGSLFGGLKAKTHIPLLLKRYLNNELELDKF  362

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWM  97
            VTHE+ FEDIN AF LL++GK +RCV+WM
Sbjct  363  VTHEMKFEDINDAFQLLVEGKCIRCVLWM  391



>ref|XP_009409158.1| PREDICTED: alcohol dehydrogenase-like 7 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009409159.1| PREDICTED: alcohol dehydrogenase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=382

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 180/210 (86%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++A VEP STVA+FGLGS+GLAVAEGARL GA RIIGVD+NPDK
Sbjct  174  ACLLSCGVSTGVGAAWKAAAVEPKSTVAVFGLGSVGLAVAEGARLQGAGRIIGVDLNPDK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN   IG +SVS+VI EMTGGGADYCFEC+G A+L+Q+A+ SCR GWG
Sbjct  234  FEIGKKFGITDFVNPKDIGERSVSEVIKEMTGGGADYCFECIGLASLMQDAFQSCRPGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG++   + +S+++ E+L  GK++IGSL GG+KPK+DIP+L  RY + EL LD+F+
Sbjct  294  KTIILGLEMHLSPMSISTLEILQ-GKSIIGSLLGGIKPKTDIPILMNRYLNKELHLDEFI  352

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGF DINKAF+LL+ GKSLRC+IWMD+
Sbjct  353  THEVGFHDINKAFELLMAGKSLRCIIWMDR  382



>ref|XP_004985405.1| PREDICTED: alcohol dehydrogenase-like 7-like [Setaria italica]
Length=381

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 176/210 (84%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG STGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA++IIGVDINPDK
Sbjct  173  ACLLSCGASTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDINPDK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+ F+N   +G K V+Q I EMT GGADYCFEC+G A L++EA+ S R GWG
Sbjct  233  QELGKKFGVTHFINPKELGEKPVNQAIIEMTDGGADYCFECIGLAVLMKEAFLSTRDGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA LS+ S ++LH GKT+IGS+FGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  293  KTIILGVEMHGAPLSIPSRQILH-GKTVIGSMFGGVKPKQDIPILADKYLNKELELDKFI  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG  DIN+AFDLL+QGKS+RC IWM+K
Sbjct  352  THEVGLNDINEAFDLLLQGKSVRCTIWMNK  381



>ref|XP_010916712.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Elaeis guineensis]
Length=383

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 178/210 (85%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GS+VAIFGLG++GLAVAEGARL GA++IIGVD+NPDK
Sbjct  175  ACLLSCGVSTGVGAAWKVAEVEAGSSVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPDK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN   IG +SVS+VI EMT GGADYCFEC+G A+L+ +A+ SCR GWG
Sbjct  235  FELGKKFGLTDFVNPKEIGERSVSEVIMEMTNGGADYCFECIGLASLMNDAFQSCRPGWG  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA L ++S E+LH GK ++GSLFGG+K K+DIP+  K+Y + EL+LD F+
Sbjct  295  KTIILGVEMHGAPLCISSSEILH-GKCIMGSLFGGIKAKNDIPIFVKKYLNKELQLDNFI  353

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG ++INKAFDLL++GKSLRC IWMD+
Sbjct  354  THEVGLQEINKAFDLLVEGKSLRCTIWMDR  383



>gb|ACG35040.1| alcohol dehydrogenase 1 [Zea mays]
Length=382

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 2/211 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG STGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA++IIGVDINPDK
Sbjct  173  ACLLSCGASTGVGAAWKQAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDINPDK  232

Query  540  FERGKTFGVSDFVNSLTIG-NKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
             E GK FGV+ F+N   +G  K V Q I EMT GGADYCFEC+G A L+ +A+ S R GW
Sbjct  233  CELGKKFGVTHFINPKELGEEKPVHQAIAEMTDGGADYCFECIGLAALMNDAFRSSRDGW  292

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGV+  GA L ++  E+LH GK++IGS+FGG+KPK DIP+LA +Y + ELELDKF
Sbjct  293  GKTIILGVEMHGAPLCISPHEILH-GKSVIGSMFGGVKPKQDIPILADKYMNKELELDKF  351

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            +THEVG +DIN+AFDLL+QGKSLRC IWMDK
Sbjct  352  ITHEVGLKDINQAFDLLLQGKSLRCTIWMDK  382



>ref|XP_007141581.1| hypothetical protein PHAVU_008G207900g [Phaseolus vulgaris]
 gb|ESW13575.1| hypothetical protein PHAVU_008G207900g [Phaseolus vulgaris]
Length=388

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 176/211 (83%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTGVGAA ++A VEPGSTVA+FGLG+IGLAV EGARLCGA +IIGVDINP K
Sbjct  178  ASLLSCGVSTGVGAAWKAAGVEPGSTVAVFGLGTIGLAVVEGARLCGATKIIGVDINPAK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+DF+ S    +KSVSQ+I EMT GG DY FECVG+A+L++EAYASCRK WG
Sbjct  238  HEIGKKFGVTDFILSEESEDKSVSQIIIEMTDGGTDYSFECVGKASLMEEAYASCRKAWG  297

Query  360  KTVVLGVDKPGAQLSLNSFE-VLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            KT+V+G++KPG++LSL   E +L+ GK+L G +FGGLKPKS +P+L KRY D EL L+ F
Sbjct  298  KTMVVGLEKPGSKLSLGCPELLLNGGKSLEGCVFGGLKPKSHVPILIKRYMDKELNLEDF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHEV F+DINKAFDLL + KSLRCVIWMDK
Sbjct  358  VTHEVQFQDINKAFDLLTERKSLRCVIWMDK  388



>dbj|BAK06271.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG +TGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA++IIGVD+NPDK
Sbjct  173  ACLLSCGATTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDLNPDK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E  K FGV+ F+N   +  K+VSQVI EMT GGADYCFEC+G A ++ +A+ S R GWG
Sbjct  233  QELAKKFGVTHFINPKELAEKTVSQVIIEMTDGGADYCFECIGLAAVMNDAFQSSRAGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA L+++S E+LH GK ++GSLFGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  293  KTIILGVEMHGAPLTISSREILH-GKCVMGSLFGGVKPKQDIPILADKYLNKELELDKFI  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG +DIN AFDLL+QGKSLRC IWMDK
Sbjct  352  THEVGLKDINTAFDLLLQGKSLRCTIWMDK  381



>ref|XP_007018719.1| GroES-like zinc-binding dehydrogenase family protein isoform 
3 [Theobroma cacao]
 gb|EOY15944.1| GroES-like zinc-binding dehydrogenase family protein isoform 
3 [Theobroma cacao]
Length=365

 Score =   297 bits (760),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 180/210 (86%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  157  ACLLSCGVSTGIGAAWKVADIEGGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  216

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GKTFGV+DF+N  T G K VS+VI EMT GGADYCFEC+G A+L+++A+ S R+GWG
Sbjct  217  FEIGKTFGVTDFINPATCGEKKVSEVIKEMTDGGADYCFECIGLASLMEDAFNSNREGWG  276

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+K G  L+LN++ +L  G+++ G LFGG KPKSDIP+LA++Y D EL LD F+
Sbjct  277  KTVILGVEKHGTPLALNTYLLLR-GRSVTGCLFGGFKPKSDIPLLAEKYLDKELNLDGFI  335

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F+DINKAF+LL+QGKSLRC+IWMD 
Sbjct  336  THELSFQDINKAFELLLQGKSLRCIIWMDN  365



>ref|XP_006433934.1| hypothetical protein CICLE_v10001399mg [Citrus clementina]
 gb|ESR47174.1| hypothetical protein CICLE_v10001399mg [Citrus clementina]
Length=396

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 178/210 (85%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A VE GSTVAIFGLG++GL+VAEGAR+ GA RIIGVD+NP+K
Sbjct  186  ACLLSCGVSTGLGAAWKVAEVEEGSTVAIFGLGAVGLSVAEGARIRGATRIIGVDLNPEK  245

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G+K+VSQVI EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  246  FETGKKFGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLASVMNDAFNSSREGWG  305

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ +SLNS E+L  G+++ G+ FGGLKPKSDI  LA++Y D EL LD+F+
Sbjct  306  KTVILGVEMHGSPISLNSIEIL-KGRSVCGTFFGGLKPKSDIATLAQKYLDKELNLDEFI  364

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F DINKAFDLL++GKSLRCVIW+DK
Sbjct  365  THEVSFHDINKAFDLLLEGKSLRCVIWIDK  394



>ref|XP_006649531.1| PREDICTED: alcohol dehydrogenase-like 7-like [Oryza brachyantha]
Length=383

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCG +TGVGAA + A VEPGSTVA+FGLG++GLAVAEGAR+CGA++IIGVD+NP+K
Sbjct  175  ASLLSCGATTGVGAAWKLAKVEPGSTVAVFGLGAVGLAVAEGARICGASKIIGVDLNPEK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+ F+N   +G K VSQ I EMT GGADYCFEC+G A+L+ +A+ S R+GWG
Sbjct  235  HELGKKFGVTHFINPQELGEKPVSQAIIEMTAGGADYCFECIGLASLMNDAFRSSREGWG  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA L++ S E+LH GK ++GSLFGG+KPK DIP+LA++Y + ELELDKF+
Sbjct  295  KTIILGVEMHGAPLAIPSLEILH-GKCVMGSLFGGVKPKQDIPILAEKYLNKELELDKFI  353

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  +DIN AF+LL+QGKSLRC IWMDK
Sbjct  354  THEVALKDINTAFELLLQGKSLRCTIWMDK  383



>ref|XP_007018718.1| GroES-like zinc-binding dehydrogenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY15943.1| GroES-like zinc-binding dehydrogenase family protein isoform 
2 [Theobroma cacao]
Length=387

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 180/209 (86%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  179  ACLLSCGVSTGIGAAWKVADIEGGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GKTFGV+DF+N  T G K VS+VI EMT GGADYCFEC+G A+L+++A+ S R+GWG
Sbjct  239  FEIGKTFGVTDFINPATCGEKKVSEVIKEMTDGGADYCFECIGLASLMEDAFNSNREGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+K G  L+LN++ +L  G+++ G LFGG KPKSDIP+LA++Y D EL LD F+
Sbjct  299  KTVILGVEKHGTPLALNTYLLLR-GRSVTGCLFGGFKPKSDIPLLAEKYLDKELNLDGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ F+DINKAF+LL+QGKSLRC+IWMD
Sbjct  358  THELSFQDINKAFELLLQGKSLRCIIWMD  386



>ref|NP_001132441.1| putative alcohol dehydrogenase superfamily protein [Zea mays]
 gb|ACF81280.1| unknown [Zea mays]
 tpg|DAA43804.1| TPA: putative alcohol dehydrogenase superfamily protein [Zea 
mays]
Length=382

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 174/211 (82%), Gaps = 2/211 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG STGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA++IIGVDINP+K
Sbjct  173  ACLLSCGASTGVGAAWKQAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDINPEK  232

Query  540  FERGKTFGVSDFVNSLTIG-NKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
             E GK FGV+ F+N   +G  K V Q I EMT GGADYCFEC+G A L+ +A+ S R GW
Sbjct  233  CELGKKFGVTHFINPKELGEEKPVHQAIAEMTDGGADYCFECIGLAALMNDAFRSSRDGW  292

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGV+  GA L ++  E+LH GK++IGS+FGG+KPK DIP+LA +Y + ELELDKF
Sbjct  293  GKTIILGVEMHGAPLCISPHEILH-GKSVIGSMFGGVKPKQDIPILADKYMNKELELDKF  351

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            +THEVG +DIN+AFDLL+QGKSLRC IWMDK
Sbjct  352  ITHEVGLKDINQAFDLLLQGKSLRCTIWMDK  382



>ref|XP_010098631.1| Alcohol dehydrogenase-like 2 [Morus notabilis]
 gb|EXB75370.1| Alcohol dehydrogenase-like 2 [Morus notabilis]
Length=390

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 179/210 (85%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GSTVAIFGLGS+GLAVAEGA+L GA++IIGVD+NP K
Sbjct  182  ACLLSCGVSTGVGAAWKVAEVEEGSTVAIFGLGSVGLAVAEGAKLRGASKIIGVDLNPKK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+D+VN  TI  KSVS+VI ++T GGADYCFEC+G A+L+Q+A++SCR+GWG
Sbjct  242  FEIGKNFGVTDYVNPATIDGKSVSEVIKDLTDGGADYCFECIGLASLMQDAFSSCREGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            +TV+LG++  G+ LS+NS+E+L  GKT+ GS+ GG+KPK DIP+LA++Y D EL LD F+
Sbjct  302  QTVILGMEMHGSPLSVNSYEILR-GKTVTGSMLGGVKPKIDIPILARKYLDKELNLDGFI  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F DINKAFDLL++G SLR +IWMDK
Sbjct  361  THELSFRDINKAFDLLLEGDSLRSIIWMDK  390



>ref|XP_006433937.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|ESR47177.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
Length=259

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 176/210 (84%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL  A++IIGVDINP+K
Sbjct  49   ACLLSCGVSTGVGAAWKVAGVEVGSTVAIFGLGAVGLAVAEGARLNRASKIIGVDINPEK  108

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G+K+VSQVI EMT GGADYCFEC+G  +++ +A+ S R+GWG
Sbjct  109  FEIGKKFGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLTSVMNDAFNSSREGWG  168

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ +SLNS E+L  G+++ G+ FGGLKP+SDI  LA++Y D EL L +F+
Sbjct  169  KTVILGVEMHGSPISLNSIEIL-KGRSVCGTYFGGLKPRSDIATLAQKYLDKELNLGEFI  227

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F DINKAFDLL++GKSLRC+IWMDK
Sbjct  228  THEVSFHDINKAFDLLLEGKSLRCIIWMDK  257



>ref|XP_006472563.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472564.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472565.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472566.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X4 [Citrus 
sinensis]
Length=390

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 178/210 (85%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL+CGVSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL  A++IIGVDINP+K
Sbjct  180  ACLLTCGVSTGVGAAWKVAGVEVGSTVAIFGLGAVGLAVAEGARLNRASKIIGVDINPEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G+K+VSQVI EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  240  FEIGKKFGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLASVMNDAFNSSREGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ +SLNS E+L  G+++ G+ FGGLKPKSDI  LA++Y D EL LD+F+
Sbjct  300  KTVILGVEMHGSPISLNSIEIL-KGRSVCGTFFGGLKPKSDIATLAQKYLDKELNLDEFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F DINKAFDLL++GKSLRCVIWMDK
Sbjct  359  THEVSFHDINKAFDLLLEGKSLRCVIWMDK  388



>ref|XP_003558622.1| PREDICTED: alcohol dehydrogenase-like 7 [Brachypodium distachyon]
Length=382

 Score =   295 bits (754),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG +TGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA++IIGVD+NP+K
Sbjct  174  ACLLSCGATTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDLNPEK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+ F+N   +G K+VSQ I EMT GGADYCFEC+G A L+ +A+ S R GWG
Sbjct  234  QELGKKFGVTHFINPKELGEKTVSQAIIEMTDGGADYCFECIGLAALMSDAFQSSRAGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  G+ LS+ S E+LH GK ++GSLFGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  294  KTIILGVEMHGSPLSIPSHEILH-GKCVMGSLFGGVKPKDDIPILADKYLNKELELDKFI  352

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  +DIN AFDLL QGKSLRC IWMDK
Sbjct  353  THEVPLKDINTAFDLLQQGKSLRCTIWMDK  382



>ref|XP_010664347.1| PREDICTED: alcohol dehydrogenase-like 1 [Vitis vinifera]
 emb|CBI19197.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 178/210 (85%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  179  ACLLSCGVSTGIGAAWKVAEVEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+ F+N    G K+VSQV+ EMT GGADYCFEC+G A+L+++A+   R+GWG
Sbjct  239  FEIGKKFGVTHFINPTACGEKAVSQVVKEMTDGGADYCFECIGLASLMKDAFDCSREGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ L++NS ++L  G++++GSLFGGLKPKSDIP+LAK+Y D EL LD+F+
Sbjct  299  KTVILGVEMHGSDLNVNSSQILR-GRSVMGSLFGGLKPKSDIPILAKKYIDKELRLDEFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAF+   QGKS+RC+IWMDK
Sbjct  358  THEVNFQDINKAFEFQSQGKSIRCIIWMDK  387



>gb|EEC74658.1| hypothetical protein OsI_10321 [Oryza sativa Indica Group]
Length=323

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCG +TGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA+ IIGVD+NP+K
Sbjct  115  ASLLSCGATTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASTIIGVDLNPEK  174

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+ F+N   +G+K VSQ I EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  175  HELGKKFGVTHFINPQELGDKPVSQAIIEMTDGGADYCFECIGLASVMSDAFRSSREGWG  234

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA LS+ S E+L +GK ++GSLFGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  235  KTIILGVEMHGAPLSIPSLEIL-NGKCVMGSLFGGVKPKQDIPILADKYLNKELELDKFI  293

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  +DIN AFDLL+QGKSLRC IWMDK
Sbjct  294  THEVPLKDINTAFDLLLQGKSLRCTIWMDK  323



>ref|XP_010916714.1| PREDICTED: alcohol dehydrogenase-like 7 [Elaeis guineensis]
Length=383

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL GA RIIGVD+NPDK
Sbjct  175  ACLLSCGVSTGVGAAWKVAKVEAGSTVAIFGLGAVGLAVAEGARLQGAGRIIGVDLNPDK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK  G++DFVN   +G K VS+VI EMT GGADYCFEC+G A+L+ +A+ S R G G
Sbjct  235  FEIGKRLGITDFVNPKELGEKPVSEVILEMTSGGADYCFECIGLASLMADAFRSSRNGSG  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  G+ + L+S E+L  GK ++GSLFGG+KPK+DIP+L  RY + EL+LD+F+
Sbjct  295  KTIILGVEMHGSPIMLDSAEILR-GKCVMGSLFGGIKPKTDIPILVNRYLNKELKLDEFI  353

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+GF DINKAFDLLI+GKSLRC+IWMD+
Sbjct  354  THEMGFHDINKAFDLLIEGKSLRCIIWMDR  383



>emb|CDP15696.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   294 bits (752),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 175/209 (84%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGAA + A VE GS VAIFGLG++GLAVAEGARLC A+RIIGVD+NP+K
Sbjct  180  ACLLSCGVTTGVGAACKFARVEEGSVVAIFGLGAVGLAVAEGARLCKASRIIGVDLNPEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN  + G KSVSQVI EMT GGADYCFEC+G A+L+ +A+ S R+G G
Sbjct  240  FEIGKKFGITDFVNPTSCGEKSVSQVIQEMTDGGADYCFECIGLASLMADAFNSSRQGGG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLGV+  G+ LS+N++E+L  G+T++G LFGGLKPKSDI   AK Y D EL LD F+
Sbjct  300  KTVVLGVEMHGSPLSINAYEILR-GRTVMGCLFGGLKPKSDISSFAKMYLDHELNLDGFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DIN+AFDLL+QGKSLRC+IWMD
Sbjct  359  THEVSFKDINQAFDLLLQGKSLRCIIWMD  387



>ref|XP_004158272.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
Length=381

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA R+ANVE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D+NP K
Sbjct  172  ACLLGCGVSTGVGAAWRTANVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVNPHK  231

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV++ VNS  IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWG
Sbjct  232  LTLAKEFGVTEVVNSGNIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWG  291

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++ GV+   + L +   + +  GK LIG ++GGLKPKSDIP L + Y D +LELD F+
Sbjct  292  KTILFGVEDQASLLGVKCIDAIFQGKMLIGCIYGGLKPKSDIPTLLQWYIDKKLELDLFI  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF LL +G+ LRCVIWM K
Sbjct  352  THEVGFEDINKAFSLLSEGQCLRCVIWMTK  381



>ref|XP_010493542.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=446

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA  +A V+ GSTV IFGLGSIGLAVAEGARLCGA+RIIGVDINP K
Sbjct  182  ACLLSCGISTGVGAAWETAKVKQGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPAK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ GK FGV++FVNSLT  N+ VS+VI EMTGGGADYCFECVG ++LV+EAYA CRKGWG
Sbjct  242  FQVGKKFGVTEFVNSLTCENRRVSEVINEMTGGGADYCFECVGSSSLVEEAYAFCRKGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+ LGVDKPG+Q+ LNS +VLH GK L+GSLFGGLK K+ IP+L KRY + ELELDKFV
Sbjct  302  KTITLGVDKPGSQICLNSSDVLHQGKILMGSLFGGLKAKTHIPLLLKRYLNNELELDKFV  361

Query  180  THEVGFED  157
            THE+ FED
Sbjct  362  THEIKFED  369



>gb|KGN47562.1| hypothetical protein Csa_6G361240 [Cucumis sativus]
Length=387

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA R+ANVE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D+NP K
Sbjct  178  ACLLGCGVSTGVGAAWRTANVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVNPHK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV++ VNS  IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWG
Sbjct  238  LTLAKEFGVTEVVNSGNIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++ GV+   + L +   + +  GK LIG ++GGLKPKSDIP L + Y D +LELD F+
Sbjct  298  KTILFGVEDQASLLGVKCIDAIFQGKMLIGCIYGGLKPKSDIPTLLQWYIDKKLELDLFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF LL +G+ LRCVIWM K
Sbjct  358  THEVGFEDINKAFSLLSEGQCLRCVIWMTK  387



>ref|NP_001049222.1| Os03g0189400 [Oryza sativa Japonica Group]
 gb|ABF94387.1| oxidoreductase, zinc-binding dehydrogenase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11136.1| Os03g0189400 [Oryza sativa Japonica Group]
 dbj|BAG90560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=381

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCG +TGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA+ IIGVD+NP+K
Sbjct  173  ASLLSCGATTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASTIIGVDLNPEK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+ F+N   +G+K VSQ I EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  233  HELGKKFGVTHFINPQELGDKPVSQAIIEMTDGGADYCFECIGLASVMSDAFRSSREGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA LS+ S E+L +GK ++GSLFGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  293  KTIILGVEMHGAPLSIPSLEIL-NGKCVMGSLFGGVKPKQDIPILADKYLNKELELDKFI  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  +DIN AFDLL+QGKSLRC IWMDK
Sbjct  352  THEVPLKDINTAFDLLLQGKSLRCTIWMDK  381



>ref|XP_008804784.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Phoenix dactylifera]
Length=381

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 177/210 (84%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  173  ACLLSCGVSTGVGAAWKVAEVEAGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN   IG ++VS+VI EMT  GADYCFEC+G A+L+ +A+ S R GWG
Sbjct  233  FELGKKFGLTDFVNPKEIGERTVSEVIIEMTNRGADYCFECIGLASLMNDAFQSSRPGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  G+ L ++S E+L+ GK ++G+LFGG+K K+DIP+LAK+Y + EL LD F+
Sbjct  293  KTIILGVEMHGSPLCVSSAEILN-GKCIMGTLFGGIKAKNDIPILAKKYLNKELHLDDFI  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG ++INKAFDLLIQGKSLRC IWMD+
Sbjct  352  THEVGLQEINKAFDLLIQGKSLRCTIWMDR  381



>gb|KDO81036.1| hypothetical protein CISIN_1g016363mg [Citrus sinensis]
Length=371

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 176/210 (84%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL  A++IIGVDINP+K
Sbjct  161  ACLLSCGVSTGVGAAWKVAGVEVGSTVAIFGLGAVGLAVAEGARLNRASKIIGVDINPEK  220

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G+K+VSQVI EMT GGADYCFEC+G  +++ +A+ S R+GWG
Sbjct  221  FEIGKKFGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLTSVMNDAFNSSREGWG  280

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ +SLNS E+L  G+++ G+ FGGLKP+SDI  LA++Y D EL L +F+
Sbjct  281  KTVILGVEMHGSPISLNSIEIL-KGRSVCGTYFGGLKPRSDIATLAQKYLDKELNLGEFI  339

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F DINKAFDLL++GKSLRC+IWMDK
Sbjct  340  THEVSFHDINKAFDLLLEGKSLRCIIWMDK  369



>gb|KDP41414.1| hypothetical protein JCGZ_15821 [Jatropha curcas]
Length=388

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 178/210 (85%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA ++A+VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  180  ACLLSCGISTGVGAAWKAADVEEGSTVAIFGLGTVGLAVAEGARLRGASKIIGVDLNPEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG+++FVN  T G K V+QVI EMT GGAD CFEC+G A+L+ EA+ S R+GWG
Sbjct  240  FEIGKKFGLTEFVNPSTCGEKPVNQVIKEMTDGGADCCFECIGLASLMTEAFRSSRQGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ +S N FE+L  G+++ G+L GGLKPKSDI  LAK+Y D EL L++F+
Sbjct  300  KTVILGVEMHGSPVSFNPFEMLE-GRSVAGALIGGLKPKSDIHTLAKKYLDKELNLEEFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F+DINKAFDLL++GKSLRC+IWMDK
Sbjct  359  THELSFKDINKAFDLLLEGKSLRCIIWMDK  388



>ref|XP_008804783.1| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 7 
[Phoenix dactylifera]
Length=382

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSC VSTGVGAA + A VE GS VAIFGLG++GLAVAEGARL GA RIIGVD+NPDK
Sbjct  174  ACLLSCSVSTGVGAAWKVAKVEAGSXVAIFGLGAVGLAVAEGARLRGAGRIIGVDLNPDK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK  G++DFVN   +G K VSQVI EMTGGGADYCFEC+G A+L+ +A+ S R G G
Sbjct  234  FEIGKRLGITDFVNPKELGEKPVSQVIREMTGGGADYCFECIGLASLMSDAFQSSRIGSG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  G+ + L+S E+L  GK ++GSL+GG+KPK+DIP+L K+Y + EL+LD+F+
Sbjct  294  KTIILGVEMHGSPIMLDSTEILR-GKCVMGSLYGGIKPKTDIPILVKQYLNKELKLDEFI  352

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+GF DINKAFDLLIQGKSLRC IWMD+
Sbjct  353  THEMGFHDINKAFDLLIQGKSLRCTIWMDR  382



>ref|XP_006433936.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|ESR47176.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|KDO81032.1| hypothetical protein CISIN_1g016363mg [Citrus sinensis]
Length=390

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 176/210 (84%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL  A++IIGVDINP+K
Sbjct  180  ACLLSCGVSTGVGAAWKVAGVEVGSTVAIFGLGAVGLAVAEGARLNRASKIIGVDINPEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G+K+VSQVI EMT GGADYCFEC+G  +++ +A+ S R+GWG
Sbjct  240  FEIGKKFGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLTSVMNDAFNSSREGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ +SLNS E+L  G+++ G+ FGGLKP+SDI  LA++Y D EL L +F+
Sbjct  300  KTVILGVEMHGSPISLNSIEIL-KGRSVCGTYFGGLKPRSDIATLAQKYLDKELNLGEFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F DINKAFDLL++GKSLRC+IWMDK
Sbjct  359  THEVSFHDINKAFDLLLEGKSLRCIIWMDK  388



>emb|CDP04608.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 168/211 (80%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++A+VE GSTVAIFGLG IGL+VAEGARL GA RIIGVD+NP+K
Sbjct  178  ACLLGCGVSTGVGAAWKTADVEAGSTVAIFGLGVIGLSVAEGARLRGAKRIIGVDLNPEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
             E GK  GV+ ++N   +G KS S+VI EMT G GADYCFECVG  +L QEA+  CRKGW
Sbjct  238  AEIGKKVGVTHYLNPTDLGGKSASEVILEMTDGLGADYCFECVGLPSLGQEAFTCCRKGW  297

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LGVDKP +QL LNS    HSGK++ G  +GGLKP  DIP+LAKRY D EL+LD F
Sbjct  298  GKTVILGVDKPDSQLILNSLVNSHSGKSITGVQYGGLKPNIDIPILAKRYLDKELQLDLF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHEV  EDINKAF LLI+GK LR VIWMDK
Sbjct  358  VTHEVKLEDINKAFKLLIEGKCLRTVIWMDK  388



>ref|XP_002465730.1| hypothetical protein SORBIDRAFT_01g044590 [Sorghum bicolor]
 gb|EER92728.1| hypothetical protein SORBIDRAFT_01g044590 [Sorghum bicolor]
Length=337

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  702  GVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFERGKT  523
            G STGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA++IIGVDINPDK+E GK 
Sbjct  135  GASTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDINPDKYELGKK  194

Query  522  FGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKTVVLG  343
            FG++ F+N   +G K V Q I EMT GGADYCFEC+G A L+ +A+ S R+GWGKT++LG
Sbjct  195  FGMTHFINPKELGEKPVYQAIVEMTDGGADYCFECIGLAALMNDAFQSSREGWGKTIILG  254

Query  342  VDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTHEVGF  163
            V+  GA L+++S E+L  GK++IGS+FGG+KPK DIP+LA +Y + ELELDKF+THEVG 
Sbjct  255  VEMHGAPLAVSSHEILR-GKSVIGSMFGGVKPKQDIPILADKYLNKELELDKFITHEVGL  313

Query  162  EDINKAFDLLIQGKSLRCVIWMDK  91
             DIN+AFDLL+QGKS+RC IWMD+
Sbjct  314  NDINEAFDLLLQGKSVRCTIWMDR  337



>gb|KJB11818.1| hypothetical protein B456_002G1197001, partial [Gossypium raimondii]
Length=361

 Score =   286 bits (733),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C ++TGVGAA + ANVE GSTV IFGLGSIGLAVA+GA+LCGA RIIGVD+NPDK
Sbjct  179  ACLFGCCIATGVGAACKVANVEAGSTVVIFGLGSIGLAVAKGAKLCGANRIIGVDVNPDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++F+NS   GN+S+SQV+ EMTGGGADYCFECVG A+LVQEAYASCRKGWG
Sbjct  239  FEIAKKFGVTEFINSKDCGNESLSQVVKEMTGGGADYCFECVGLASLVQEAYASCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGV KPG+QLSL+SFEVLHSGKTL G+LFGG+K KSD+P+L KRY+D EL++D+FV
Sbjct  299  KTIVLGVQKPGSQLSLSSFEVLHSGKTLTGALFGGVKAKSDLPLLLKRYTDNELQVDEFV  358

Query  180  THE  172
            THE
Sbjct  359  THE  361



>gb|EEC82469.1| hypothetical protein OsI_26910 [Oryza sativa Indica Group]
Length=390

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA + A VEPGS+VA+FGLG++GLAVA+GAR+ GA RIIGVD+NPDK
Sbjct  173  ACLLSCGISTGVGAAWKVAAVEPGSSVAVFGLGAVGLAVAQGARMRGAKRIIGVDLNPDK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMT-GGGADYCFECVGQATLVQEAYASCRKGW  364
            F+ GK  G++DF+N    G K+VS+VI EMT GGGADYCFEC+G  +++ EA+ S R GW
Sbjct  233  FDVGKRLGMTDFINPNDTGGKTVSEVIKEMTGGGGADYCFECIGSTSVMAEAFQSTRNGW  292

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGV    A +S+ S E+L  G+++IGSLFGG+KPK+DIP+LA++Y D ELEL++F
Sbjct  293  GKTILLGVSGNKAPISIPSHEILR-GRSVIGSLFGGIKPKNDIPMLAQKYLDKELELEEF  351

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            +THE+GFE+IN+AF+LL QGKS+RC+IWMD
Sbjct  352  ITHEMGFEEINRAFELLTQGKSIRCIIWMD  381



>ref|NP_001060310.1| Os07g0621800 [Oryza sativa Japonica Group]
 dbj|BAC10189.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF22224.1| Os07g0621800 [Oryza sativa Japonica Group]
 dbj|BAG92638.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67611.1| hypothetical protein OsJ_25166 [Oryza sativa Japonica Group]
Length=390

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA + A VEPGS+VA+FGLG++GLAVA+GAR+ GA RIIGVD+NPDK
Sbjct  173  ACLLSCGISTGVGAAWKVAAVEPGSSVAVFGLGAVGLAVAQGARMRGAKRIIGVDLNPDK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMT-GGGADYCFECVGQATLVQEAYASCRKGW  364
            F+ GK  G++DF+N    G K+VS+VI EMT GGGADYCFEC+G  +++ EA+ S R GW
Sbjct  233  FDVGKRLGMTDFINPNDTGGKTVSEVIKEMTGGGGADYCFECIGSTSVMAEAFQSTRNGW  292

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGV    A +S+ S E+L  G+++IGSLFGG+KPK+DIP+LA++Y D ELEL++F
Sbjct  293  GKTILLGVSGNKAPISIPSHEILR-GRSVIGSLFGGIKPKNDIPMLAQKYLDKELELEEF  351

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            +THE+GFE+IN+AF+LL QGKS+RC+IWMD
Sbjct  352  ITHEMGFEEINRAFELLTQGKSIRCIIWMD  381



>ref|XP_008464881.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X4 [Cucumis melo]
Length=360

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGA+ R+A VE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D++P K
Sbjct  151  ACLLGCGVSTGVGASWRTAKVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVSPYK  210

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV++ VNS +IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWG
Sbjct  211  LTLAKEFGVTEVVNSRSIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWG  270

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++ GV+   + L +   + +  GK L+G ++GGLKPKSDIP L + Y D +L+LD F+
Sbjct  271  KTIIFGVEDQASLLGVKCMDAICQGKMLMGCIYGGLKPKSDIPTLLQWYMDKKLQLDLFI  330

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF LL +G+ LRC+IWM K
Sbjct  331  THEVGFEDINKAFSLLSEGQCLRCMIWMTK  360



>ref|XP_007018717.1| GroES-like zinc-binding dehydrogenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY15942.1| GroES-like zinc-binding dehydrogenase family protein isoform 
1 [Theobroma cacao]
Length=406

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 180/229 (79%), Gaps = 20/229 (9%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAV-------------------AE  598
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAV                   AE
Sbjct  179  ACLLSCGVSTGIGAAWKVADIEGGSTVAIFGLGAVGLAVLITQLHLFNPCPNHALLIVAE  238

Query  597  GARLCGAARIIGVDINPDKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFEC  418
            GARL GA++IIGVD+NP+KFE GKTFGV+DF+N  T G K VS+VI EMT GGADYCFEC
Sbjct  239  GARLRGASKIIGVDLNPEKFEIGKTFGVTDFINPATCGEKKVSEVIKEMTDGGADYCFEC  298

Query  417  VGQATLVQEAYASCRKGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSD  238
            +G A+L+++A+ S R+GWGKTV+LGV+K G  L+LN++ +L  G+++ G LFGG KPKSD
Sbjct  299  IGLASLMEDAFNSNREGWGKTVILGVEKHGTPLALNTYLLLR-GRSVTGCLFGGFKPKSD  357

Query  237  IPVLAKRYSDGELELDKFVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            IP+LA++Y D EL LD F+THE+ F+DINKAF+LL+QGKSLRC+IWMD 
Sbjct  358  IPLLAEKYLDKELNLDGFITHELSFQDINKAFELLLQGKSLRCIIWMDN  406



>ref|XP_008464879.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X2 [Cucumis melo]
Length=387

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGA+ R+A VE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D++P K
Sbjct  178  ACLLGCGVSTGVGASWRTAKVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVSPYK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV++ VNS +IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWG
Sbjct  238  LTLAKEFGVTEVVNSRSIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++ GV+   + L +   + +  GK L+G ++GGLKPKSDIP L + Y D +L+LD F+
Sbjct  298  KTIIFGVEDQASLLGVKCMDAICQGKMLMGCIYGGLKPKSDIPTLLQWYMDKKLQLDLFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF LL +G+ LRC+IWM K
Sbjct  358  THEVGFEDINKAFSLLSEGQCLRCMIWMTK  387



>ref|XP_008464878.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Cucumis melo]
Length=416

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGA+ R+A VE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D++P K
Sbjct  207  ACLLGCGVSTGVGASWRTAKVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVSPYK  266

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV++ VNS +IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWG
Sbjct  267  LTLAKEFGVTEVVNSRSIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWG  326

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++ GV+   + L +   + +  GK L+G ++GGLKPKSDIP L + Y D +L+LD F+
Sbjct  327  KTIIFGVEDQASLLGVKCMDAICQGKMLMGCIYGGLKPKSDIPTLLQWYMDKKLQLDLFI  386

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVGFEDINKAF LL +G+ LRC+IWM K
Sbjct  387  THEVGFEDINKAFSLLSEGQCLRCMIWMTK  416



>ref|XP_010272993.1| PREDICTED: alcohol dehydrogenase-like 7 [Nelumbo nucifera]
Length=388

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A+VE GSTV IFGLG++GLAVAEGAR+ GA++IIGVD+NP K
Sbjct  180  ACLLSCGVSTGVGAAWKVADVEAGSTVVIFGLGAVGLAVAEGARIRGASKIIGVDLNPQK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN     ++ +++VI EMT GGADYCFEC+G A+L+ +A+  CR GWG
Sbjct  240  FEIGKKFGVTDFVNPKDCLDRPITEVISEMTDGGADYCFECIGLASLMNDAFNCCRSGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  G+ LS+N  E+L  GK + G+LFGG K K+DIP+ AK Y D EL LD F+
Sbjct  300  KTVILGVEMHGSPLSINCLEILR-GKCITGALFGGTKAKTDIPLFAKMYLDKELHLDDFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F DINKAFDLLIQ KS+RC+IWMD+
Sbjct  359  THEVSFHDINKAFDLLIQEKSIRCIIWMDR  388



>ref|XP_004491173.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X2 [Cicer 
arietinum]
Length=359

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 161/210 (77%), Gaps = 29/210 (14%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVEPGSTVA+FGLG IGLAVAEGARLCGA RIIGVDINP K
Sbjct  179  ACLLSCGVSTGVGAAWRTANVEPGSTVAVFGLGCIGLAVAEGARLCGATRIIGVDINPQK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F+ GK FG++DFV++    NKSVSQVI EMTGGGADYCFECVG A+LV EAYASCR    
Sbjct  239  FDIGKKFGLTDFVHAGECENKSVSQVIMEMTGGGADYCFECVGMASLVHEAYASCR----  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
                                     KTL+GSLFGGLKPK+D+P+L KRY D EL LD FV
Sbjct  295  -------------------------KTLMGSLFGGLKPKTDVPILLKRYIDKELNLDDFV  329

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DINKAFDLLI+G+SLRC+IWM K
Sbjct  330  THEVEFKDINKAFDLLIKGQSLRCLIWMHK  359



>ref|XP_003562679.1| PREDICTED: alcohol dehydrogenase-like 2 [Brachypodium distachyon]
Length=408

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VEPGSTVA+FGLG++GLAVA+G+++ GA RIIGVD+NPDK
Sbjct  177  ACLLSCGVSTGVGAAWKVAAVEPGSTVAVFGLGAVGLAVAQGSKMRGAKRIIGVDLNPDK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK  G+++F+N    G K+VS+VI EMTGGGADYCFEC+G   +  EA++S R GWG
Sbjct  237  CEIGKRMGITEFINPNDTGGKAVSEVIKEMTGGGADYCFECIGSTAVTAEAFSSSRMGWG  296

Query  360  KTVVLGVDK-PGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            KT+VLGV     A +S+ S+E+L  G++++GSLFGGLKPK+D+P+LA++Y D ELELD+F
Sbjct  297  KTIVLGVASGAAAPISIPSYEILR-GRSVVGSLFGGLKPKTDVPLLAQKYLDEELELDEF  355

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            VTHE+GF+DIN AFDLL QGK LRC+IWMD
Sbjct  356  VTHEMGFDDINGAFDLLTQGKCLRCIIWMD  385



>ref|XP_006828009.1| hypothetical protein AMTR_s00008p00243660 [Amborella trichopoda]
 gb|ERM95425.1| hypothetical protein AMTR_s00008p00243660 [Amborella trichopoda]
Length=386

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 173/209 (83%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA + ANVE GSTV IFGLG++GLAVAEGAR+ GA++IIGVD+NP K
Sbjct  178  ACLLSCGISTGVGAAWKVANVEAGSTVVIFGLGTVGLAVAEGARIQGASKIIGVDLNPQK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+ +G++DF+N    G+K V +VI EMT GG DYCFECVG A+L+ EA+ S R GWG
Sbjct  238  FELGQVYGLTDFINPKECGDKPVHEVIREMTDGGVDYCFECVGLASLMSEAFLSSRPGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA +S++S E+L  GKT++GSLFGG+KPKSDIP+LA +Y   EL+L+ FV
Sbjct  298  KTIILGVEMHGAPISISSIEIL-KGKTVMGSLFGGIKPKSDIPLLANKYLKKELQLEGFV  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DINKAFDL++QG+ LRC+I MD
Sbjct  357  THEVSFQDINKAFDLMLQGEGLRCIIRMD  385



>ref|XP_004958351.1| PREDICTED: alcohol dehydrogenase-like 5-like [Setaria italica]
Length=325

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VEPGSTVA+FGLG++GLAVA+G+++ GA RIIGVD+NPDK
Sbjct  111  ACLLSCGVSTGVGAAWKVAAVEPGSTVAVFGLGTVGLAVAQGSKMHGATRIIGVDLNPDK  170

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+  GV+DFVN    G K+VS+VI EMTGGGAD+CFEC+G  +++ EA+ S R GWG
Sbjct  171  FEIGQRLGVTDFVNPNDTGEKTVSEVIKEMTGGGADHCFECIGIPSVMAEAFQSSRTGWG  230

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG D   A +S++S  +   G+++ G+L GG+KPK DIPVLA++Y D ELELD+FV
Sbjct  231  KTIILGSDAAAAPVSISSSGI-KRGRSVTGALLGGIKPKDDIPVLAQKYMDKELELDEFV  289

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            TH +GF+DIN AFDLL +GK LRC+IWMD
Sbjct  290  THRMGFDDINIAFDLLARGKCLRCIIWMD  318



>emb|CDP09730.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++A++E G+TVAIFGLG IGLAVAEGARL GA  IIGVD+NPDK
Sbjct  178  ACLLGCGVSTGVGAAWKTADIEEGTTVAIFGLGVIGLAVAEGARLRGAKTIIGVDLNPDK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
             E GK FG++ F+N   +G K  S+VI EMT G GADYCFECVG  +L QEA+  CRKGW
Sbjct  238  VEIGKKFGITHFINPRELGGKLASEVILEMTDGLGADYCFECVGLPSLSQEAFTCCRKGW  297

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGVDKP +Q  LNS    HSGKT+ G  +GGLKP  DI +LAKRY D EL+LD F
Sbjct  298  GKTIILGVDKPDSQFILNSLVNNHSGKTITGVQYGGLKPNLDIAILAKRYLDKELQLDLF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHE+  EDINKAF LLI+GK LR VIW D+
Sbjct  358  VTHEIKLEDINKAFKLLIEGKCLRTVIWFDQ  388



>ref|XP_010025911.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X2 [Eucalyptus 
grandis]
Length=360

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVG A + A++E GS+V IFGLG +GLAVAEGARL GA++I+GVD+NPDK
Sbjct  152  ACLLSCGVSTGVGGAWKVADIERGSSVVIFGLGVVGLAVAEGARLRGASKIVGVDLNPDK  211

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN    G + VS+VI E+T GGADY FECVG A+++ +A+ S R+G G
Sbjct  212  FEIGKKFGVTDFVNPEACGERPVSEVIKEITDGGADYSFECVGLASVMADAFNSSREGGG  271

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  GA LSL S+E+L  G+T++GS FGGLKPKSD+P+LA++Y D EL LD F+
Sbjct  272  KTVILGVESRGAPLSLGSYEILR-GRTVVGSYFGGLKPKSDVPLLAQKYLDQELNLDDFI  330

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            T EV F+DIN AFDLL+QGKSLRC+IWMD+
Sbjct  331  TQEVSFQDINTAFDLLLQGKSLRCIIWMDR  360



>ref|XP_010025906.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83079.1| hypothetical protein EUGRSUZ_B00037 [Eucalyptus grandis]
Length=388

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVG A + A++E GS+V IFGLG +GLAVAEGARL GA++I+GVD+NPDK
Sbjct  180  ACLLSCGVSTGVGGAWKVADIERGSSVVIFGLGVVGLAVAEGARLRGASKIVGVDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN    G + VS+VI E+T GGADY FECVG A+++ +A+ S R+G G
Sbjct  240  FEIGKKFGVTDFVNPEACGERPVSEVIKEITDGGADYSFECVGLASVMADAFNSSREGGG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  GA LSL S+E+L  G+T++GS FGGLKPKSD+P+LA++Y D EL LD F+
Sbjct  300  KTVILGVESRGAPLSLGSYEILR-GRTVVGSYFGGLKPKSDVPLLAQKYLDQELNLDDFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            T EV F+DIN AFDLL+QGKSLRC+IWMD+
Sbjct  359  TQEVSFQDINTAFDLLLQGKSLRCIIWMDR  388



>gb|EEC82468.1| hypothetical protein OsI_26909 [Oryza sativa Indica Group]
Length=392

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA + A VEPGS+VA+FGLG++GLAVA+GAR+ GA RIIGVD+NPDK
Sbjct  175  ACLLSCGISTGVGAAWKVAAVEPGSSVAVFGLGAVGLAVAQGARMRGATRIIGVDLNPDK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMT-GGGADYCFECVGQATLVQEAYASCRKGW  364
            F+ GK  G++DF+N    G K+VS+VI EMT GGGADYCFEC+G A+++ EA+ S R GW
Sbjct  235  FDVGKRLGITDFINPNDTGGKTVSEVIKEMTGGGGADYCFECIGSASVMAEAFQSSRMGW  294

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGV    A + +   ++L  G+++IGSLFGG+KPK+DIP+LA++Y D ELEL++F
Sbjct  295  GKTILLGVIGSMAPIGIPPQDLL-PGRSVIGSLFGGIKPKNDIPMLAQKYLDKELELEEF  353

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            +THE+GFE+IN+AF+LL QGKS+RC+IWMD
Sbjct  354  ITHEMGFEEINRAFELLTQGKSIRCIIWMD  383



>emb|CDP09728.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++A+VE GSTVAIFGLG IGLAVAEGARL GA  IIGVD+NPDK
Sbjct  178  ACLLGCGVSTGVGAAWKTADVEAGSTVAIFGLGVIGLAVAEGARLRGAKTIIGVDLNPDK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
             E GK FG++ F+N   +G K  S+VI  MT G GADYCFECVG  +L QEA+A CRKGW
Sbjct  238  VEIGKKFGITHFINPKELGGKPASEVILGMTDGLGADYCFECVGLPSLSQEAFACCRKGW  297

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGVDKP ++  LNS    HSGKT+ G  +GGLKP  DI +L KRY D EL+LD F
Sbjct  298  GKTIILGVDKPDSKFILNSLVNNHSGKTITGVQYGGLKPNIDIAILGKRYLDKELQLDLF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHE+  EDINKAF LLI+GK LR VIWMD+
Sbjct  358  VTHEIKLEDINKAFKLLIEGKCLRTVIWMDQ  388



>emb|CDP15613.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   280 bits (717),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++A+VE G+TVAIFGLG IGLAVAEGARL GA  IIGVD+NPDK
Sbjct  178  ACLLGCGVSTGVGAAWKTADVEEGTTVAIFGLGVIGLAVAEGARLRGAKTIIGVDLNPDK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
             E GK FG++ F+N   +G K  S+VI EMT G GADYCFECVG  +L QEA+  CRKGW
Sbjct  238  VEIGKKFGITHFINPRELGGKLASEVILEMTDGLGADYCFECVGLPSLSQEAFTCCRKGW  297

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGVDKP +Q  LNS    HSGKT+ G  +GGLKP  DI +LAKRY D +L+LD F
Sbjct  298  GKTIILGVDKPDSQFILNSLVNNHSGKTITGVQYGGLKPNLDIAILAKRYLDKKLQLDLF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHE+  EDINKAF LLI+GK LR VIW D+
Sbjct  358  VTHEIKLEDINKAFKLLIEGKCLRTVIWFDQ  388



>ref|XP_010025924.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X2 [Eucalyptus 
grandis]
Length=360

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVG A + A++E GS+V IFGLG +GLAVAEGARL GA++I+GVD+NPDK
Sbjct  152  ACLLSCGVSTGVGGAWKVADIEQGSSVVIFGLGVVGLAVAEGARLRGASKIVGVDLNPDK  211

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVN    G + VS+VI E+T GGADY FECVG A+++ +A+ S R+G G
Sbjct  212  FEIGKKFGVTNFVNPEACGERPVSEVIKEITDGGADYSFECVGLASVMVDAFNSSREGGG  271

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  GA LSL S+E+L  G+T++GS FGGLKPKSD+P+LA++Y D EL LD F+
Sbjct  272  KTVILGVESRGAPLSLGSYEILR-GRTVVGSYFGGLKPKSDVPLLAQKYLDQELNLDDFI  330

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            T EV F+DIN AFDLL+QGKSLRC+IWMD+
Sbjct  331  TQEVSFQDINTAFDLLLQGKSLRCIIWMDR  360



>emb|CDP15616.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++A+VE G+TVAIFGLG IGLAVAEGARL GA  IIGVD+NPDK
Sbjct  178  ACLLGCGVSTGVGAAWKTADVEEGTTVAIFGLGVIGLAVAEGARLRGAKTIIGVDLNPDK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
             E GK FG++ F+N   +G K  S+VI EMT G GADYCFECVG  +L QEA+  CRKGW
Sbjct  238  AEIGKKFGITHFINPRELGGKLASEVILEMTDGLGADYCFECVGLPSLSQEAFTCCRKGW  297

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGVDKP +Q  LNS    HSGKT+ G  +GGLKP  DI +LAKRY + EL+LD F
Sbjct  298  GKTIILGVDKPDSQFILNSLVNNHSGKTITGVQYGGLKPNLDIAILAKRYLEKELQLDLF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTHE+  EDINKAF LLI+GK LR VIW D+
Sbjct  358  VTHEIKLEDINKAFKLLIEGKCLRTVIWFDQ  388



>ref|XP_004958352.1| PREDICTED: alcohol dehydrogenase-like 2-like [Setaria italica]
Length=391

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 172/210 (82%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TGVGAA + A VEPGSTVAIFGLG++GLAVA+G+++ GA RIIGVD+NPDK
Sbjct  175  ACLLSCGVATGVGAAWKVAAVEPGSTVAIFGLGAVGLAVAQGSKMRGATRIIGVDLNPDK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMT-GGGADYCFECVGQATLVQEAYASCRKGW  364
            FE GK  G++DFVN   IG ++VS+VI EMT G GADYCFEC+G  +++ EA+ S R GW
Sbjct  235  FEIGKKLGITDFVNPNGIGEQTVSEVIKEMTSGAGADYCFECIGSVSVMAEAFKSSRMGW  294

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTVVLGVD   A +S+ SF+++  G++++GS  GG+KPK DIPVLA +  D ELELD+F
Sbjct  295  GKTVVLGVDGSAAPISIPSFDIMR-GRSVVGSYLGGIKPKDDIPVLAHKCLDKELELDEF  353

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            +TH++GF+DIN AFDLL +GK LRC+IWMD
Sbjct  354  ITHQMGFDDINSAFDLLARGKCLRCIIWMD  383



>ref|XP_006363286.1| PREDICTED: alcohol dehydrogenase-like 1-like [Solanum tuberosum]
Length=388

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + A VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  179  ASLLSCGVSTGLGAAWKVAEVEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DF+N  T G KS SQVI EMT  GADYCFEC+G  +L+Q+A+ S RK  G
Sbjct  239  FEIGKKFGVTDFINPTTCGEKSTSQVIKEMTDDGADYCFECIGLTSLMQDAFTSSRKDTG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG++  G  LS++  E++ +GKT+ GS+FGG+K K DIP+ A +Y + EL LD F+
Sbjct  299  KTILLGIEMHGTPLSISPLELVAAGKTITGSMFGGVKAKVDIPIFANQYLNNELNLDGFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLL   KSLRC+IWMDK
Sbjct  359  THEVSFEDINKAFDLLEARKSLRCIIWMDK  388



>dbj|BAJ90549.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88426.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 171/210 (81%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CG  TGVGAA R A V+PGS+V IFGLG++GL+VA+GA++CGA +IIGVD+NPDK
Sbjct  177  ACLLGCGAGTGVGAAWRLAKVQPGSSVVIFGLGAVGLSVAQGAKMCGATKIIGVDLNPDK  236

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+DFVN   +G   +SQ I EMTGGGADYCFEC+G A+++ +A+ S ++G G
Sbjct  237  QELGKKFGVTDFVNPSKLGESPLSQAIIEMTGGGADYCFECIGAASVMTDAFRSAKQGNG  296

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+K G  +SL S E L  GK ++GSLFGG+KPK+DIP+LA++  + ELEL+K +
Sbjct  297  KTVILGVEKDGKPISLPSIEFLF-GKCVMGSLFGGMKPKTDIPILAEKCMNKELELEKLI  355

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG ++IN AFDLL+QGKSLRC+IWMDK
Sbjct  356  THEVGLQEINTAFDLLLQGKSLRCIIWMDK  385



>ref|XP_009103237.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X1 [Brassica 
rapa]
Length=389

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSC VSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NPDK
Sbjct  181  AALLSCCVSTGVGAAWKVAGVEEGSTVAIFGLGAVGLAVAEGARLHGASKIIGVDLNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N+ + G K++SQVI EMTGGG DY FEC+G A+L++EA+ S R G G
Sbjct  241  FEIGKRFGITDFINTASCGEKTISQVIKEMTGGGVDYSFECIGLASLMEEAFNSSRTGSG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K  + +SL+S  +L  G+++ GSLFGGLKPK DIP+L  RY   EL LD F+
Sbjct  301  KTVILGMEKNASPISLDSRAILR-GRSVHGSLFGGLKPKLDIPILVDRYLKKELNLDGFI  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL++GKS+RC++WMDK
Sbjct  360  THEISFEEINKAFDLLVEGKSIRCIMWMDK  389



>gb|KFK44338.1| hypothetical protein AALP_AA1G245100 [Arabis alpina]
Length=392

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + A+VE GSTVAIFGLG++GLAVAEGARL GAARIIGVD+NPDK
Sbjct  184  ASLLSCGVSTGIGAAWKVADVEAGSTVAIFGLGAVGLAVAEGARLRGAARIIGVDLNPDK  243

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE+GK FG +DFVN    G K +S+VI EMTGGG DY FECVG A+L+ EA+ S RKG G
Sbjct  244  FEQGKIFGFTDFVNPTLCGEKKISEVIKEMTGGGVDYSFECVGLASLMNEAFMSTRKGSG  303

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG++K GA +SL SF+++ +G+ + G LFGGLK K DIP+L   Y   EL LD F+
Sbjct  304  KTVVLGMEKHGAPISLGSFDLI-AGRDICGCLFGGLKSKLDIPILVDHYLKKELNLDSFI  362

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F++INKAFDLL +GKSLRC IWMDK
Sbjct  363  THELKFDEINKAFDLLEKGKSLRCTIWMDK  392



>ref|XP_010025916.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Eucalyptus 
grandis]
Length=388

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVG A + A++E GS+V IFGLG +GLAVAEGARL GA++I+GVD+NPDK
Sbjct  180  ACLLSCGVSTGVGGAWKVADIEQGSSVVIFGLGVVGLAVAEGARLRGASKIVGVDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVN    G + VS+VI E+T GGADY FECVG A+++ +A+ S R+G G
Sbjct  240  FEIGKKFGVTNFVNPEACGERPVSEVIKEITDGGADYSFECVGLASVMVDAFNSSREGGG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+  GA LSL S+E+L  G+T++GS FGGLKPKSD+P+LA++Y D EL LD F+
Sbjct  300  KTVILGVESRGAPLSLGSYEILR-GRTVVGSYFGGLKPKSDVPLLAQKYLDQELNLDDFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            T EV F+DIN AFDLL+QGKSLRC+IWMD+
Sbjct  359  TQEVSFQDINTAFDLLLQGKSLRCIIWMDR  388



>gb|EPS73677.1| hypothetical protein M569_01082, partial [Genlisea aurea]
Length=279

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA ++ANVE GSTV IFGLG+IGLAVAEGAR+ GAARIIGVDINP+K
Sbjct  88   ACLLSCGVSTGVGAAWKTANVESGSTVVIFGLGAIGLAVAEGARIRGAARIIGVDINPEK  147

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++FVNS + G+KS+SQ+I EMT GGADYCFECVG A+L+ EAY SCRKGWG
Sbjct  148  FEISKKFGVTEFVNSTSCGDKSLSQIINEMTDGGADYCFECVGLASLITEAYDSCRKGWG  207

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVV+GV +PG ++ L++  ++  G+ L G +FG +KPKS++ +L K Y++ ELELDKF+
Sbjct  208  KTVVVGVTQPGDKVELSALGIVDYGRILTGCIFGSIKPKSELSILIKSYAEKELELDKFI  267

Query  180  THEVGFEDINKA  145
            THEVGF+DINKA
Sbjct  268  THEVGFDDINKA  279



>ref|XP_006363284.1| PREDICTED: alcohol dehydrogenase-like 1-like isoform X1 [Solanum 
tuberosum]
Length=387

 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA R A++E GSTVAIFGLG++GLAV +GA+L GAA+IIGVD+NP+K
Sbjct  179  ASLLSCGVSTGLGAAWRVADIEEGSTVAIFGLGAVGLAVVQGAKLRGAAKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FG++DF+N  T G KS SQ+I EMT GGADYCFEC+G A+L+QEA+ S RKG G
Sbjct  239  IEIGKKFGLTDFINPTTCGEKSTSQIIKEMTDGGADYCFECIGLASLMQEAFTSSRKGTG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++  G  LS+N +E L +GKT+ GS+FGG+K K DIP+ A +Y + EL L+ F+
Sbjct  299  KTVILGIEMHGTPLSINPYE-LAAGKTITGSMFGGVKAKVDIPIFANQYLNNELNLEGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  EDINKAFDLL  GK+LRC+IWMDK
Sbjct  358  THEVNCEDINKAFDLLEAGKTLRCIIWMDK  387



>gb|KJB64116.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
 gb|KJB64117.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
 gb|KJB64125.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=290

 Score =   274 bits (700),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+N +K
Sbjct  83   ACLLSCGVSTGIGAAWKVADIEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNQEK  142

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGVS+F+N  T G K VS+VI E+T GG DY FEC+G A+L++EA+ S R  WG
Sbjct  143  FEIGKKFGVSEFINPTTCGEKKVSEVIKEITDGGVDYSFECIGLASLMEEAFNSSRVNWG  202

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+     L +N++ +L  G+T+ G  FGGLK KSDIP+LA++Y   E+ LD F+
Sbjct  203  KTVILGVEMHHTPLPINTYFLLR-GRTVTGCFFGGLKAKSDIPILAQKYLHKEINLDGFI  261

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DINKAFDLL++GKSLRC+IWMD
Sbjct  262  THEVNFQDINKAFDLLLEGKSLRCIIWMD  290



>ref|XP_004238533.1| PREDICTED: alcohol dehydrogenase-like 1 [Solanum lycopersicum]
Length=384

 Score =   276 bits (707),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + A VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  175  ASLLSCGVSTGLGAAWKIAQVEQGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  234

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G KS SQVI E+T  GADYCFEC+G   L+Q+A+ S RK  G
Sbjct  235  FEIGKKFGLTDFINPTTCGEKSTSQVIKELTDNGADYCFECIGLTALMQDAFTSSRKDTG  294

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG++  GA LS++  E++ +GKT+ GS+FGG+K K DIP+ A +Y + EL LD F+
Sbjct  295  KTILLGIEMHGAPLSISPLELVLAGKTITGSMFGGVKAKVDIPIFANQYLNNELNLDGFI  354

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLL   KSLRC+IWMDK
Sbjct  355  THEVNFEDINKAFDLLEARKSLRCIIWMDK  384



>tpg|DAA43801.1| TPA: putative alcohol dehydrogenase superfamily protein [Zea 
mays]
Length=259

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG  TGVGAA RSA VEPGSTVAIFGLGS+GLAV +GA++CGA++IIGVD+NPDK
Sbjct  49   ACLLSCGAGTGVGAAWRSAKVEPGSTVAIFGLGSVGLAVVQGAKMCGASKIIGVDLNPDK  108

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E G++FGV+DFVN   +  +SV +VI EMTGGG DY FEC+G  +++ +A+   + G G
Sbjct  109  EEVGRSFGVTDFVNPSQLDKRSVVEVIVEMTGGGVDYSFECIGVPSVMTDAFRCTKMGKG  168

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+ +   ++ L S E+L  G+ ++GSLFGGLKPK+ IPVLAK+  D EL+LD  V
Sbjct  169  KTIVLGLGRDSDEVCLPSLELLF-GRCVMGSLFGGLKPKTHIPVLAKKCMDKELQLDALV  227

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+G +DINKAFDLL+QGKSLRC++WMDK
Sbjct  228  THELGLQDINKAFDLLLQGKSLRCILWMDK  257



>emb|CDP09731.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGAA ++A++E G+TVAIFGLG IGL+VAEGAR+ GA  IIGVD+NPDK
Sbjct  178  ACLLGCGVSTGVGAAWKTADIEAGTTVAIFGLGVIGLSVAEGARIRGAKTIIGVDLNPDK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
             E GK FG++ F+N   +G K  S+VI  MT G GADYCFECVG  +L QEA+A CRKGW
Sbjct  238  VEIGKKFGITHFINPKELGGKLASEVILGMTDGLGADYCFECVGLPSLSQEAFACCRKGW  297

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LGVDKP A+  LNS    HSGKT+IG  +GGLKP  DI +L KRY D EL+LD F
Sbjct  298  GKTVILGVDKPDAKFILNSLVNNHSGKTVIGVQYGGLKPNIDIAILGKRYLDKELQLDLF  357

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            VTH++  EDINKAF LLI+GK LR VIW+D+
Sbjct  358  VTHQIKLEDINKAFKLLIEGKCLRTVIWLDR  388



>ref|XP_006828005.1| hypothetical protein AMTR_s00008p00242230 [Amborella trichopoda]
 gb|ERM95421.1| hypothetical protein AMTR_s00008p00242230 [Amborella trichopoda]
Length=387

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 172/209 (82%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVG A R+A VE GSTV IFGLG++GLAVAEGAR+ GA++IIGVD+NP K
Sbjct  179  ACLLSCGISTGVGGAWRAAMVEAGSTVVIFGLGTVGLAVAEGARIQGASKIIGVDLNPQK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE G+ +G++DF+N    G+K V +V+  MT GGADYCFECVG A+L+ +A+ S R GWG
Sbjct  239  FELGQVYGLTDFINPKECGDKPVHEVVRAMTDGGADYCFECVGLASLMSDAFLSSRPGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA LS+++ E+L  GKT++GS+FGG+KPK+DIP+LA +Y   EL+L+ F+
Sbjct  299  KTIILGVEMHGAPLSISALEIL-KGKTVMGSMFGGIKPKADIPILANKYLKKELQLEGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DINKAFDL++QG+ LRC+I MD
Sbjct  358  THEVSFQDINKAFDLMLQGECLRCIIRMD  386



>gb|EMS47035.1| Alcohol dehydrogenase-like 7 [Triticum urartu]
Length=409

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 173/211 (82%), Gaps = 3/211 (1%)
 Frame = -2

Query  720  ACLLSCGVSTG--VGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINP  547
            ACLLSCGVSTG  +GAA + A VEPGS+VA+FGLG++GLAVA+G R+ GA RIIGVD+NP
Sbjct  180  ACLLSCGVSTGAGIGAAWKVAAVEPGSSVAVFGLGAVGLAVAQGCRMRGAKRIIGVDLNP  239

Query  546  DKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKG  367
            +K   GK  G++DF+N   IG K+VS+V+ EMTGGGADYCFEC+G  +++ EA+ S R G
Sbjct  240  EKCGIGKRLGITDFINPNDIGEKTVSEVVKEMTGGGADYCFECIGSTSVMAEAFQSSRMG  299

Query  366  WGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDK  187
            WGKTVVLGV    A +S+ S ++L  G++++GSLFGGLKPK+D+P+LA++Y D E+ELD+
Sbjct  300  WGKTVVLGVSNGVAPMSIPSHDILR-GRSVVGSLFGGLKPKTDVPILAQKYLDKEVELDE  358

Query  186  FVTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            FVTHE+GF DIN AF+LL+QGK LRC++WMD
Sbjct  359  FVTHEMGFHDINAAFELLVQGKCLRCILWMD  389



>ref|XP_006416200.1| hypothetical protein EUTSA_v10007878mg [Eutrema salsugineum]
 gb|ESQ34553.1| hypothetical protein EUTSA_v10007878mg [Eutrema salsugineum]
Length=389

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A+VE GSTVAIFGLG++GLAVAEGARL GAA+IIG+D+NPDK
Sbjct  180  ACLLSCGVSTGVGAAWKVADVEEGSTVAIFGLGAVGLAVAEGARLRGAAKIIGIDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DFVN    G K +S+VI EMTGGG DY FECVG A+L+ EA+ S R G G
Sbjct  240  FELGKKFGFTDFVNPTLCGEKKISEVIKEMTGGGVDYSFECVGLASLLSEAFISTRTGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG+ K  A +SL SF++L  G+++ GS+FGGLK K DIP+L   Y   EL LD F+
Sbjct  300  KTIMLGMGKHAAPISLASFDLL-KGRSICGSMFGGLKSKLDIPILVDHYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL +G+SLRC++WMDK
Sbjct  359  THELDFEEINKAFDLLEEGRSLRCILWMDK  388



>ref|XP_010320184.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X2 [Solanum lycopersicum]
Length=368

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA R A++E GS VA+FGLG++GLAV +GA+L GA++IIGVD+NP+K
Sbjct  160  ASLLSCGVSTGLGAAWRVADIEEGSIVAVFGLGAVGLAVVQGAKLRGASKIIGVDLNPEK  219

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G KS SQ+I EM+ GGADYCFEC+G A+L+QEA+   RKG G
Sbjct  220  FEIGKKFGLTDFINPTTCGEKSTSQIIKEMSDGGADYCFECIGLASLMQEAFTRSRKGTG  279

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++  G  LS+N +E L +GKT+ GS+FGG+K K DIP+ A +Y + EL LD F+
Sbjct  280  KTVILGIEMHGTPLSINPYE-LAAGKTITGSMFGGVKAKLDIPIFANQYLNNELNLDGFI  338

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLL  GK+LRC+IWM K
Sbjct  339  THEVNFEDINKAFDLLEAGKTLRCIIWMGK  368



>emb|CAA18114.1| alcohol dehydrogenase like protein [Arabidopsis thaliana]
 emb|CAB79166.1| alcohol dehydrogenase like protein [Arabidopsis thaliana]
Length=378

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + ANVE GSTVA+FGLG++GLAV EGARL GA +IIGVD+NP+K
Sbjct  170  AALLSCGVSTGIGAAWKVANVEKGSTVAVFGLGAVGLAVGEGARLRGAGKIIGVDLNPEK  229

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DF+NS   G   +S+VI EMTGGG DY FECVG  +L+ EA++S R G G
Sbjct  230  FELGKKFGFTDFINSTLCGENKISEVIKEMTGGGVDYSFECVGLPSLLTEAFSSTRTGSG  289

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+DK    +SL SF++L  G+ + GSLFGGLKPK DIP+L   Y   EL LD F+
Sbjct  290  KTVVLGIDKHLTPVSLGSFDLLR-GRHVCGSLFGGLKPKLDIPILVDHYLKKELNLDSFI  348

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL+QGKSLRC++WM+K
Sbjct  349  THELKFEEINKAFDLLVQGKSLRCILWMNK  378



>ref|XP_006284083.1| hypothetical protein CARUB_v10005213mg [Capsella rubella]
 gb|EOA16981.1| hypothetical protein CARUB_v10005213mg [Capsella rubella]
Length=332

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTGVGAA + A+VE GST+A+FGLG++GLAVAEGARL GA +IIGVD+NPDK
Sbjct  124  AALLSCGVSTGVGAAWKVADVEEGSTIAVFGLGAVGLAVAEGARLRGAGKIIGVDLNPDK  183

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N    G K +S+VI EMTG G DY FECVG  +L+ EA+ S R G G
Sbjct  184  FELGKKFGITDFINPALCGEKKISEVIKEMTGVGVDYSFECVGLHSLLTEAFNSTRTGSG  243

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG++K    +SL SF+ L  G+ + GS+FGGLKPK DIP+L + Y   EL LD F+
Sbjct  244  KTVVLGIEKDLTPISLGSFD-LFRGRHVCGSMFGGLKPKLDIPILVEHYLKKELNLDSFI  302

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL+QGKSLRCV+WMDK
Sbjct  303  THELKFEEINKAFDLLVQGKSLRCVLWMDK  332



>ref|XP_009145341.1| PREDICTED: alcohol dehydrogenase-like 1 [Brassica rapa]
Length=389

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTGVGAA + ANVE GSTVA+FGLG++GLAVAEGARL GAA+IIGVD+NPDK
Sbjct  181  AALLSCGVSTGVGAAWKVANVEEGSTVAVFGLGAVGLAVAEGARLRGAAKIIGVDLNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DFVN    G K VS+VI EMTGGG DY FECVG  +++ EA+ S R G G
Sbjct  241  FELGKKFGFTDFVNPTLCGEKKVSEVIKEMTGGGVDYSFECVGLPSILSEAFISTRTGSG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG+ K  A +SL SF++L SG+T+ GSLFGGLK K DIPVL   Y   EL LD F+
Sbjct  301  KTVMLGMGKHAAPISLGSFDLL-SGRTICGSLFGGLKSKLDIPVLVDHYLKKELNLDSFI  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F++INKAF+LL +GKSLRC+IWMDK
Sbjct  360  THELKFQEINKAFELLEEGKSLRCIIWMDK  389



>ref|XP_004238532.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X1 [Solanum lycopersicum]
Length=387

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA R A++E GS VA+FGLG++GLAV +GA+L GA++IIGVD+NP+K
Sbjct  179  ASLLSCGVSTGLGAAWRVADIEEGSIVAVFGLGAVGLAVVQGAKLRGASKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G KS SQ+I EM+ GGADYCFEC+G A+L+QEA+   RKG G
Sbjct  239  FEIGKKFGLTDFINPTTCGEKSTSQIIKEMSDGGADYCFECIGLASLMQEAFTRSRKGTG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++  G  LS+N +E L +GKT+ GS+FGG+K K DIP+ A +Y + EL LD F+
Sbjct  299  KTVILGIEMHGTPLSINPYE-LAAGKTITGSMFGGVKAKLDIPIFANQYLNNELNLDGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDINKAFDLL  GK+LRC+IWM K
Sbjct  358  THEVNFEDINKAFDLLEAGKTLRCIIWMGK  387



>gb|KDO85026.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=362

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGARLCGA RIIGVD+  +K
Sbjct  179  ACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV++FVNS   G+KSVSQ+I +MT GGADYCFECVG A+LVQEAYA CRKGWG
Sbjct  239  FEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSD  208
            KT+VLGVD+PG+QLSL+SFEVLHSGK L+GSLFGGLK KSDIP+L KRY D
Sbjct  299  KTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMD  349



>ref|NP_567645.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 ref|NP_974589.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 sp|Q0V7W6.1|ADHL5_ARATH RecName: Full=Alcohol dehydrogenase-like 5 [Arabidopsis thaliana]
 gb|ABH04561.1| At4g22110 [Arabidopsis thaliana]
 gb|AEE84551.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 gb|AEE84552.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
Length=389

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + ANVE GSTVA+FGLG++GLAV EGARL GA +IIGVD+NP+K
Sbjct  181  AALLSCGVSTGIGAAWKVANVEKGSTVAVFGLGAVGLAVGEGARLRGAGKIIGVDLNPEK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DF+NS   G   +S+VI EMTGGG DY FECVG  +L+ EA++S R G G
Sbjct  241  FELGKKFGFTDFINSTLCGENKISEVIKEMTGGGVDYSFECVGLPSLLTEAFSSTRTGSG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+DK    +SL SF++L  G+ + GSLFGGLKPK DIP+L   Y   EL LD F+
Sbjct  301  KTVVLGIDKHLTPVSLGSFDLLR-GRHVCGSLFGGLKPKLDIPILVDHYLKKELNLDSFI  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL+QGKSLRC++WM+K
Sbjct  360  THELKFEEINKAFDLLVQGKSLRCILWMNK  389



>ref|XP_006649532.1| PREDICTED: alcohol dehydrogenase-like 2-like [Oryza brachyantha]
Length=380

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 172/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG  TGVGAA R A V+PGS+VA+FGLGS+GLAV +GA++CGA++IIGVD+NPDK
Sbjct  172  ACLLSCGGGTGVGAAWRLAKVQPGSSVAVFGLGSVGLAVVQGAKMCGASKIIGVDLNPDK  231

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK+FGV+DFVN   +G KSVS+VI  MT GGA+YCFEC+G ++++ EA  S + G G
Sbjct  232  EEVGKSFGVTDFVNPSQLGEKSVSEVINAMTDGGAEYCFECIGISSVMTEAVRSTKSGKG  291

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG+++ G  L L SFE L  GK ++GSLFGG+KPK+DIP+LAK+  + ELEL+K V
Sbjct  292  KTIILGLEQDGQPLCLPSFEFLF-GKCVMGSLFGGIKPKTDIPILAKKCMNKELELEKLV  350

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  ++IN AFDLL+QGKSLRC+IWMDK
Sbjct  351  THEVDLQEINTAFDLLLQGKSLRCIIWMDK  380



>ref|XP_006658830.1| PREDICTED: alcohol dehydrogenase-like 2-like [Oryza brachyantha]
Length=390

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 173/210 (82%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VEPGS+VA+FGLG++GLAVA+GAR+ GA RIIGVD+N DK
Sbjct  173  ACLLSCGVSTGVGAAWKVAAVEPGSSVAVFGLGAVGLAVAQGARMRGAKRIIGVDLNADK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGG-GADYCFECVGQATLVQEAYASCRKGW  364
            FE GK  G++DFVN    G K+VS+VI EMTGG GADYCFEC+G A+++ EA+ S R GW
Sbjct  233  FEIGKRLGITDFVNPNDTGGKTVSEVIKEMTGGDGADYCFECIGSASVMAEAFQSSRMGW  292

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKT++LGV    A +++   ++L  G++++GSLFGG+KPK+DIP+LA++Y   ELEL++F
Sbjct  293  GKTILLGVVSNAAPIAIPPRDILR-GRSVVGSLFGGIKPKNDIPMLAQKYLHKELELEEF  351

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            VTH++GF++IN A +LL QGKSLRC+IWMD
Sbjct  352  VTHQMGFDEINGALELLTQGKSLRCIIWMD  381



>gb|KJB64120.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=386

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+N +K
Sbjct  179  ACLLSCGVSTGIGAAWKVADIEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNQEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGVS+F+N  T G K VS+VI E+T GG DY FEC+G A+L++EA+ S R  WG
Sbjct  239  FEIGKKFGVSEFINPTTCGEKKVSEVIKEITDGGVDYSFECIGLASLMEEAFNSSRVNWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+     L +N++ +L  G+T+ G  FGGLK KSDIP+LA++Y   E+ LD F+
Sbjct  299  KTVILGVEMHHTPLPINTYFLLR-GRTVTGCFFGGLKAKSDIPILAQKYLHKEINLDGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DINKAFDLL++GKSLRC+IWMD
Sbjct  358  THEVNFQDINKAFDLLLEGKSLRCIIWMD  386



>ref|XP_003561960.1| PREDICTED: alcohol dehydrogenase-like 2 [Brachypodium distachyon]
Length=387

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            AC+L CG  TGVGAA + A VEP S+VA+FGLG++GL+VA+GA++CGA++IIGVD+NPDK
Sbjct  176  ACILGCGAGTGVGAAWKLAKVEPASSVAVFGLGAVGLSVAQGAKMCGASKIIGVDLNPDK  235

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+DF+N   +G  SV +VI +MTGGGADYCFEC+G A+++ +A+ SC++G G
Sbjct  236  RELGKIFGVTDFINPSELGESSVVEVIIKMTGGGADYCFECIGLASVMTDAFRSCKQGKG  295

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV++ G  + L +FE L  GK ++GSLFGG+KPK+DIP+LA++  + ELEL+K +
Sbjct  296  KTVILGVEQDGKPICLPAFEFLF-GKCVMGSLFGGIKPKTDIPILAEKCMNKELELEKLI  354

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+  +DIN AFDLL+QGKSLRC+IWM+K
Sbjct  355  THELDLQDINTAFDLLVQGKSLRCIIWMEK  384



>gb|KJB64121.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=387

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+N +K
Sbjct  180  ACLLSCGVSTGIGAAWKVADIEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNQEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGVS+F+N  T G K VS+VI E+T GG DY FEC+G A+L++EA+ S R  WG
Sbjct  240  FEIGKKFGVSEFINPTTCGEKKVSEVIKEITDGGVDYSFECIGLASLMEEAFNSSRVNWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+     L +N++ +L  G+T+ G  FGGLK KSDIP+LA++Y   E+ LD F+
Sbjct  300  KTVILGVEMHHTPLPINTYFLLR-GRTVTGCFFGGLKAKSDIPILAQKYLHKEINLDGFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DINKAFDLL++GKSLRC+IWMD
Sbjct  359  THEVNFQDINKAFDLLLEGKSLRCIIWMD  387



>ref|XP_006363285.1| PREDICTED: alcohol dehydrogenase-like 1-like isoform X2 [Solanum 
tuberosum]
Length=387

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA R A++E GSTVAIFGLG++GLAV +GA+L GAA+IIGVD+NP+K
Sbjct  179  ASLLSCGVSTGLGAAWRVADIEEGSTVAIFGLGAVGLAVVQGAKLRGAAKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FG++DF+N  T G KS SQ+I EMT GGADYCFEC+G A+L+QEA+ S RKG G
Sbjct  239  IEIGKKFGLTDFINPTTCGEKSTSQIIKEMTDGGADYCFECIGLASLMQEAFTSSRKGTG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++  G  LS+N +E L +GKT+ GS+FGG+K K DIP+ A +Y + +L L+ F+
Sbjct  299  KTVILGIEMHGTPLSINPYE-LAAGKTITGSMFGGVKAKVDIPIFANQYLNNDLNLEGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE  FEDINKAFDLL  GK+LRC+IWM K
Sbjct  358  THEGNFEDINKAFDLLEAGKTLRCIIWMGK  387



>gb|AAM67260.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=384

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + ANVE GSTVA+FGLG++GLAV EGARL GA +IIGVD+NP+K
Sbjct  176  AALLSCGVSTGIGAAWKVANVEKGSTVAVFGLGAVGLAVGEGARLRGAGKIIGVDLNPEK  235

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG + F+N    G K +S+VI EMTGGG DY FECVG  +L+ EA++S R G G
Sbjct  236  FELGKKFGFTSFINPTLCGEKKISEVIKEMTGGGVDYSFECVGLPSLLTEAFSSTRTGSG  295

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+DK    +SL SF++L  G+ + GSLFGGLKPK DIP+L   Y   EL LD F+
Sbjct  296  KTVVLGIDKHLTPVSLGSFDLLR-GRHVCGSLFGGLKPKLDIPILVDHYLKKELNLDSFI  354

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL+QGKSLRC++WM+K
Sbjct  355  THELKFEEINKAFDLLVQGKSLRCILWMNK  384



>ref|NP_001141131.1| uncharacterized protein LOC100273217 [Zea mays]
 gb|ACF85487.1| unknown [Zea mays]
 tpg|DAA43803.1| TPA: putative alcohol dehydrogenase superfamily protein [Zea 
mays]
Length=383

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG  TGVGAA RSA VEPGSTVAIFGLGS+GLAV +GA++CGA++IIGVD+NPDK
Sbjct  173  ACLLSCGAGTGVGAAWRSAKVEPGSTVAIFGLGSVGLAVVQGAKMCGASKIIGVDLNPDK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E G++FGV+DFVN   +  +SV +VI EMTGGG DY FEC+G  +++ +A+   + G G
Sbjct  233  EEVGRSFGVTDFVNPSQLDKRSVVEVIVEMTGGGVDYSFECIGVPSVMTDAFRCTKMGKG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+ +   ++ L S E+L  G+ ++GSLFGGLKPK+ IPVLAK+  D EL+LD  V
Sbjct  293  KTIVLGLGRDSDEVCLPSLELLF-GRCVMGSLFGGLKPKTHIPVLAKKCMDKELQLDALV  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+G +DINKAFDLL+QGKSLRC++WMDK
Sbjct  352  THELGLQDINKAFDLLLQGKSLRCILWMDK  381



>gb|KFK44339.1| hypothetical protein AALP_AA1G245200 [Arabis alpina]
Length=389

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGV+TG+GA  + ANVE GSTVAIFG+G++GLAVAE ARL GAARIIGVD+NPDK
Sbjct  181  AALLSCGVATGLGAVWKVANVEEGSTVAIFGIGAVGLAVAEAARLRGAARIIGVDLNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVNS     K++SQVI EMTGGG DY FEC+G   L++EA+ S R G G
Sbjct  241  FEIGKRFGITDFVNSALCKEKTISQVIREMTGGGVDYSFECIGLEPLMEEAFLSTRTGSG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG+ K    + L S ++L  G+T+ G+LFGGLKPK DIP++  RY   EL LD F+
Sbjct  301  KTVILGMTKDILPIRLGSHDILR-GRTVCGTLFGGLKPKLDIPIIVDRYLKKELNLDGFI  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+GFE+INKAFDLL++GKS+RCV+WMD+
Sbjct  360  THELGFEEINKAFDLLMEGKSIRCVLWMDR  389



>emb|CDY00452.1| BnaC07g13740D [Brassica napus]
Length=390

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 172/211 (82%), Gaps = 2/211 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSC VSTGVGAA + A VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NPDK
Sbjct  181  AALLSCCVSTGVGAAWKVAGVEEGSTVAIFGLGAVGLAVAEGARLHGASKIIGVDLNPDK  240

Query  540  FE-RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE  GK FG++DFVN+ + G K++SQVI EMTGGG DY FEC+G A+L++EA+ S R G 
Sbjct  241  FEIVGKRFGITDFVNTASCGEKTISQVIKEMTGGGVDYSFECIGLASLMEEAFNSSRTGS  300

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LG++K  + +SL+S  +L  G+++ GSLFGGLKPK DIP+L  RY   EL LD F
Sbjct  301  GKTVILGMEKNASPISLDSRAILR-GRSVHGSLFGGLKPKLDIPILVDRYLKKELNLDGF  359

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            +THE+ FE+INKAFDLL++G S+RC++WM+K
Sbjct  360  ITHEISFEEINKAFDLLVEGNSIRCIMWMEK  390



>ref|XP_002465729.1| hypothetical protein SORBIDRAFT_01g044580 [Sorghum bicolor]
 gb|EER92727.1| hypothetical protein SORBIDRAFT_01g044580 [Sorghum bicolor]
Length=384

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG  TGVGAA R+A VEPGSTVAIFGLGS+GLAV +GA++CGA++IIGVD+NPDK
Sbjct  173  ACLLSCGAGTGVGAAWRTAKVEPGSTVAIFGLGSVGLAVVQGAKMCGASKIIGVDLNPDK  232

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
               G++FGV+DFVN   + N+SV +VI EMTGGG DY FEC+G  +++ +A+   + G G
Sbjct  233  ENVGRSFGVTDFVNPSQLDNRSVIEVIVEMTGGGVDYSFECIGVPSVMTDAFRCTKMGKG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+ +   Q+ L S E+L  G+ ++G+LFGG+KPK+DIP+LAK+  D EL+LD  V
Sbjct  293  KTIVLGLGRDSDQVCLPSLELLF-GRCVMGTLFGGMKPKTDIPILAKKCMDKELQLDALV  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+G ++IN AFDLL+QGKSLRC+IWMDK
Sbjct  352  THELGLQEINTAFDLLLQGKSLRCIIWMDK  381



>emb|CDY21362.1| BnaA09g30650D [Brassica napus]
Length=390

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -2

Query  720  ACLLSCGVST-GVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPD  544
            A LLSCGVST GVGAA + ANVE GSTVA+FGLG++GLAVAEGARL GAA+IIGVD+NPD
Sbjct  181  AALLSCGVSTAGVGAAWKVANVEEGSTVAVFGLGAVGLAVAEGARLRGAAKIIGVDLNPD  240

Query  543  KFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            KFE GK FG +DFVN    G K VS+VI EMTGGG DY FECVG  +++ EA+ S R G 
Sbjct  241  KFELGKKFGFTDFVNPTLCGEKKVSEVIKEMTGGGVDYSFECVGLPSILSEAFISTRTGS  300

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LG+ K  A +SL SF++L SG+T+ GSLFGGLK K DIPVL   Y   EL LD F
Sbjct  301  GKTVMLGMGKHAAPISLGSFDLL-SGRTICGSLFGGLKSKLDIPVLVDHYLKKELNLDSF  359

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            +THE+ F++INKAF+LL +GKSLRC+IWMDK
Sbjct  360  ITHELKFQEINKAFELLEEGKSLRCIIWMDK  390



>ref|XP_010459996.1| PREDICTED: alcohol dehydrogenase-like 1 [Camelina sativa]
Length=388

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+G A + ANVE GSTVA+FGLG++GLAVAEGARL  AA+IIG+D NPDK
Sbjct  180  AALLSCGVSTGIGGAWKVANVEEGSTVAVFGLGAVGLAVAEGARLRRAAKIIGIDTNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K +S+VI EMTGGG DY FECVG A+L+ EA+ S R G G
Sbjct  240  FELGKKFGLTDFVNPTLCGEKKISEVIKEMTGGGVDYSFECVGVASLLTEAFISTRTGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K  A +SL SF++L SG+++ GSLFGGLK K DIP+L   Y   E+ LD F+
Sbjct  300  KTVMLGMEKHAAPISLGSFDLL-SGRSICGSLFGGLKAKLDIPILLDHYLKKEINLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F++INKAFDLL +GKSLRC++WMDK
Sbjct  359  THELKFQEINKAFDLLKEGKSLRCILWMDK  388



>ref|XP_006849437.1| hypothetical protein AMTR_s00024p00046470 [Amborella trichopoda]
 gb|ERN11018.1| hypothetical protein AMTR_s00024p00046470 [Amborella trichopoda]
Length=381

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 167/209 (80%), Gaps = 2/209 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA + ANVE GSTVAIFGLG++GLAVAEGAR+ GAA+IIGVDINPDK
Sbjct  174  ACLLSCGISTGVGAAWKVANVEAGSTVAIFGLGTVGLAVAEGARVRGAAKIIGVDINPDK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N   + +K ++QV+ EMT GGADYCFEC G A+L++EA+   R GWG
Sbjct  234  FELGKQFGLTDFINPKELNDKPLNQVLKEMTNGGADYCFECAGIASLIKEAFLGSRTGWG  293

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
             TV+LGV + G  +S NSFE++ +GK L GSL GG+KPK+DIP   ++Y + EL L+ F+
Sbjct  294  LTVILGVGQ-GDSVSFNSFEII-TGKMLTGSLLGGVKPKTDIPFFGEKYLEKELRLEGFI  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ F+DINKA DLL QG  LRC+I MD
Sbjct  352  THELNFQDINKALDLLFQGIGLRCIIRMD  380



>ref|XP_010448937.1| PREDICTED: alcohol dehydrogenase-like 5 isoform X3 [Camelina 
sativa]
Length=388

 Score =   270 bits (689),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 162/210 (77%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTGVGAA + A+VE GST+A+FGLG++GLAVAEGARL GA +IIGVD+NPDK
Sbjct  180  AALLSCGVSTGVGAAWKVADVEEGSTIAVFGLGTVGLAVAEGARLRGAGKIIGVDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DF+N    G K +S+VI EMT GG DY FECVG  +L+ EA+ S R G G
Sbjct  240  FELGKKFGVTDFINPALCGEKKISEVIKEMTRGGVDYSFECVGLPSLLTEAFNSTRTGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+DK     SL   + L  G+ + GS+FGGLKPK DIP+L   Y   EL LD F+
Sbjct  300  KTVVLGIDKDLTPTSLGCLD-LFRGRHICGSMFGGLKPKLDIPILVDHYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL+QGKSLRC++WMDK
Sbjct  359  THELKFEEINKAFDLLVQGKSLRCILWMDK  388



>ref|XP_006413691.1| hypothetical protein EUTSA_v10025421mg [Eutrema salsugineum]
 gb|ESQ55144.1| hypothetical protein EUTSA_v10025421mg [Eutrema salsugineum]
Length=390

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTGVGAA + A+VE GST+A+FGLG++GLAV EGARL GAA+IIGVD+NP K
Sbjct  182  AILLSCGVSTGVGAAWKVADVEEGSTIAVFGLGAVGLAVGEGARLRGAAKIIGVDLNPKK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DFVN    G + +S+VI E+TGGG DY FEC+G  +++ EA+ S R G G
Sbjct  242  FELGKKFGFTDFVNPTFCGEQKISEVIKEITGGGVDYSFECIGLTSVLSEAFTSTRTGTG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+DK     +L+SF+ L  GK + GSLFGGLKPK DIP+L  RY   EL LD F+
Sbjct  302  KTIVLGIDKHLEPTNLDSFD-LFRGKHVCGSLFGGLKPKLDIPILVNRYLKKELNLDSFI  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL QGKSLRC++WMDK
Sbjct  361  THELNFEEINKAFDLLEQGKSLRCILWMDK  390



>ref|XP_002890513.1| hypothetical protein ARALYDRAFT_472482 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66772.1| hypothetical protein ARALYDRAFT_472482 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + ANVE GSTVA+FGLG++GLAVAEGARL GAA+IIG+D NPDK
Sbjct  180  AALLSCGVSTGIGAAWKVANVEEGSTVAVFGLGAVGLAVAEGARLRGAAKIIGIDTNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DF+N    G K VS+V+ EMT GG DY FECVG A+L+ EA+ S R G G
Sbjct  240  FELGKKFGFTDFINPTLCGEKKVSEVVKEMTKGGVDYSFECVGLASLLNEAFISTRTGTG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K  A +SL SF++L  G+ + GSLFGGLK K DIP+L   Y   EL LD F+
Sbjct  300  KTVMLGMEKHAAPISLGSFDLLR-GRNICGSLFGGLKSKLDIPILVDHYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F++INKAF LL +GKSLRC++WMDK
Sbjct  359  THELNFKEINKAFALLEEGKSLRCILWMDK  388



>ref|XP_004985403.1| PREDICTED: alcohol dehydrogenase-like 2-like [Setaria italica]
Length=376

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG STGVGAA + A VEPGS+V IFGLGSIGLAVA+GA++CGA++IIGVD+NPDK
Sbjct  168  ACLLSCGASTGVGAAWKVAKVEPGSSVVIFGLGSIGLAVAQGAKMCGASKIIGVDLNPDK  227

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK+FGV+ FVN   +GN SVS+ I ++TGGGADY FEC+G ++++ +A+ S + G G
Sbjct  228  EEVGKSFGVTHFVNPSQLGNSSVSEEIGKLTGGGADYGFECIGVSSVMTDAFTSTKPGKG  287

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG +K    +SL S ++L SGK ++GS FGG+KPK+D+P+LA++  + ELEL+  V
Sbjct  288  KTIILGFEKNNEPISLPSLDLL-SGKCVMGSYFGGMKPKTDVPILAQKCMNKELELEGLV  346

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG ++IN+AF+LL+QGKSLRC+IWMDK
Sbjct  347  THEVGLQEINQAFNLLLQGKSLRCLIWMDK  376



>ref|XP_006416199.1| hypothetical protein EUTSA_v10007889mg [Eutrema salsugineum]
 gb|ESQ34552.1| hypothetical protein EUTSA_v10007889mg [Eutrema salsugineum]
Length=387

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LL CGVSTGVGAA + A+VE GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NPDK
Sbjct  179  AALLGCGVSTGVGAAWKVADVEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPDK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN      K++S+V+ EMT GG DY FEC+G A+L++EA+ S R G G
Sbjct  239  FEIGKRFGITDFVNPALYKEKTISEVVKEMTKGGVDYSFECIGLASLMEEAFNSTRTGSG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K    +SL S+++L  G+T+ G+LFGGLKPK DIP+L  RY   EL LD F+
Sbjct  299  KTVILGMEKYKLPVSLGSYDLLR-GRTICGTLFGGLKPKLDIPILVDRYLKKELNLDGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAF+L ++G S+RCV+WMDK
Sbjct  358  THELSFEEINKAFNLSMEGNSIRCVLWMDK  387



>emb|CDX79124.1| BnaA01g11910D [Brassica napus]
Length=363

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA ++A++E GSTVA+FGLG++GLAV EGARL GAA+IIG+DINPDK
Sbjct  155  AVLLSCGVSTGIGAAWKTADIEEGSTVAVFGLGAVGLAVGEGARLRGAAQIIGIDINPDK  214

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F  GK FG +DFVN    G+K +S+VI ++ GGG DY FECVG  +++ EA+ S R G G
Sbjct  215  FALGKEFGFTDFVNPTLCGDKKISEVIKKIAGGGVDYSFECVGITSVLSEAFISTRTGTG  274

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV LG++ P A   L+SF+ L  GK + GSLFGGLKPK DIPVL  RY   EL LD F+
Sbjct  275  KTVALGIN-PAAPTELHSFD-LFRGKHVCGSLFGGLKPKLDIPVLVDRYLKKELNLDSFI  332

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAFDLL +GKSLRC++WMDK
Sbjct  333  THELKFEDINKAFDLLEKGKSLRCILWMDK  362



>gb|KHG05239.1| hypothetical protein F383_30798 [Gossypium arboreum]
Length=386

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+N +K
Sbjct  179  ACLLSCGISTGIGAAWKVADIEEGSTVAIFGLGTVGLAVAEGARLRGASKIIGVDLNQEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV++F+N  T G K +S+VI E T GGADYCFEC+G A+L+++A+ S R  WG
Sbjct  239  IEIGKQFGVTEFINPTTCGEKKISEVIKEKTDGGADYCFECIGLASLMEDAFNSSRVNWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++     L +N+  +L  G+++ G LFGGLKPKSDIP LA++Y   EL LD F+
Sbjct  299  KTVILGLEMHRTPLPVNT-SLLLRGRSVTGCLFGGLKPKSDIPFLAQKYLHKELNLDGFI  357

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEVGF DINKAFDLL++GKSLRC+I MD
Sbjct  358  THEVGFGDINKAFDLLLEGKSLRCIIRMD  386



>emb|CDY04816.1| BnaC05g17730D [Brassica napus]
Length=390

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 165/210 (79%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVST-GVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPD  544
            A LLSCGVST GVGAA + ANVE GSTVA+FGLG++GLA AEGARL GAA+IIGVD+NPD
Sbjct  181  AALLSCGVSTAGVGAAWKVANVEEGSTVAVFGLGAVGLAAAEGARLRGAAKIIGVDLNPD  240

Query  543  KFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            KFE GK FG +DFVN    G K VS+VI EMTGGG DY FECVG  +++ EA+ S R G 
Sbjct  241  KFELGKKFGFTDFVNPTLCGEKKVSEVIKEMTGGGVDYSFECVGLPSILSEAFISTRTGS  300

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LG+ K  A +SL SF++L SG+T+ GSLFGGLK K DIPVL   Y   EL LD F
Sbjct  301  GKTVMLGMGKHAAPISLGSFDLL-SGRTICGSLFGGLKSKLDIPVLVDHYLKKELNLDSF  359

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            +THE+ F++INKAF+LL +GK+LRC+IWMD
Sbjct  360  ITHELKFQEINKAFELLEEGKTLRCIIWMD  389



>emb|CDX82904.1| BnaC01g13540D [Brassica napus]
Length=389

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 163/210 (78%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA R+A++E GSTVA+FGLG++GLAV EGARL GAA+IIG+DINPDK
Sbjct  181  AVLLSCGVSTGIGAAWRTADIEEGSTVAVFGLGAVGLAVGEGARLRGAAQIIGIDINPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F  GK FG +DFVN    G+K +S+VI E+ GGG DY FECVG  +++ EA+ S R G G
Sbjct  241  FAIGKKFGFTDFVNPTLCGDKKISEVIKEIAGGGVDYSFECVGITSVLSEAFLSTRTGTG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV LG++ P A   L+SF  L  GK + GSLFGGLKPK DIP+L  RY   EL LD F+
Sbjct  301  KTVALGIN-PAAPTELDSFG-LFRGKHVCGSLFGGLKPKLDIPILVDRYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAFDLL +GKSLRC++WMDK
Sbjct  359  THELKFEDINKAFDLLEKGKSLRCILWMDK  388



>ref|XP_010459997.1| PREDICTED: alcohol dehydrogenase-like 2 [Camelina sativa]
Length=388

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LL C VSTGVGA  + A+VE GSTVAIFGLG++GLAVAEG RL GAA++IGVD+NPDK
Sbjct  180  AALLGCCVSTGVGAVWKVADVEEGSTVAIFGLGAVGLAVAEGVRLRGAAKVIGVDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K  SQVI +MT GG DY FEC+G A+L++EA+ S R GWG
Sbjct  240  FEIGKQFGITDFVNPALCGEKKTSQVINDMTEGGVDYSFECIGLASLMEEAFNSTRPGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+++    +SL S+++L  G+T+ G+LFGGLKPK DIP+L  RY   EL LD  +
Sbjct  300  KTVVLGMEQKAMPISLGSYDLLR-GRTICGTLFGGLKPKLDIPILVDRYLKKELNLDGLI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ FE+INKAFDLL +G ++RC++WMD
Sbjct  359  THELKFEEINKAFDLLTEGNTIRCILWMD  387



>gb|EMS47036.1| Alcohol dehydrogenase-like 7 [Triticum urartu]
Length=492

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A VEPGS+VA+FGLG +GLAVA+G R+ GA +IIGVD+NP+K
Sbjct  148  ACLLSCGVSTGVGAAWKVAAVEPGSSVAVFGLGVVGLAVAQGCRMRGAKQIIGVDLNPEK  207

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             + GK  G++DF+N    G K+VS+V+ EMTGGGADYCFEC+G  + + EA+ S RKGWG
Sbjct  208  RDIGKRLGITDFINPNDTGEKAVSEVVKEMTGGGADYCFECIGSTSAMAEAFQSSRKGWG  267

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGV   GA +S+   ++L  G++++GSLFGGLKPK+DIP+LA++Y D ELELD+FV
Sbjct  268  KTIVLGVSSGGAPMSIPPHDILW-GRSVVGSLFGGLKPKTDIPILAQKYLDEELELDEFV  326

Query  180  THEVGFEDINKAFDLLIQGKSLR  112
            THE+GF+DIN AF+LL QGK LR
Sbjct  327  THEMGFDDINAAFELLTQGKCLR  349



>ref|XP_009135576.1| PREDICTED: alcohol dehydrogenase-like 5 [Brassica rapa]
Length=389

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA ++A++E GSTVA+FGLG++GLAV EGARL GAA+IIG+DINPDK
Sbjct  181  AVLLSCGVSTGIGAAWKTADIEEGSTVAVFGLGAVGLAVGEGARLRGAAQIIGIDINPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            F  GK FG +DFVN    G+K +S+VI ++ GGG DY FECVG  +++ EA+ S R G G
Sbjct  241  FALGKEFGFTDFVNPTLCGDKKISEVIKKIAGGGVDYSFECVGITSVLSEAFISTRTGTG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV LG++ P A   L+SF+ L  GK + GSLFGGLKPK DIPVL  RY   EL LD F+
Sbjct  301  KTVALGIN-PAAPTELHSFD-LFRGKHVCGSLFGGLKPKLDIPVLVDRYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FEDINKAFDLL +GKSLRC++WMDK
Sbjct  359  THELKFEDINKAFDLLEKGKSLRCILWMDK  388



>gb|KJB64122.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=383

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 167/209 (80%), Gaps = 4/209 (2%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+N +K
Sbjct  179  ACLLSCGVSTGIGAAWKVADIEEGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNQEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGVS+F+N  T G K   +VI E+T GG DY FEC+G A+L++EA+ S R  WG
Sbjct  239  FEIGKKFGVSEFINPTTCGEK---KVIKEITDGGVDYSFECIGLASLMEEAFNSSRVNWG  295

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LGV+     L +N++ +L  G+T+ G  FGGLK KSDIP+LA++Y   E+ LD F+
Sbjct  296  KTVILGVEMHHTPLPINTYFLLR-GRTVTGCFFGGLKAKSDIPILAQKYLHKEINLDGFI  354

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV F+DINKAFDLL++GKSLRC+IWMD
Sbjct  355  THEVNFQDINKAFDLLLEGKSLRCIIWMD  383



>ref|NP_173659.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 ref|NP_001031079.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 sp|Q9SK86.1|ADHL1_ARATH RecName: Full=Alcohol dehydrogenase-like 1 [Arabidopsis thaliana]
 gb|AAF18534.1|AC006551_20 Very similar to alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAM13113.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAM91221.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE30240.1| alcohol dehydrogenase-like 1 [Arabidopsis thaliana]
 gb|AEE30241.1| alcohol dehydrogenase-like 1 [Arabidopsis thaliana]
Length=388

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+GAA + ANVE GST+AIFGLG++GLAVAEGARL GAA+IIG+D N DK
Sbjct  180  AALLSCGVSTGIGAAWKVANVEEGSTIAIFGLGAVGLAVAEGARLRGAAKIIGIDTNSDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DF+N    G K +S+VI EMT GG DY FECVG A+L+ EA+ S R G G
Sbjct  240  FELGKKFGFTDFINPTLCGEKKISEVIKEMTEGGVDYSFECVGLASLLNEAFISTRTGTG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K  A +SL SF++L  G+ + GSLFGGLK K DIP+L   Y   EL LD F+
Sbjct  300  KTVMLGMEKHAAPISLGSFDLLR-GRVICGSLFGGLKSKLDIPILVDHYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F++INKAF LL +GKSLRC++WMDK
Sbjct  359  THELNFKEINKAFALLEEGKSLRCILWMDK  388



>ref|XP_004162243.1| PREDICTED: alcohol dehydrogenase-like 2-like [Cucumis sativus]
Length=398

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 168/212 (79%), Gaps = 1/212 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A L  CGV TG+GAA   A+V+ GSTVAIFGLG++GLAVAEG++   A++IIG+D+NP+K
Sbjct  182  APLFGCGVPTGIGAAWNVADVDEGSTVAIFGLGTVGLAVAEGSKRRKASKIIGIDLNPNK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV+DF+N  T G+K++ +VI E T GGADYCFEC+G A+L++EA  S ++GWG
Sbjct  242  FEIAKKFGVTDFINPATCGDKAIHEVIKEETDGGADYCFECIGLASLMEEAIKSTKEGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K V+LGV+K GA   +NSFE++ +G T+ G+LFGGLKPKSD+P+L  +Y   EL LD+ +
Sbjct  302  KAVILGVEKDGAAFKVNSFEII-NGITITGALFGGLKPKSDVPMLINKYLHKELNLDELI  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK*F  85
            +HEV FEDINKAFDLL+ GKSLRC+IW+D  F
Sbjct  361  SHEVEFEDINKAFDLLLSGKSLRCLIWIDHGF  392



>ref|XP_010064576.1| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 7 
[Eucalyptus grandis]
Length=335

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL+ CGVSTGVGAA R+A+VE GSTVAIFGLGSIGLAVAEGARLCGAARIIGVD NPDK
Sbjct  111  ACLIGCGVSTGVGAAWRTASVEAGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDTNPDK  170

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG +DFVN+    NK++SQVI EMTGGGADYCFE VG A+LV EAYA  RKGWG
Sbjct  171  FEIGKKFGATDFVNAGNCDNKALSQVINEMTGGGADYCFESVGLASLVHEAYACGRKGWG  230

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSD  208
            KTVVLGVD+PG+QL+ +S +VLHSGK+L+GSLFGGLK KSDIP+L +RY D
Sbjct  231  KTVVLGVDRPGSQLTFSSCDVLHSGKSLMGSLFGGLKSKSDIPILLRRYVD  281



>ref|XP_004152752.1| PREDICTED: alcohol dehydrogenase-like 2-like [Cucumis sativus]
 gb|KGN62708.1| hypothetical protein Csa_2G369090 [Cucumis sativus]
Length=398

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 168/212 (79%), Gaps = 1/212 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A L  CGV TG+GAA   A+V+ GSTVAIFGLG++GLAVAEG++   A++IIG+D+NP+K
Sbjct  182  APLFGCGVPTGIGAAWNVADVDEGSTVAIFGLGTVGLAVAEGSKRRKASKIIGIDLNPNK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV+DF+N  T G+K++ +VI E T GGADYCFEC+G A+L++EA  S ++GWG
Sbjct  242  FEIAKKFGVTDFINPATCGDKAIHEVIKEETDGGADYCFECIGLASLMEEAIKSTKEGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K V+LGV+K GA   +NSFE++ +G T+ G+LFGGLKPKSD+P+L  +Y   EL LD+ +
Sbjct  302  KAVILGVEKDGAAFKVNSFEII-NGITITGALFGGLKPKSDVPMLINKYLHKELNLDELI  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK*F  85
            +HEV FEDINKAFDLL+ GKSLRC+IW+D  F
Sbjct  361  SHEVEFEDINKAFDLLLSGKSLRCLIWIDHGF  392



>ref|XP_010448935.1| PREDICTED: alcohol dehydrogenase-like 5 isoform X1 [Camelina 
sativa]
Length=390

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 162/212 (76%), Gaps = 3/212 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAV--AEGARLCGAARIIGVDINP  547
            A LLSCGVSTGVGAA + A+VE GST+A+FGLG++GLAV  AEGARL GA +IIGVD+NP
Sbjct  180  AALLSCGVSTGVGAAWKVADVEEGSTIAVFGLGTVGLAVSVAEGARLRGAGKIIGVDLNP  239

Query  546  DKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKG  367
            DKFE GK FGV+DF+N    G K +S+VI EMT GG DY FECVG  +L+ EA+ S R G
Sbjct  240  DKFELGKKFGVTDFINPALCGEKKISEVIKEMTRGGVDYSFECVGLPSLLTEAFNSTRTG  299

Query  366  WGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDK  187
             GKTVVLG+DK     SL   + L  G+ + GS+FGGLKPK DIP+L   Y   EL LD 
Sbjct  300  SGKTVVLGIDKDLTPTSLGCLD-LFRGRHICGSMFGGLKPKLDIPILVDHYLKKELNLDS  358

Query  186  FVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            F+THE+ FE+INKAFDLL+QGKSLRC++WMDK
Sbjct  359  FITHELKFEEINKAFDLLVQGKSLRCILWMDK  390



>ref|XP_010266957.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X2 [Nelumbo nucifera]
Length=375

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 156/210 (74%), Gaps = 32/210 (15%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCG+STGVGAA+++A VE GSTVAIFGLG+IGLAVAEGARLCGA+RI+GVD+NP+K
Sbjct  198  ACLLSCGISTGVGAALKTAKVEAGSTVAIFGLGAIGLAVAEGARLCGASRIVGVDVNPNK  257

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DF+N    G++ +S+                                GWG
Sbjct  258  FEIGKKFGVTDFINPKECGSRRISE--------------------------------GWG  285

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGVDKPG QLS++S+E+LH GK L+GSLFG +K KSDIP+L  RY D ELELDKFV
Sbjct  286  KTIVLGVDKPGTQLSISSYEILHHGKCLMGSLFGDIKAKSDIPLLLNRYMDKELELDKFV  345

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV FEDIN AFDLLI GKS+R VIWMDK
Sbjct  346  THEVHFEDINTAFDLLIHGKSIRSVIWMDK  375



>ref|XP_010675994.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676000.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 167/209 (80%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TG+GA  + A VE GSTVAIFGLG++GL   + A+L GAA+IIGVD+NP+K
Sbjct  182  ACLLSCGVTTGIGAVWKVAQVEEGSTVAIFGLGAVGLGAVQAAKLQGAAKIIGVDLNPEK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
               G+ FGV+DF++  + G K +S+ I E+T GGADYCFEC+G AT++Q+A+ S R+GWG
Sbjct  242  EGIGRKFGVTDFIDPKSCGEKKISEAIKELTDGGADYCFECIGSATVMQDAFESTRQGWG  301

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            +T++LG +  G  LSLN  +++  GK++IGS+FGG+KPKSDIPVL ++Y + EL LD+++
Sbjct  302  QTIILGAEVRGIPLSLNCLDIIQ-GKSVIGSIFGGIKPKSDIPVLTQKYMNEELCLDEYI  360

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV   DINKAF+ L+QG+SLRC+IWMD
Sbjct  361  THEVKLHDINKAFEYLVQGQSLRCIIWMD  389



>ref|XP_002890514.1| hypothetical protein ARALYDRAFT_472484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66773.1| hypothetical protein ARALYDRAFT_472484 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGV+TG+GAA + A+VE GSTVAIFGLG++GLAVAEG RL GA +IIGVD+NP K
Sbjct  180  AALLSCGVATGIGAAWKVADVEEGSTVAIFGLGAVGLAVAEGVRLRGATKIIGVDLNPAK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK +G++DFVN    G K++S+VI EMT  GADY FEC+G A+L++EA+ S R G G
Sbjct  240  FEIGKRYGMTDFVNPALCGEKTISEVIREMTEVGADYSFECIGLASLMEEAFNSTRPGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG+++    +SL S+++L  G+T+ G+LFGGLKPK DIP+L  RY   EL LD  +
Sbjct  300  KTVILGMEQKALPVSLGSYDLLR-GRTICGTLFGGLKPKLDIPILVDRYLKKELNLDGLI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL +G S+RCV+WMDK
Sbjct  359  THELSFEEINKAFDLLAEGNSIRCVVWMDK  388



>ref|NP_001049223.1| Os03g0189600 [Oryza sativa Japonica Group]
 gb|ABF94388.1| oxidoreductase, zinc-binding dehydrogenase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11137.1| Os03g0189600 [Oryza sativa Japonica Group]
 dbj|BAG88176.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89916.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58468.1| hypothetical protein OsJ_09718 [Oryza sativa Japonica Group]
Length=379

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL C   TGVGAA R A V+PGS+V +FGLGS+GLAV +GA++CGA +IIGVD+NP+K
Sbjct  171  ACLLGCCGGTGVGAAWRLAKVQPGSSVVVFGLGSVGLAVVQGAKMCGATKIIGVDLNPNK  230

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+DFVN   +G+KSVS+VI  MT GGADY FEC+G ++++ EA  S + G G
Sbjct  231  EEVGKEFGVTDFVNPSQLGDKSVSEVINAMTDGGADYSFECIGISSVMTEAVRSTKSGRG  290

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+K    L L SFE L  GK ++GSLFGG KPK+DIP+LA++  + ELEL+K V
Sbjct  291  KTIILGVEKDSQPLCLPSFEFLF-GKCVMGSLFGGAKPKTDIPILAEKCMNKELELEKLV  349

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG  +IN AFDLL+QGKSLRC+IWMDK
Sbjct  350  THEVGLTEINTAFDLLLQGKSLRCIIWMDK  379



>ref|XP_009110138.1| PREDICTED: alcohol dehydrogenase-like 2 [Brassica rapa]
Length=389

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSC VS+GVGAA + A+VE GSTVAIFGLG +GLA AEGARL GAA+IIGVD+NPDK
Sbjct  181  AALLSCCVSSGVGAAWKVADVEEGSTVAIFGLGGVGLAAAEGARLRGAAKIIGVDLNPDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K +SQVI EMT GG DY FEC+G  +L++EA+ S R G G
Sbjct  241  FEIGKRFGITDFVNPALSGEKKISQVIKEMTEGGVDYSFECIGLTSLMEEAFNSTRTGSG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K    +SL S ++L  G+T+ G+LFGGLKPK DIP+L   Y   EL L+ F+
Sbjct  301  KTVILGMEKQMLPISLGSHDLLR-GRTICGTLFGGLKPKVDIPILVDSYLKRELNLNGFI  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAFDLL++G+++RCV+WMDK
Sbjct  360  THELSFEEINKAFDLLVKGETIRCVLWMDK  389



>ref|XP_010498712.1| PREDICTED: alcohol dehydrogenase-like 2 [Camelina sativa]
Length=388

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LL C VSTGVGA  + A+VE GSTVAIFGLG++GLAVAEGARL GAA++IGVD+NPDK
Sbjct  180  AALLGCCVSTGVGAVWKVADVEEGSTVAIFGLGAVGLAVAEGARLRGAAKVIGVDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K  SQVI +MT GG DY FEC+G A+L++EA+ S R G G
Sbjct  240  FEIGKQFGITDFVNPALCGEKKTSQVINDMTEGGVDYSFECIGLASLMEEAFNSTRPGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+++    +SL S+++L  G+T+ G+LFGG+KPK DIP+L  RY   EL LD  +
Sbjct  300  KTVVLGMEQKAMPISLGSYDLLR-GRTICGTLFGGMKPKLDIPILVDRYLKKELNLDGLI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ FE+INKAFDLL +G ++RC++WMD
Sbjct  359  THEIKFEEINKAFDLLAEGNTIRCILWMD  387



>ref|XP_010477503.1| PREDICTED: alcohol dehydrogenase-like 2 [Camelina sativa]
Length=388

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LL C VSTGVGA  + A+VE GSTVAIFGLG++GLAVAEGARL GAA++IGVD+NPDK
Sbjct  180  AALLGCCVSTGVGAVWKVADVEEGSTVAIFGLGAVGLAVAEGARLRGAAKVIGVDLNPDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K  SQVI +MT GG DY FEC+G A+L++EA+ S R G G
Sbjct  240  FEIGKKFGITDFVNPALCGEKKTSQVINDMTEGGVDYSFECIGLASLMEEAFNSTRPGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG+++    +SL S+++L  G+T+ G+LFGGLKPK DIP+L  RY   EL LD  +
Sbjct  300  KTVVLGMEQKAMPISLGSYDLLR-GRTICGTLFGGLKPKLDIPILVDRYLKKELNLDGLI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THE+ FE+INKAFDLL +G ++RC++WMD
Sbjct  359  THELKFEEINKAFDLLAEGNTIRCILWMD  387



>gb|EEC74659.1| hypothetical protein OsI_10323 [Oryza sativa Indica Group]
Length=379

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL C   TGVGAA R A V+PGS+V +FGLGS+GLAV +GA++CGA +IIGVD+NP+K
Sbjct  171  ACLLGCCGGTGVGAAWRLAKVQPGSSVVVFGLGSVGLAVVQGAKMCGATKIIGVDLNPNK  230

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+DFVN   +G+KSVS+VI  MT GGADY FEC+G ++++ EA  S + G G
Sbjct  231  EEVGKEFGVTDFVNPSQLGDKSVSEVINAMTDGGADYSFECIGISSVMSEAVRSTKSGRG  290

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+K    L L SFE L  GK ++GSLFGG KPK+DIP+LA++  + ELEL+K V
Sbjct  291  KTIILGVEKDSQPLCLPSFEFLF-GKCVMGSLFGGAKPKTDIPILAEKCMNKELELEKLV  349

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG  +IN AF+LL+QGKSLRC+IWMDK
Sbjct  350  THEVGLTEINTAFNLLLQGKSLRCIIWMDK  379



>ref|XP_008444855.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Cucumis melo]
Length=388

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A L  CGV TG+GAA   A+V+ GSTVAIFGLG++GLAVAEG++   A++IIG+D NP+K
Sbjct  180  AALFGCGVPTGIGAAWNVADVDEGSTVAIFGLGTVGLAVAEGSKHRKASKIIGIDSNPNK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV++F+N  T G+K++ +VI E T GGADYCFECVG A+L++EA  S R+GWG
Sbjct  240  FEIAKKFGVTNFINPATCGDKAIHEVIKEETDGGADYCFECVGLASLMEEAIKSSREGWG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            K V+LGV+K G   ++NSFE++ +G T+ GSLFGGLKPKSD+P+L  +Y   EL LD  +
Sbjct  300  KAVILGVEKDGRPFTVNSFEII-NGITITGSLFGGLKPKSDLPMLIDKYLHKELYLDGLI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            +HEV FEDINKAFDLLI G+SLRC+IW+D
Sbjct  359  SHEVEFEDINKAFDLLIYGRSLRCLIWID  387



>ref|XP_006305040.1| hypothetical protein CARUB_v10009406mg [Capsella rubella]
 gb|EOA37938.1| hypothetical protein CARUB_v10009406mg [Capsella rubella]
Length=388

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LL C VSTGVGA  + A+VE GSTVAIFGLG++GLAVAEGARL GAARIIGVD+NP+K
Sbjct  180  AALLGCCVSTGVGAVWKVADVEKGSTVAIFGLGAVGLAVAEGARLRGAARIIGVDLNPEK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K  SQVI +MT GG DY FEC+G ++ ++EA+ S R G G
Sbjct  240  FEIGKQFGITDFVNPTLCGEKKTSQVINDMTEGGVDYSFECIGLSSSMEEAFNSTRPGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTVVLG++K    +SL S+++L  G+T+ G+LFGGLKPK DIP+L  RY   EL LD  +
Sbjct  300  KTVVLGMEKDAMPISLGSYDLLR-GRTVCGTLFGGLKPKLDIPILVDRYLKKELNLDGLI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAF+LL +G S+RC++WMDK
Sbjct  359  THELKFEEINKAFELLAEGSSIRCILWMDK  388



>gb|AAN64148.1| Putative alcohol dehydrogenase [Oryza sativa Japonica Group]
Length=306

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 160/210 (76%), Gaps = 18/210 (9%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCG +TGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CG             
Sbjct  115  ASLLSCGATTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICG-------------  161

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV+ F+N   +G+K VSQ I EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  162  ----KKFGVTHFINPQELGDKPVSQAIIEMTDGGADYCFECIGLASVMSDAFRSSREGWG  217

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA LS+ S E+L+ GK ++GSLFGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  218  KTIILGVEMHGAPLSIPSLEILN-GKCVMGSLFGGVKPKQDIPILADKYLNKELELDKFI  276

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV  +DIN AFDLL+QGKSLRC IWMDK
Sbjct  277  THEVPLKDINTAFDLLLQGKSLRCTIWMDK  306



>emb|CDX91678.1| BnaC08g05970D [Brassica napus]
Length=390

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 166/211 (79%), Gaps = 2/211 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSC VSTGVGAA + ANVE GSTVAIFGLG++GLAVAEGARL GAA+IIGVD+NPDK
Sbjct  181  AALLSCCVSTGVGAAWKVANVEEGSTVAIFGLGAVGLAVAEGARLRGAAKIIGVDLNPDK  240

Query  540  FE-RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE  GK FG++DFVN    G K +SQVI EMT GG DY FEC+G  + ++EA+ S R G 
Sbjct  241  FEIVGKRFGITDFVNPALSGEKKISQVIKEMTEGGVDYSFECIGLTSSMEEAFNSTRTGS  300

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LG++K    +SL S ++L  G+T+ G+LFGGLKPK DIP+L   Y   EL L+ F
Sbjct  301  GKTVILGMEKQMLPISLGSHDLLR-GRTICGTLFGGLKPKLDIPILVDSYLKKELNLNGF  359

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            +THE+ FE+INKAFDLL++G+++RCV+WMDK
Sbjct  360  ITHELSFEEINKAFDLLVKGETIRCVLWMDK  390



>ref|XP_010477502.1| PREDICTED: alcohol dehydrogenase-like 1 [Camelina sativa]
Length=388

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCGVSTG+G A + ANV+ GSTVA+FGLG++GLAVAEGARL  AA+IIGVD N DK
Sbjct  180  AALLSCGVSTGIGGAWKVANVDEGSTVAVFGLGAVGLAVAEGARLRRAAKIIGVDTNSDK  239

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K +S+VI +MTGGG DY FECVG A+L+ EA+ S R G G
Sbjct  240  FELGKKFGLTDFVNPTLCGEKKISEVIKKMTGGGVDYSFECVGVASLLTEAFNSTRPGSG  299

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LG++K  A +SL SF++L +G+++ GSLFGGLK K DI +L   Y   EL LD F+
Sbjct  300  KTIMLGMEKHAAPISLGSFDLL-TGRSICGSLFGGLKAKLDIHILLDHYLKKELNLDSFI  358

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ F++INKAFDLL +GKSLRC++WMDK
Sbjct  359  THELKFQEINKAFDLLKEGKSLRCILWMDK  388



>ref|NP_173660.1| alcohol dehydrogenase-like 2 [Arabidopsis thaliana]
 sp|Q9SK87.1|ADHL2_ARATH RecName: Full=Alcohol dehydrogenase-like 2 [Arabidopsis thaliana]
 gb|AAF18533.1|AC006551_19 Very similar to alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAT71918.1| At1g22440 [Arabidopsis thaliana]
 gb|AAU15136.1| At1g22440 [Arabidopsis thaliana]
 gb|AEE30242.1| alcohol dehydrogenase-like 2 [Arabidopsis thaliana]
Length=386

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 164/210 (78%), Gaps = 1/210 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSC V+TG+GAA + A+VE GSTV IFGLG++GLAVAEG RL GAA+IIGVD+NP K
Sbjct  178  AALLSCSVATGLGAAWKVADVEEGSTVVIFGLGAVGLAVAEGVRLRGAAKIIGVDLNPAK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DFVN    G K++S+VI EMT  GADY FEC+G A+L++EA+ S R G G
Sbjct  238  FEIGKRFGITDFVNPALCGEKTISEVIREMTDVGADYSFECIGLASLMEEAFKSTRPGSG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLG+++    +SL S+++L  G+T+ G+LFGGLKPK DIP+L  RY   EL L+  +
Sbjct  298  KTIVLGMEQKALPISLGSYDLLR-GRTVCGTLFGGLKPKLDIPILVDRYLKKELNLEDLI  356

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THE+ FE+INKAF LL +G S+RC+IWMDK
Sbjct  357  THELSFEEINKAFHLLAEGNSIRCIIWMDK  386



>emb|CDP01100.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 32/241 (13%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVA--------------------  601
            ACLLSCGV+TGVGA +++A +E GSTVAIFGLG++GLAVA                    
Sbjct  178  ACLLSCGVTTGVGATMKAAQIEEGSTVAIFGLGTVGLAVALVLAFNSLIFCSCISILRSH  237

Query  600  -----------EGARLCGAARIIGVDINPDKFERGKTFGVSDFVNSLTIGNKSVSQVICE  454
                       EGAR+ GA++IIG+D N +KFE  K FGV+DFVN  + G  SVSQVI E
Sbjct  238  LISLKLIRTVAEGARIRGASKIIGIDKNLEKFEIAKKFGVTDFVNPTSCGKDSVSQVIRE  297

Query  453  MTGGGADYCFECVGQATLVQEAYASCRKGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLI  274
            MT GGADYCFECVG  +L++EA+   R+G GKTV+LG D  G+ LS++  E+L +GK+++
Sbjct  298  MTDGGADYCFECVGSTSLIREAFDGSRQGCGKTVILGADLHGSPLSIHPLEIL-AGKSIM  356

Query  273  GSLFGGLKPKSDIPVLAKRYSDGELELDKFVTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            G+  GG+KPK DIP LA++Y   EL LD F+THEV FE+INKAFDLL+QGKSLRC+IWM+
Sbjct  357  GATLGGIKPKQDIPHLAQKYLKKELRLDGFITHEVNFEEINKAFDLLLQGKSLRCIIWMN  416

Query  93   K  91
            +
Sbjct  417  R  417



>emb|CDY41481.1| BnaA08g20830D [Brassica napus]
Length=390

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 166/211 (79%), Gaps = 2/211 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSC VS+GVGAA + A+VE GSTVAIFGLG +GLAVAEGARL GAARIIGVD+NPDK
Sbjct  181  AALLSCCVSSGVGAAWKVADVEEGSTVAIFGLGGVGLAVAEGARLRGAARIIGVDLNPDK  240

Query  540  FE-RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE  GK FG++DFVN    G K +SQVI EMT GG D+ FEC+G  +L++EA+ S R G 
Sbjct  241  FEIVGKRFGITDFVNPALSGEKKISQVIKEMTEGGVDHSFECIGLTSLMEEAFNSTRTGS  300

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV+LG++K    +SL S ++L  G+T+ G+LFGGLKPK DIP+L   Y   EL L+ F
Sbjct  301  GKTVILGMEKQMLPISLGSHDLLR-GRTICGTLFGGLKPKLDIPILVDSYLKRELNLNGF  359

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            +THE+ FE+INKAFDLL++G+++RCV+WMDK
Sbjct  360  ITHELSFEEINKAFDLLVKGETIRCVLWMDK  390



>ref|XP_010448936.1| PREDICTED: alcohol dehydrogenase-like 5 isoform X2 [Camelina 
sativa]
Length=389

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 161/212 (76%), Gaps = 4/212 (2%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAV--AEGARLCGAARIIGVDINP  547
            A LLSCGVST VGAA + A+VE GST+A+FGLG++GLAV  AEGARL GA +IIGVD+NP
Sbjct  180  AALLSCGVST-VGAAWKVADVEEGSTIAVFGLGTVGLAVSVAEGARLRGAGKIIGVDLNP  238

Query  546  DKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKG  367
            DKFE GK FGV+DF+N    G K +S+VI EMT GG DY FECVG  +L+ EA+ S R G
Sbjct  239  DKFELGKKFGVTDFINPALCGEKKISEVIKEMTRGGVDYSFECVGLPSLLTEAFNSTRTG  298

Query  366  WGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDK  187
             GKTVVLG+DK     SL   + L  G+ + GS+FGGLKPK DIP+L   Y   EL LD 
Sbjct  299  SGKTVVLGIDKDLTPTSLGCLD-LFRGRHICGSMFGGLKPKLDIPILVDHYLKKELNLDS  357

Query  186  FVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            F+THE+ FE+INKAFDLL+QGKSLRC++WMDK
Sbjct  358  FITHELKFEEINKAFDLLVQGKSLRCILWMDK  389



>gb|KEH35716.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=328

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A+VE G+TVAIFGLG++GLAVA  A+  GA++IIGVD+N DK
Sbjct  119  ACLLSCGVSTGIGAAWKVADVEKGTTVAIFGLGAVGLAVAVAAKQRGASKIIGVDLNHDK  178

Query  540  FERGKTFGVSDFVNSLTIGN-KSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE GK FG++DFVN  +  N KSVS+VI +MT GGADYCFEC+G A+L+ EA+ S R+GW
Sbjct  179  FEIGKQFGITDFVNPSSTSNEKSVSEVIKDMTNGGADYCFECIGLASLMTEAFNSSREGW  238

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV++GV+  G+ L+LN +++L  GKT+ GSLFGGLKPKSD+P+LA++Y D EL LD F
Sbjct  239  GKTVIIGVEMHGSPLTLNPYDIL-KGKTITGSLFGGLKPKSDLPLLAQKYLDKELNLDGF  297

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            ++ EV F+DINKAFD L+QGKS+RC+I MD
Sbjct  298  ISQEVDFKDINKAFDYLLQGKSIRCIIRMD  327



>ref|XP_006405265.1| hypothetical protein EUTSA_v10028276mg, partial [Eutrema salsugineum]
 gb|ESQ46718.1| hypothetical protein EUTSA_v10028276mg, partial [Eutrema salsugineum]
Length=402

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 158/221 (71%), Gaps = 35/221 (16%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAV-------AEGARLCGAARIIG  562
            ACLLSCGVSTGVGAA  +A VE GSTV IFGLGSIGLAV       AEGARLCGA+RIIG
Sbjct  198  ACLLSCGVSTGVGAAWETAKVEKGSTVVIFGLGSIGLAVKSQFQVVAEGARLCGASRIIG  257

Query  561  VDINPDKFE------------RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFEC  418
            VDINP KF+             GK FGV++FVNS T  NK VS+VI EMT GGADYCFEC
Sbjct  258  VDINPAKFQIVSINCSEIHLFVGKKFGVNEFVNSKTCENKRVSEVINEMTCGGADYCFEC  317

Query  417  VGQATLVQEAYASCRKGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSD  238
            VG ++LVQEAYA CRK                + L+SF+VLH GKTL+GS+FGGLK K+ 
Sbjct  318  VGSSSLVQEAYACCRK----------------ICLDSFDVLHHGKTLVGSMFGGLKAKTH  361

Query  237  IPVLAKRYSDGELELDKFVTHEVGFEDINKAFDLLIQGKSL  115
            IP+L K Y D ELELDKFVTHE+ FEDIN AF LLI+GK +
Sbjct  362  IPILLKYYLDNELELDKFVTHEMKFEDINDAFQLLIEGKCI  402



>gb|KEH35713.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=384

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A+VE G+TVAIFGLG++GLAVA  A+  GA++IIGVD+N DK
Sbjct  175  ACLLSCGVSTGIGAAWKVADVEKGTTVAIFGLGAVGLAVAVAAKQRGASKIIGVDLNHDK  234

Query  540  FERGKTFGVSDFVNSLTIGN-KSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE GK FG++DFVN  +  N KSVS+VI +MT GGADYCFEC+G A+L+ EA+ S R+GW
Sbjct  235  FEIGKQFGITDFVNPSSTSNEKSVSEVIKDMTNGGADYCFECIGLASLMTEAFNSSREGW  294

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV++GV+  G+ L+LN +++L  GKT+ GSLFGGLKPKSD+P+LA++Y D EL LD F
Sbjct  295  GKTVIIGVEMHGSPLTLNPYDIL-KGKTITGSLFGGLKPKSDLPLLAQKYLDKELNLDGF  353

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            ++ EV F+DINKAFD L+QGKS+RC+I MD
Sbjct  354  ISQEVDFKDINKAFDYLLQGKSIRCIIRMD  383



>ref|XP_003602833.1| Alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AES73084.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=391

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A+VE G+TVAIFGLG++GLAVA  A+  GA++IIGVD+N DK
Sbjct  182  ACLLSCGVSTGIGAAWKVADVEKGTTVAIFGLGAVGLAVAVAAKQRGASKIIGVDLNHDK  241

Query  540  FERGKTFGVSDFVNSLTIGN-KSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE GK FG++DFVN  +  N KSVS+VI +MT GGADYCFEC+G A+L+ EA+ S R+GW
Sbjct  242  FEIGKQFGITDFVNPSSTSNEKSVSEVIKDMTNGGADYCFECIGLASLMTEAFNSSREGW  301

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV++GV+  G+ L+LN +++L  GKT+ GSLFGGLKPKSD+P+LA++Y D EL LD F
Sbjct  302  GKTVIIGVEMHGSPLTLNPYDIL-KGKTITGSLFGGLKPKSDLPLLAQKYLDKELNLDGF  360

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            ++ EV F+DINKAFD L+QGKS+RC+I MD
Sbjct  361  ISQEVDFKDINKAFDYLLQGKSIRCIIRMD  390



>ref|XP_004985404.1| PREDICTED: alcohol dehydrogenase-like 5-like [Setaria italica]
Length=383

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 164/213 (77%), Gaps = 4/213 (2%)
 Frame = -2

Query  720  ACLLSCGVST---GVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDIN  550
            ACLLSCG  T   GVGAA R A VEPGS+VAIFGLGS+GLAVA+GA++CGA++IIGVD+N
Sbjct  172  ACLLSCGAGTDEPGVGAAWRLAKVEPGSSVAIFGLGSVGLAVAQGAKMCGASKIIGVDLN  231

Query  549  PDKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRK  370
            PDK E GK FGV+DFVN   +   SVS VI EMTGGG D  FECVG  +++ +A+ S ++
Sbjct  232  PDKEEVGKAFGVTDFVNPTQLDKSSVSGVIGEMTGGGVDCSFECVGVPSVMTDAFRSTKQ  291

Query  369  GWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELD  190
            G GKT++LG+ K   QL + + E+L  GK +IGS  GG+KPK+DIP+LA++  + ELELD
Sbjct  292  GNGKTIILGLGKETDQLCVPALELLF-GKCVIGSALGGIKPKTDIPILAEKCMNKELELD  350

Query  189  KFVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
              VTHEVG  +IN AFDLL+QGKSLRC+IWM K
Sbjct  351  GLVTHEVGLREINTAFDLLLQGKSLRCIIWMGK  383



>emb|CDP09729.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 162/243 (67%), Gaps = 33/243 (14%)
 Frame = -2

Query  720  ACLLSCGVSTGVGA----------------------AIRSANVEPGSTVAIFGLGSIGLA  607
            ACLL CGVSTG                         ++++A+VE GSTVAIFGLG IGLA
Sbjct  178  ACLLGCGVSTGNAICFDSCWHNLIHFELVRRTYFTFSVKTADVEEGSTVAIFGLGVIGLA  237

Query  606  VAEGARLCGAARIIGVDINPDKFERGKTFGVSDFVNSLTIGNKSVSQ----------VIC  457
            VAEGARL GA  IIGVD+NPDK E GK FGV+ F+N   +G K  +           VI 
Sbjct  238  VAEGARLRGAKTIIGVDMNPDKVEIGKKFGVTHFINPRELGGKLATTTLENAVFCIAVIL  297

Query  456  EMTGG-GADYCFECVGQATLVQEAYASCRKGWGKTVVLGVDKPGAQLSLNSFEVLHSGKT  280
            EMT G GADYCFECVG  +L QEA+  CRKGWGKT++LGVDKP +Q  LNS    HSGKT
Sbjct  298  EMTDGLGADYCFECVGLPSLSQEAFTCCRKGWGKTIILGVDKPDSQFILNSLVNNHSGKT  357

Query  279  LIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTHEVGFEDINKAFDLLIQGKSLRCVIW  100
            + G  +GGLKP  DI +LAKRY D EL+LD FVTHE+  EDINKAF LLI+GK LR VIW
Sbjct  358  ITGVQYGGLKPNLDIAILAKRYLDKELQLDLFVTHEIKLEDINKAFKLLIEGKCLRTVIW  417

Query  99   MDK  91
            +D+
Sbjct  418  LDQ  420



>ref|XP_004501693.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X1 [Cicer 
arietinum]
Length=389

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 171/209 (82%), Gaps = 1/209 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A+VE GSTVAIFGLG++GLAVA  A+  GA++IIGVD+N DK
Sbjct  181  ACLLSCGVSTGVGAAWKVADVEKGSTVAIFGLGAVGLAVAVAAKQRGASKIIGVDLNQDK  240

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FGV+DFVN  +  +KSVS+VI +MT GGADYCFEC+G A+L+ EA+ S R+GWG
Sbjct  241  FEIGKQFGVTDFVNPSSCNDKSVSEVIKDMTDGGADYCFECIGLASLMAEAFNSSREGWG  300

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV++GV+  G+ LS++S+ +L  G+T+ GSLFGG KPK+DIP+LA +Y D EL LD FV
Sbjct  301  KTVIIGVEMHGSPLSVSSYSIL-KGRTITGSLFGGFKPKTDIPLLANKYLDKELNLDGFV  359

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            + EV F+DINKAFD L+QG ++RC+I MD
Sbjct  360  SQEVDFKDINKAFDYLLQGNTIRCIIRMD  388



>gb|EEE58467.1| hypothetical protein OsJ_09715 [Oryza sativa Japonica Group]
Length=329

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 157/200 (79%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            A LLSCG +TGVGAA + A VEPGS+VAIFGLG++GLAVAEGAR+CGA+ IIGVD+NP+K
Sbjct  117  ASLLSCGATTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASTIIGVDLNPEK  176

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
             E GK FGV+ F+N   +G+K VSQ I EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  177  HELGKKFGVTHFINPQELGDKPVSQAIIEMTDGGADYCFECIGLASVMSDAFRSSREGWG  236

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT++LGV+  GA LS+ S E+L +GK ++GSLFGG+KPK DIP+LA +Y + ELELDKF+
Sbjct  237  KTIILGVEMHGAPLSIPSLEIL-NGKCVMGSLFGGVKPKQDIPILADKYLNKELELDKFI  295

Query  180  THEVGFEDINKAFDLLIQGK  121
            THEV  +   +      +G+
Sbjct  296  THEVPLKTSTRHLTFCCRGR  315



>gb|EMS67661.1| Alcohol dehydrogenase-like 2 [Triticum urartu]
Length=446

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 164/222 (74%), Gaps = 13/222 (6%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CG  TGVGAA R A V+PGS+V IFGLG++GL+VA+GA++CGAA+IIGVD+NPDK
Sbjct  223  ACLLGCGAGTGVGAAWRLAKVQPGSSVVIFGLGAVGLSVAQGAKMCGAAKIIGVDLNPDK  282

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQ------------VICEMTGGGADYCFECVGQATLV  397
             E GK     D         +  +Q            VI EMTGGGADYCFEC+G A+++
Sbjct  283  EELGKEKIRRDRFREPVKTRREPTQPVVLISLLDKVQVIIEMTGGGADYCFECIGSASVM  342

Query  396  QEAYASCRKGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKR  217
             EA+ S ++G GKTV+LG++K G  +SL S E L  GK ++GSLFGG+KPK+DIP+LA++
Sbjct  343  TEAFRSAKQGNGKTVILGLEKDGKPISLPSIEFLF-GKCVMGSLFGGMKPKTDIPILAEK  401

Query  216  YSDGELELDKFVTHEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
              + ELEL+K +THEVG ++IN AFDLL+QGKSLRC+IWMDK
Sbjct  402  CMNKELELEKLITHEVGLQEINTAFDLLLQGKSLRCIIWMDK  443



>ref|XP_004501694.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X2 [Cicer 
arietinum]
Length=390

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 171/210 (81%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA + A+VE GSTVAIFGLG++GLAVA  A+  GA++IIGVD+N DK
Sbjct  181  ACLLSCGVSTGVGAAWKVADVEKGSTVAIFGLGAVGLAVAVAAKQRGASKIIGVDLNQDK  240

Query  540  FER-GKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGW  364
            FE  GK FGV+DFVN  +  +KSVS+VI +MT GGADYCFEC+G A+L+ EA+ S R+GW
Sbjct  241  FENTGKQFGVTDFVNPSSCNDKSVSEVIKDMTDGGADYCFECIGLASLMAEAFNSSREGW  300

Query  363  GKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKF  184
            GKTV++GV+  G+ LS++S+ +L  G+T+ GSLFGG KPK+DIP+LA +Y D EL LD F
Sbjct  301  GKTVIIGVEMHGSPLSVSSYSIL-KGRTITGSLFGGFKPKTDIPLLANKYLDKELNLDGF  359

Query  183  VTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            V+ EV F+DINKAFD L+QG ++RC+I MD
Sbjct  360  VSQEVDFKDINKAFDYLLQGNTIRCIIRMD  389



>ref|XP_006386151.1| hypothetical protein POPTR_0002s01480g [Populus trichocarpa]
 gb|ERP63948.1| hypothetical protein POPTR_0002s01480g [Populus trichocarpa]
Length=445

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTGVGAA R+ANVE GSTV IFGLGSIGLAVAEGAR+ GA +IIGVD+N +K
Sbjct  178  ACLLSCGVSTGVGAAWRTANVEAGSTVVIFGLGSIGLAVAEGARISGATKIIGVDVNQEK  237

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE  K FGV+DFVN    G+K VSQVI EMTGGGADYCFECVG  +L+++AYA CRKGWG
Sbjct  238  FEIAKKFGVTDFVNVGECGDKPVSQVINEMTGGGADYCFECVGLVSLMEQAYACCRKGWG  297

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSD  208
            KT++LGV+KP +++SL   +VL SGKTL G+LFGGLK KSDIP+L KRY D
Sbjct  298  KTIILGVEKPESRVSLPCADVLQSGKTLTGALFGGLKAKSDIPILLKRYMD  348



>ref|XP_010676005.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=385

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 160/209 (77%), Gaps = 11/209 (5%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+TG+GA  + A VE GSTVAIFGLG++GL   + A+L GAA+IIGVD+NP+K
Sbjct  182  ACLLSCGVTTGIGAVWKVAQVEEGSTVAIFGLGAVGLGAVQAAKLQGAAKIIGVDLNPEK  241

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                      + ++  + G K +S+ I E+T GGADYCFEC+G AT++Q+A+ S R+GWG
Sbjct  242  ----------EGIDPKSCGEKKISEAIKELTDGGADYCFECIGSATVMQDAFESTRQGWG  291

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            +T++LG +  G  LSLN  +++  GK++IGS+FGG+KPKSDIPVL ++Y + EL LD+++
Sbjct  292  QTIILGAEVRGIPLSLNCLDIIQ-GKSVIGSIFGGIKPKSDIPVLTQKYMNEELCLDEYI  350

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            THEV   DINKAF+ L+QG+SLRC+IWMD
Sbjct  351  THEVKLHDINKAFEYLVQGQSLRCIIWMD  379



>gb|KJB11813.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=341

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 146/210 (70%), Gaps = 47/210 (22%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACL  C ++TGVGAA + ANVE GSTV IFGLGSIGLAV +                   
Sbjct  179  ACLFGCCIATGVGAACKVANVEAGSTVVIFGLGSIGLAVVK-------------------  219

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                                        EMTGGGADYCFECVG A+LVQEAYASCRKGWG
Sbjct  220  ----------------------------EMTGGGADYCFECVGLASLVQEAYASCRKGWG  251

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KT+VLGV KPG+QLSL+SFEVLHSGKTL G+LFGG+K KSD+P+L KRY+D EL++D+FV
Sbjct  252  KTIVLGVQKPGSQLSLSSFEVLHSGKTLTGALFGGVKAKSDLPLLLKRYTDNELQVDEFV  311

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEV F+DIN+AF+LL+ GK +RCVIWMDK
Sbjct  312  THEVKFQDINRAFELLMGGKCIRCVIWMDK  341



>gb|EMT16703.1| Alcohol dehydrogenase-like protein 7 [Aegilops tauschii]
Length=419

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANV----EPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDI  553
            ACLLSCGVST    A R+ +V       +T  +       L VA+G R+ GA RIIGVD+
Sbjct  180  ACLLSCGVSTARKLA-RAPDVLVAVSQYTTPHVSNQCQSVLQVAQGCRMRGAKRIIGVDL  238

Query  552  NPDKFERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCR  373
            NP+K + GK  G++DF+N   IG ++VS+V+ EMTGGGADYCFEC+G  +++ EA+ S R
Sbjct  239  NPEKRDIGKRLGITDFINPNDIGERTVSEVVKEMTGGGADYCFECIGSTSVMAEAFQSSR  298

Query  372  KGWGKTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELEL  193
            KGWGKTVVLGV    A +S+ S ++L  G++++GSLFGGLKPK+DIP+LA++Y D ELEL
Sbjct  299  KGWGKTVVLGVSNGVAPMSIPSHDIL-MGRSVVGSLFGGLKPKADIPILAQKYVDKELEL  357

Query  192  DKFVTHEVGFEDINKAFDLLIQGKSLRCVIWMD  94
            D+FVTHE+GF DIN AFDLL QGK LRC+IWMD
Sbjct  358  DEFVTHEMGFNDINAAFDLLTQGKCLRCIIWMD  390



>gb|EMT04315.1| Alcohol dehydrogenase-like protein 2 [Aegilops tauschii]
Length=365

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 152/210 (72%), Gaps = 23/210 (11%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CG  TGVGAA R A V+PGS+V IFGLG++GL+VA+G                  
Sbjct  176  ACLLGCGAGTGVGAAWRLAKVQPGSSVVIFGLGAVGLSVAQG------------------  217

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV+DFVN   +G   +SQVI EMTGGGADYCFEC+G A+++ EA+ S ++G G
Sbjct  218  ----KKFGVTDFVNPSKLGESPLSQVIIEMTGGGADYCFECIGVASVMTEAFRSAKQGNG  273

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
            KTV+LG++K G  +SL S E L  GK ++GSLFGG+KPK+DIP+LAK+    ELEL+K +
Sbjct  274  KTVILGLEKDGKPISLPSIEFLF-GKCVMGSLFGGIKPKTDIPILAKKCMSKELELEKLI  332

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            THEVG ++IN AFDLL+QGKSLRC+IWMDK
Sbjct  333  THEVGLQEINTAFDLLLQGKSLRCIIWMDK  362



>gb|KJB26825.1| hypothetical protein B456_004G262400 [Gossypium raimondii]
Length=267

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 151/207 (73%), Gaps = 2/207 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A++  GS V IFGLG++GLAVA+GA+L GA++IIGVDINP+K+
Sbjct  61   CLLSCGVAAGLGAAWNVADISKGSIVVIFGLGTVGLAVAQGAKLRGASQIIGVDINPEKY  120

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ K FGV+DF+N     N+ + QVI  ++GGG DY FEC+G   +V  A  SC  GWG 
Sbjct  121  EKAKCFGVTDFLNPNEY-NEPIQQVIKRISGGGTDYSFECIGNTGMVTTALQSCCDGWGL  179

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   +++ + +    SGKTL GSLFGG KPKSD+P L  +Y + E+++D+F+T
Sbjct  180  TVTLGVPKTNPEIA-SHYSAFLSGKTLKGSLFGGWKPKSDLPSLVNKYMNREIQVDEFIT  238

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWM  97
            H + FEDINKAF L+ +GK LRCVI M
Sbjct  239  HNLPFEDINKAFTLMREGKCLRCVIHM  265



>ref|XP_007018720.1| GroES-like zinc-binding dehydrogenase family protein isoform 
4 [Theobroma cacao]
 gb|EOY15945.1| GroES-like zinc-binding dehydrogenase family protein isoform 
4 [Theobroma cacao]
Length=369

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A++E GSTVAIFGLG++GLAVAEGARL GA++IIGVD+NP+K
Sbjct  179  ACLLSCGVSTGIGAAWKVADIEGGSTVAIFGLGAVGLAVAEGARLRGASKIIGVDLNPEK  238

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GKTFGV+DF+N  T G K VS+VI EMT GGADYCFEC+G A+L+++A+ S R+GWG
Sbjct  239  FEIGKTFGVTDFINPATCGEKKVSEVIKEMTDGGADYCFECIGLASLMEDAFNSNREGWG  298

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSD  208
            KTV+LGV+K G  L+LN++ +L  G+++ G LFGG KPKSDIP+LA++Y D
Sbjct  299  KTVILGVEKHGTPLALNTYLLLR-GRSVTGCLFGGFKPKSDIPLLAEKYLD  348



>dbj|BAK06008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCG S G+GAA   A+V  GS+V IFGLG++GL+VA+GA+L GA++IIGVD NPDK 
Sbjct  178  CLLSCGASAGLGAAWNVADVSKGSSVVIFGLGTVGLSVAQGAKLRGASKIIGVDTNPDKQ  237

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+GK FGV+DF+N   + N+ V QV+  +T GGADY FECVG   +V  A  SC  GWG 
Sbjct  238  EKGKAFGVTDFINPAEL-NEPVQQVVKRLTDGGADYSFECVGDTGVVSTALQSCSDGWGL  296

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +L SG+TL GSLFGG +PKSDIP+L ++Y++ E+++D  VT
Sbjct  297  TVTLGVPKAKPEVSAH-YGLLLSGRTLKGSLFGGWRPKSDIPLLVEKYTNKEIQIDDLVT  355

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F DINKA +L+++ + LRCVI M K
Sbjct  356  HDMPFSDINKALELMLENRCLRCVIHMAK  384



>dbj|BAD25091.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD25889.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAG87839.1| unnamed protein product [Oryza sativa Japonica Group]
Length=255

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS G+GAA + A++  GS+V IFGLG++GL+VA+GA+L GA+ IIGVD NP+K 
Sbjct  49   CLLSCGVSAGLGAAWKVADISKGSSVVIFGLGTVGLSVAQGAKLRGASIIIGVDTNPEKQ  108

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+GK FGV+DF+N   + N+ V QV+  +T GGADY FECVG   +V  A  SC  GWG 
Sbjct  109  EKGKAFGVTDFINPEEL-NEPVQQVVKRLTNGGADYSFECVGDTGVVSTALQSCSDGWGL  167

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +L SG+TL GSLFGG +PKSD+P+L  +Y++ E+++D  VT
Sbjct  168  TVTLGVPKAKPEVSAH-YALLLSGRTLKGSLFGGWRPKSDLPLLVDKYANKEIQVDDLVT  226

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F+ INKA +L+++ K LRCVI M +
Sbjct  227  HDLSFDYINKALELMLENKCLRCVIHMPQ  255



>ref|XP_002263525.1| PREDICTED: alcohol dehydrogenase-like 6 [Vitis vinifera]
 emb|CBI26407.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 152/209 (73%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS G+GAA + AN+  GSTV IFGLG++GL+VA+GA+  GA+RIIGVDIN +K 
Sbjct  173  CLLSCGVSAGLGAAWKVANITEGSTVVIFGLGTVGLSVAQGAKQRGASRIIGVDINSEKM  232

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ K FG+++FVN     N+ V QVI +MT GGADY FEC+G   +V  A  SC  GWG 
Sbjct  233  EKAKAFGITEFVNPHDC-NEPVQQVIKQMTDGGADYSFECIGDTGMVTTALQSCCDGWGL  291

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  SG+TL GSLFGG +PKSD+  L   Y   E+++D+F+T
Sbjct  292  TVTLGVPKVNPEIS-SHYGLFLSGRTLRGSLFGGWRPKSDLHSLVDMYMRKEIQIDEFIT  350

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + FEDINKAFDL+++GK LRCVI M K
Sbjct  351  HNLPFEDINKAFDLMMEGKCLRCVIHMPK  379



>gb|KJB26827.1| hypothetical protein B456_004G262400 [Gossypium raimondii]
Length=374

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 151/207 (73%), Gaps = 2/207 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A++  GS V IFGLG++GLAVA+GA+L GA++IIGVDINP+K+
Sbjct  168  CLLSCGVAAGLGAAWNVADISKGSIVVIFGLGTVGLAVAQGAKLRGASQIIGVDINPEKY  227

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ K FGV+DF+N     N+ + QVI  ++GGG DY FEC+G   +V  A  SC  GWG 
Sbjct  228  EKAKCFGVTDFLNPNEY-NEPIQQVIKRISGGGTDYSFECIGNTGMVTTALQSCCDGWGL  286

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   +++ + +    SGKTL GSLFGG KPKSD+P L  +Y + E+++D+F+T
Sbjct  287  TVTLGVPKTNPEIA-SHYSAFLSGKTLKGSLFGGWKPKSDLPSLVNKYMNREIQVDEFIT  345

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWM  97
            H + FEDINKAF L+ +GK LRCVI M
Sbjct  346  HNLPFEDINKAFTLMREGKCLRCVIHM  372



>ref|XP_010421318.1| PREDICTED: alcohol dehydrogenase-like 6 isoform X2 [Camelina 
sativa]
 ref|XP_010421319.1| PREDICTED: alcohol dehydrogenase-like 6 isoform X3 [Camelina 
sativa]
Length=384

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+IIGVDINP K 
Sbjct  178  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQIIGVDINPAKA  237

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS    ++ +SQVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  238  EQAKTFGVTDFINS-NDHSEPISQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  296

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  +GK+L G+LFGG KPKSDIP L ++Y + E+ +D+ VT
Sbjct  297  TVTLGVPKMKPEVSAH-YGLFLAGKSLKGTLFGGWKPKSDIPSLIEKYMNKEIMIDELVT  355

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWM  97
            H + F+DINKAFDL+ +GK LRCV+ M
Sbjct  356  HNLAFDDINKAFDLMREGKCLRCVLHM  382



>gb|KJB26824.1| hypothetical protein B456_004G262400 [Gossypium raimondii]
Length=380

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 151/207 (73%), Gaps = 2/207 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A++  GS V IFGLG++GLAVA+GA+L GA++IIGVDINP+K+
Sbjct  174  CLLSCGVAAGLGAAWNVADISKGSIVVIFGLGTVGLAVAQGAKLRGASQIIGVDINPEKY  233

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ K FGV+DF+N     N+ + QVI  ++GGG DY FEC+G   +V  A  SC  GWG 
Sbjct  234  EKAKCFGVTDFLNPNEY-NEPIQQVIKRISGGGTDYSFECIGNTGMVTTALQSCCDGWGL  292

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   +++ + +    SGKTL GSLFGG KPKSD+P L  +Y + E+++D+F+T
Sbjct  293  TVTLGVPKTNPEIA-SHYSAFLSGKTLKGSLFGGWKPKSDLPSLVNKYMNREIQVDEFIT  351

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWM  97
            H + FEDINKAF L+ +GK LRCVI M
Sbjct  352  HNLPFEDINKAFTLMREGKCLRCVIHM  378



>ref|XP_006472567.1| PREDICTED: alcohol dehydrogenase-like 2-like [Citrus sinensis]
Length=379

 Score =   230 bits (587),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGVSTG+GAA + A VE GSTVAIFGLG++GL+VAEGAR+ GA RIIGVD+NP+K
Sbjct  186  ACLLSCGVSTGLGAAWKVAEVEEGSTVAIFGLGAVGLSVAEGARIRGATRIIGVDLNPEK  245

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            FE GK FG++DF+N  T G+K+VSQVI EMT GGADYCFEC+G A+++ +A+ S R+GWG
Sbjct  246  FETGKKFGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLASVMNDAFNSSREGWG  305

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSD  208
            KTV+LGV+  G+ +SLNS E+L  G+++ G+ FGGLKPKSDI  LA++Y D
Sbjct  306  KTVILGVEMHGSPISLNSIEIL-KGRSVCGTFFGGLKPKSDIATLAQKYLD  355



>ref|XP_006647577.1| PREDICTED: alcohol dehydrogenase-like 6-like [Oryza brachyantha]
Length=380

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS G+GAA + A++  GSTV IFGLG++GL+VA+GA+L GA+ IIGVD NP+K 
Sbjct  174  CLLSCGVSAGLGAAWKVADISEGSTVVIFGLGTVGLSVAQGAKLRGASIIIGVDTNPEKQ  233

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
             +GK FG++DF+N   + N+ V QV+  +T GGADY FECVG   +V  A  SC  GWG 
Sbjct  234  AKGKAFGITDFINPENL-NEPVQQVVKRLTNGGADYSFECVGDTGVVSTALQSCSDGWGL  292

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +L SG+TL GSLFGG KPKSD+P+L  +Y++ E+++D  VT
Sbjct  293  TVTLGVPKAKPEVSAH-YALLLSGRTLKGSLFGGWKPKSDLPLLVDKYANKEIQVDGLVT  351

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F DINKAF+L+++ + LRCV+ M +
Sbjct  352  HDMPFSDINKAFELMLENRCLRCVVHMPQ  380



>ref|XP_010421317.1| PREDICTED: alcohol dehydrogenase-like 6 isoform X1 [Camelina 
sativa]
Length=410

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+IIGVDINP K 
Sbjct  204  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQIIGVDINPAKA  263

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS    ++ +SQVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  264  EQAKTFGVTDFINS-NDHSEPISQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  322

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  +GK+L G+LFGG KPKSDIP L ++Y + E+ +D+ VT
Sbjct  323  TVTLGVPKMKPEVSAH-YGLFLAGKSLKGTLFGGWKPKSDIPSLIEKYMNKEIMIDELVT  381

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWM  97
            H + F+DINKAFDL+ +GK LRCV+ M
Sbjct  382  HNLAFDDINKAFDLMREGKCLRCVLHM  408



>ref|XP_004953221.1| PREDICTED: alcohol dehydrogenase-like 6-like isoform X1 [Setaria 
italica]
Length=384

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 153/209 (73%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS G+GAA   A+V  GS+V IFGLG++GL+VA+GA+L GA++IIGVD NP+K 
Sbjct  178  CLLSCGVSAGLGAAWNVADVSEGSSVVIFGLGTVGLSVAQGAKLRGASKIIGVDTNPEKQ  237

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+GK FGV+DF+N   + ++ V QVI  MT GGADY FECVG   +V  A  SC  GWG 
Sbjct  238  EKGKAFGVTDFINPNEL-SEPVQQVIKRMTDGGADYSFECVGDTGVVSTALQSCSDGWGV  296

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + +  L SG+TL GSLFGG +PKSD+P L  +Y+D E+++D  VT
Sbjct  297  TVTLGVPKAKPEVSAH-YAFLLSGRTLKGSLFGGWRPKSDLPSLVNKYADKEIQVDGLVT  355

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F DIN+A +L+++ K LRCVI M +
Sbjct  356  HDIPFGDINRALELMLESKCLRCVIHMSQ  384



>ref|XP_006287936.1| hypothetical protein CARUB_v10001171mg [Capsella rubella]
 gb|EOA20834.1| hypothetical protein CARUB_v10001171mg [Capsella rubella]
Length=382

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+IIGVDINP K 
Sbjct  176  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQIIGVDINPAKA  235

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS    ++ +SQVI  MT GGAD+ FECVG   +   A  SC  GWG 
Sbjct  236  EQAKTFGVTDFINSNDY-SEHISQVIKRMTEGGADFSFECVGDTGIATTALQSCSDGWGM  294

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S++ + +  SGK+L G+LFGG KPKSDIP L ++Y + E+ +D+ VT
Sbjct  295  TVTLGVPKVKPEVSVH-YGLFLSGKSLKGTLFGGWKPKSDIPSLIEKYMNKEIMIDELVT  353

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + F+DIN+AFDL+  GK LRCV+ M K
Sbjct  354  HNLAFDDINEAFDLMRDGKCLRCVLHMPK  382



>ref|XP_007209256.1| hypothetical protein PRUPE_ppa007260mg [Prunus persica]
 gb|EMJ10455.1| hypothetical protein PRUPE_ppa007260mg [Prunus persica]
Length=376

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 151/206 (73%), Gaps = 2/206 (1%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            +LSCGVSTGVGAA  +ANV+  STVAIFGLGS+GLAVAEGAR  GA++IIGVDINPDKF 
Sbjct  173  MLSCGVSTGVGAAWNTANVQAASTVAIFGLGSVGLAVAEGARARGASKIIGVDINPDKFI  232

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
            +G+  GV+DF+N    G K + + I E+T GG DY FEC+G   +++EA+ S  +GWG T
Sbjct  233  KGQAMGVTDFINPDEPG-KPLHERIREITDGGVDYSFECIGNLDVLREAFLSTHEGWGFT  291

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            VVLG+      L L+  E+ H G+ +IGS+FGG K KS +P  A+    G ++LDKF+TH
Sbjct  292  VVLGIHPTPKMLPLHPMELFH-GRGIIGSVFGGFKGKSQLPHFAQECMHGVVDLDKFITH  350

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWM  97
            E+ FE IN AF LLI+GKSLRCV+ +
Sbjct  351  ELPFEKINDAFQLLIEGKSLRCVLQL  376



>gb|EAY86827.1| hypothetical protein OsI_08208 [Oryza sativa Indica Group]
Length=381

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS G+GAA + A++  GS+V IFGLG++GL+VA+GA+L  A+ IIGVD NP+K 
Sbjct  175  CLLSCGVSAGLGAAWKVADISKGSSVVIFGLGTVGLSVAQGAKLRRASIIIGVDTNPEKQ  234

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+GK FGV+DF+N   + N+ V QV+  +T GGADY FECVG   +V  A  SC  GWG 
Sbjct  235  EKGKAFGVTDFINPEEL-NEPVQQVVKRLTNGGADYSFECVGDTGVVSTALQSCSDGWGL  293

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +L SG+TL GSLFGG +PKSD+P+L  +Y++ E+++D  VT
Sbjct  294  TVTLGVPKAKPEVSAH-YALLLSGRTLKGSLFGGWRPKSDLPLLVDKYANKEIQVDDLVT  352

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F+DINKA +L+++ K LRCVI M +
Sbjct  353  HDLSFDDINKALELMLENKCLRCVIHMPQ  381



>ref|NP_001047528.1| Os02g0637700 [Oryza sativa Japonica Group]
 dbj|BAD25090.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD25888.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF09442.1| Os02g0637700 [Oryza sativa Japonica Group]
 gb|EAZ23931.1| hypothetical protein OsJ_07657 [Oryza sativa Japonica Group]
 dbj|BAG93672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=381

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS G+GAA + A++  GS+V IFGLG++GL+VA+GA+L GA+ IIGVD NP+K 
Sbjct  175  CLLSCGVSAGLGAAWKVADISKGSSVVIFGLGTVGLSVAQGAKLRGASIIIGVDTNPEKQ  234

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+GK FGV+DF+N   + N+ V QV+  +T GGADY FECVG   +V  A  SC  GWG 
Sbjct  235  EKGKAFGVTDFINPEEL-NEPVQQVVKRLTNGGADYSFECVGDTGVVSTALQSCSDGWGL  293

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +L SG+TL GSLFGG +PKSD+P+L  +Y++ E+++D  VT
Sbjct  294  TVTLGVPKAKPEVSAH-YALLLSGRTLKGSLFGGWRPKSDLPLLVDKYANKEIQVDDLVT  352

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F+ INKA +L+++ K LRCVI M +
Sbjct  353  HDLSFDYINKALELMLENKCLRCVIHMPQ  381



>gb|AAM62747.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=381

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+I+GVDINP K 
Sbjct  175  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLSGAAQILGVDINPAKA  234

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS  + ++ + QVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  235  EQAKTFGVTDFINSNDL-SEPIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  293

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  SGK+L G+LFGG KPKSD+P L  +Y + E+ +D+F+T
Sbjct  294  TVTLGVPKAKPEVSAH-YGLFLSGKSLKGTLFGGWKPKSDLPSLIDKYMNKEIMIDEFIT  352

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + F++INKAF L+ +GK LRCV+ M K
Sbjct  353  HNLSFDEINKAFVLMREGKCLRCVLHMPK  381



>ref|XP_010493721.1| PREDICTED: alcohol dehydrogenase-like 6 [Camelina sativa]
Length=382

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+IIGVDINP K 
Sbjct  176  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQIIGVDINPAKA  235

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS    ++ + QVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  236  EQAKTFGVTDFINS-NDHSEPIFQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  294

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  +GK+L G+LFGG KPKSDIP L ++Y + E+ +D+ VT
Sbjct  295  TVTLGVPKVKPEVSAH-YGLFLAGKSLKGTLFGGWKPKSDIPSLIEKYMNKEIMIDELVT  353

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + F+DINKAF+L+ +GK LRCV+ M K
Sbjct  354  HNLAFDDINKAFELMREGKCLRCVLHMPK  382



>gb|ACL53051.1| unknown [Zea mays]
 gb|AFW63127.1| putative alcohol dehydrogenase superfamily protein [Zea mays]
Length=267

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 154/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGVS+G+GA    ANV  GS+VAIFGLG++GL+VA+GA+L GA++IIGVD NP+K 
Sbjct  61   CLLSCGVSSGLGAVWNVANVSKGSSVAIFGLGTVGLSVAQGAKLRGASKIIGVDTNPEKQ  120

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+GK+FGV+DF+N   + ++ V QVI  +T GG DY FECVG + +V  A  SC  GWG 
Sbjct  121  EKGKSFGVTDFINPDEL-SEPVQQVIKRITDGGVDYSFECVGDSGVVSTALQSCSDGWGV  179

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LG+ K   ++S + +  L SG+TL GS+FGG KPKSD+P L  +Y+  E+++D  VT
Sbjct  180  TVTLGLPKGKLEVSTH-YAFLLSGRTLKGSMFGGWKPKSDLPSLVDKYAAKEIQVDGLVT  238

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H++ F +INKA +L+++ K LRCVI M +
Sbjct  239  HDIPFNEINKALELMLENKCLRCVIHMPR  267



>ref|XP_002874221.1| hypothetical protein ARALYDRAFT_489336 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50480.1| hypothetical protein ARALYDRAFT_489336 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+IIGVDINP K 
Sbjct  176  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQIIGVDINPAKA  235

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS  + ++ + QVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  236  EQAKTFGVTDFINSNDL-SEPIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  294

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  SGK+L G+LFGG KPKSD+P L ++Y + E+ +D+ VT
Sbjct  295  TVTLGVPKVKPEVSAH-YGLFLSGKSLKGTLFGGWKPKSDLPSLIEKYMNKEIMIDELVT  353

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + F++INKAFDL+  GK LRCV+ M K
Sbjct  354  HNLVFDEINKAFDLMRDGKCLRCVLHMPK  382



>ref|XP_008239269.1| PREDICTED: alcohol dehydrogenase-like 4 [Prunus mume]
Length=395

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 153/206 (74%), Gaps = 2/206 (1%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            LLSCGVSTGVGAA  +ANV+  STVAIFGLGS+GLAVAEGAR  GA+RIIGVDINP+KF 
Sbjct  192  LLSCGVSTGVGAAWNTANVQAASTVAIFGLGSVGLAVAEGARARGASRIIGVDINPNKFI  251

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
            +G+  GV+DF+N    G K + + I E+T GG D+ FEC+G   +++EA+ S  +GWG T
Sbjct  252  KGQAMGVTDFINPSEPG-KPLHERIREITDGGVDHSFECIGNLDVLREAFLSTHEGWGFT  310

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            VVLG+      L L+  E++H G+ +IGS+FGG K KS +P  A+   +G ++LDKF+TH
Sbjct  311  VVLGIHPTPKMLLLHPMELVH-GRGIIGSVFGGFKGKSQLPHFAQECMNGVVDLDKFITH  369

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWM  97
            E+ FE IN AF LLI+GKSLRCV+ +
Sbjct  370  ELPFEKINDAFQLLIEGKSLRCVLQL  395



>ref|NP_974831.1| alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
 ref|NP_001078619.1| alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
 gb|AED93356.1| alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
 gb|AED93357.1| alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
Length=352

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+I+GVDINP K 
Sbjct  146  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQILGVDINPAKA  205

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS  + ++ + QVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  206  EQAKTFGVTDFINSNDL-SEPIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  264

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  SGK+L G+LFGG KPKSD+P L  +Y + E+ +D+F+T
Sbjct  265  TVTLGVPKAKPEVSAH-YGLFLSGKSLKGTLFGGWKPKSDLPSLIDKYMNKEIMIDEFIT  323

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + F++INKAF L+ +GK LRCV+ M K
Sbjct  324  HNLSFDEINKAFVLMREGKCLRCVLHMPK  352



>ref|XP_009398007.1| PREDICTED: alcohol dehydrogenase-like 6 [Musa acuminata subsp. 
malaccensis]
 gb|AIU98495.1| alcohol dehydrogenase [Musa acuminata AAA Group]
Length=381

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 153/210 (73%), Gaps = 2/210 (1%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLLSCGV+ G+GAA   A++  GSTV IFGLG++GL+VA+ A+  GA+RIIGVDINP+K
Sbjct  174  ACLLSCGVAAGIGAAWNVADISKGSTVVIFGLGTVGLSVAQAAKSRGASRIIGVDINPEK  233

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
            +E+GK FGV++++N      + + QVI ++T GGADY FECVG  ++V  A  SC  GWG
Sbjct  234  YEKGKAFGVTEYINPDEC-KEPIQQVIKQITDGGADYSFECVGDTSIVSTALQSCCDGWG  292

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFV  181
             TV LGV K    +S + +  L  G+TL GSLFGG KPKS++P+L  +Y  GE++LD+ V
Sbjct  293  MTVTLGVPKTNPVVSTH-YAFLLMGRTLKGSLFGGWKPKSELPLLVDKYMKGEIQLDELV  351

Query  180  THEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            TH++ F +IN+AF L+ +GK LRCVI M K
Sbjct  352  THDITFANINEAFSLMREGKCLRCVIHMPK  381



>gb|KDP45829.1| hypothetical protein JCGZ_17436 [Jatropha curcas]
Length=267

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   AN+  GSTV IFGLG++GL+VA+GA+L GA++IIG+D NP+K 
Sbjct  61   CLLSCGVAAGLGAAWNVANISEGSTVVIFGLGTVGLSVAQGAKLRGASQIIGIDTNPEKR  120

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ K FGV+ F+N     N+ + QV+  +T GGADY FEC+G   +V  A  SC  GWG 
Sbjct  121  EKAKAFGVTQFINP-NDSNEPIQQVVKSITNGGADYSFECIGDTGMVTTALQSCCDGWGL  179

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +L SG+TL GSLFGG KPKS +P L   Y   E+++D+ +T
Sbjct  180  TVTLGVPKVKPEISAH-YGLLLSGRTLKGSLFGGWKPKSHLPSLVDMYLKKEIQIDELIT  238

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + FEDINKAF+L+ +GK LRCVI M K
Sbjct  239  HNLQFEDINKAFNLMKEGKCLRCVIHMPK  267



>ref|XP_008464880.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X3 [Cucumis melo]
Length=380

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  ACLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDK  541
            ACLL CGVSTGVGA+ R+A VE GSTVAIFGLG++GLAVA+GAR+CGAARIIG+D++P K
Sbjct  207  ACLLGCGVSTGVGASWRTAKVEKGSTVAIFGLGTVGLAVAQGARICGAARIIGIDVSPYK  266

Query  540  FERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWG  361
                K FGV++ VNS +IG+KSVSQVI EMT GGADYCFECVG ++L++EA+A CRKGWG
Sbjct  267  LTLAKEFGVTEVVNSRSIGDKSVSQVINEMTDGGADYCFECVGLSSLIKEAFACCRKGWG  326

Query  360  KTVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGEL  199
            KT++ GV+   + L +   + +  GK L+G ++GGLKPKSDIP L + Y D  +
Sbjct  327  KTIIFGVEDQASLLGVKCMDAICQGKMLMGCIYGGLKPKSDIPTLLQWYMDKNM  380



>ref|NP_568453.1| alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
 sp|Q8LEB2.2|ADHL6_ARATH RecName: Full=Alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
 gb|AAL85002.1| AT5g24760/T4C12_30 [Arabidopsis thaliana]
 gb|AAM16261.1| AT5g24760/T4C12_30 [Arabidopsis thaliana]
 gb|AED93355.1| alcohol dehydrogenase-like 6 [Arabidopsis thaliana]
Length=381

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+I+GVDINP K 
Sbjct  175  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQILGVDINPAKA  234

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ KTFGV+DF+NS  + ++ + QVI  MTGGGAD+ FECVG   +   A  SC  GWG 
Sbjct  235  EQAKTFGVTDFINSNDL-SEPIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGM  293

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  SGK+L G+LFGG KPKSD+P L  +Y + E+ +D+F+T
Sbjct  294  TVTLGVPKAKPEVSAH-YGLFLSGKSLKGTLFGGWKPKSDLPSLIDKYMNKEIMIDEFIT  352

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + F++INKAF L+ +GK LRCV+ M K
Sbjct  353  HNLSFDEINKAFVLMREGKCLRCVLHMPK  381



>ref|XP_010454800.1| PREDICTED: alcohol dehydrogenase-like 6 [Camelina sativa]
Length=383

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 153/207 (74%), Gaps = 2/207 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A+V+ GS+V IFGLG++GL+VA+GA+L GAA+IIGVDINP K 
Sbjct  177  CLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGAAQIIGVDINPAKA  236

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
             + KTFGV+DF+NS    ++ +SQVI  MTGGGAD  FECVG   +   A  SC  GWG 
Sbjct  237  GQAKTFGVTDFINS-NDHSEPISQVIKRMTGGGADVSFECVGDTRIATTALQSCSDGWGM  295

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   ++S + + +  +GK+L G+LFGG KPKSDIP L ++Y + E+ +D+ VT
Sbjct  296  TVTLGVPKVKPEVSAH-YGLFLAGKSLKGTLFGGWKPKSDIPSLVEKYMNKEIMIDELVT  354

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWM  97
            H + F+DINKAFDL+ +GK LRCV+ M
Sbjct  355  HNLAFDDINKAFDLMREGKCLRCVLHM  381



>ref|XP_009360201.1| PREDICTED: alcohol dehydrogenase-like 4 [Pyrus x bretschneideri]
Length=396

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 151/206 (73%), Gaps = 2/206 (1%)
 Frame = -2

Query  714  LLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKFE  535
            LLSCGVSTGVGAA  +ANV+P STVAIFGLGS+GLAVAEGAR+ GA++IIGVDINPDKF 
Sbjct  193  LLSCGVSTGVGAAWNTANVQPASTVAIFGLGSVGLAVAEGARVRGASKIIGVDINPDKFI  252

Query  534  RGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGKT  355
            +G+  GV++F+N    G K V + I E+T GG DY FECVG   +++EA+ S  +GWG T
Sbjct  253  KGQEMGVTNFINPTEPG-KPVHERIREITDGGVDYSFECVGNLDVLREAFLSTHEGWGFT  311

Query  354  VVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVTH  175
            V+LG+      L  +  E L +G+ +IGS+FGG K KS +P  A +   G + LDKF+TH
Sbjct  312  VILGIHAAPTTLPFHPME-LFNGRGIIGSVFGGFKGKSQLPHFAIQCMRGVVGLDKFITH  370

Query  174  EVGFEDINKAFDLLIQGKSLRCVIWM  97
            E+ FE IN AF LLI+GKSLRCV+ +
Sbjct  371  ELPFEKINDAFQLLIEGKSLRCVLQL  396



>ref|XP_007029344.1| GroES-like zinc-binding dehydrogenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY09846.1| GroES-like zinc-binding dehydrogenase family protein isoform 
2 [Theobroma cacao]
Length=378

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 151/209 (72%), Gaps = 2/209 (1%)
 Frame = -2

Query  717  CLLSCGVSTGVGAAIRSANVEPGSTVAIFGLGSIGLAVAEGARLCGAARIIGVDINPDKF  538
            CLLSCGV+ G+GAA   A++  GSTV IFGLG++GLAVA+GA+L GA++IIGV+ NP+K+
Sbjct  172  CLLSCGVAAGLGAAWNVADISKGSTVVIFGLGTVGLAVAQGAKLRGASQIIGVETNPEKY  231

Query  537  ERGKTFGVSDFVNSLTIGNKSVSQVICEMTGGGADYCFECVGQATLVQEAYASCRKGWGK  358
            E+ K FGV++F+N      + + QVI  ++GGG DY FEC+G    V  A  SC  GWG 
Sbjct  232  EKAKAFGVTEFLNPKDC-KEPIQQVIKRLSGGGTDYSFECIGDTGTVATALQSCCDGWGL  290

Query  357  TVVLGVDKPGAQLSLNSFEVLHSGKTLIGSLFGGLKPKSDIPVLAKRYSDGELELDKFVT  178
            TV LGV K   +++ + +    SGKTL GSLFGG KPKSD+P L ++Y + E+++D+F+T
Sbjct  291  TVTLGVPKMKPEIAAH-YSAFLSGKTLKGSLFGGWKPKSDLPSLVEKYMNKEIQIDEFIT  349

Query  177  HEVGFEDINKAFDLLIQGKSLRCVIWMDK  91
            H + FEDINKAF L+ +GK LRCVI M K
Sbjct  350  HNLPFEDINKAFSLMREGKCLRCVIHMPK  378



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425