BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034J05

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594235.1|  PREDICTED: protein PAT1 homolog 1-like             182   7e-50   Nicotiana tomentosiformis
ref|XP_009757677.1|  PREDICTED: uncharacterized protein LOC104210470    181   3e-49   Nicotiana sylvestris
ref|XP_009602223.1|  PREDICTED: uncharacterized protein LOC104097371    181   4e-49   Nicotiana tomentosiformis
ref|XP_009781689.1|  PREDICTED: uncharacterized protein LOC104230555    178   1e-48   Nicotiana sylvestris
ref|XP_006351984.1|  PREDICTED: protein PAT1 homolog 1-like             176   4e-48   Solanum tuberosum [potatoes]
ref|XP_006354416.1|  PREDICTED: uncharacterized protein LOC102594...    175   9e-48   Solanum tuberosum [potatoes]
ref|XP_009797313.1|  PREDICTED: protein PAT1 homolog 1-like             173   1e-46   Nicotiana sylvestris
ref|XP_009595696.1|  PREDICTED: protein PAT1 homolog 1-like             172   3e-46   Nicotiana tomentosiformis
ref|XP_004251557.1|  PREDICTED: uncharacterized protein LOC101260...    168   1e-45   Solanum lycopersicum
ref|XP_010313689.1|  PREDICTED: uncharacterized protein LOC101260...    168   1e-45   Solanum lycopersicum
ref|XP_008451848.1|  PREDICTED: uncharacterized protein LOC103493011    164   3e-43   Cucumis melo [Oriental melon]
ref|XP_008809752.1|  PREDICTED: uncharacterized protein LOC103721355    156   4e-43   
ref|XP_010112872.1|  hypothetical protein L484_017708                   159   9e-43   
ref|XP_004147742.1|  PREDICTED: uncharacterized protein LOC101213130    162   1e-42   Cucumis sativus [cucumbers]
ref|XP_004165263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    162   1e-42   
ref|XP_008787377.1|  PREDICTED: uncharacterized protein LOC103705447    157   5e-42   
ref|XP_011085449.1|  PREDICTED: protein PAT1 homolog 1-like             156   6e-42   Sesamum indicum [beniseed]
gb|EYU42843.1|  hypothetical protein MIMGU_mgv1a001457mg                155   6e-42   Erythranthe guttata [common monkey flower]
ref|XP_004239250.1|  PREDICTED: uncharacterized protein LOC101257075    156   4e-41   Solanum lycopersicum
ref|XP_011100381.1|  PREDICTED: uncharacterized protein LOC105178578    158   9e-41   Sesamum indicum [beniseed]
emb|CDP16041.1|  unnamed protein product                                159   2e-40   Coffea canephora [robusta coffee]
ref|XP_002264820.1|  PREDICTED: protein PAT1 homolog 1-like             150   3e-40   Vitis vinifera
emb|CAN68728.1|  hypothetical protein VITISV_033604                     150   4e-40   Vitis vinifera
ref|XP_004303935.1|  PREDICTED: protein PAT1 homolog 1                  144   1e-38   Fragaria vesca subsp. vesca
ref|XP_010907163.1|  PREDICTED: uncharacterized protein LOC105033889    147   2e-38   Elaeis guineensis
ref|XP_008342293.1|  PREDICTED: protein PAT1 homolog 1-like             143   5e-38   
ref|XP_009377953.1|  PREDICTED: protein PAT1 homolog 1-like             143   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_008793552.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    145   8e-38   Phoenix dactylifera
ref|XP_008793553.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    145   1e-37   
ref|XP_010243929.1|  PREDICTED: protein PAT1 homolog 1-like             146   1e-37   Nelumbo nucifera [Indian lotus]
gb|ACF84116.1|  unknown                                                 140   3e-37   Zea mays [maize]
ref|XP_010243918.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    147   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010243919.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    147   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010923783.1|  PREDICTED: uncharacterized protein LOC105046771    147   6e-37   
ref|XP_008229675.1|  PREDICTED: protein PAT1 homolog 1-like             139   2e-36   Prunus mume [ume]
ref|XP_010036063.1|  PREDICTED: protein PAT1 homolog 1-like             144   3e-36   Eucalyptus grandis [rose gum]
ref|XP_007217055.1|  hypothetical protein PRUPE_ppa001180mg             136   1e-35   
ref|XP_010645006.1|  PREDICTED: uncharacterized protein LOC100267...    137   2e-35   Vitis vinifera
ref|XP_003545913.2|  PREDICTED: uncharacterized protein LOC100787648    143   2e-35   Glycine max [soybeans]
ref|XP_009406732.1|  PREDICTED: uncharacterized protein LOC103989...    139   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010645007.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       136   2e-35   Vitis vinifera
ref|XP_010645008.1|  PREDICTED: protein PAT1 homolog 1 isoform X3       136   2e-35   Vitis vinifera
ref|XP_008383068.1|  PREDICTED: uncharacterized protein LOC103445...    136   2e-35   
ref|XP_008383066.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       136   3e-35   Malus domestica [apple tree]
ref|XP_010062704.1|  PREDICTED: protein PAT1 homolog 1                  133   3e-35   Eucalyptus grandis [rose gum]
ref|XP_010926895.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       140   3e-35   
ref|XP_010926894.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       140   4e-35   Elaeis guineensis
ref|XP_009345080.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    134   8e-35   Pyrus x bretschneideri [bai li]
ref|XP_009345081.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    134   1e-34   
ref|XP_006585424.1|  PREDICTED: uncharacterized protein LOC100812...    140   1e-34   Glycine max [soybeans]
ref|XP_004488834.1|  PREDICTED: uncharacterized protein LOC101500903    140   2e-34   Cicer arietinum [garbanzo]
ref|NP_001140581.1|  uncharacterized protein LOC100272651               140   3e-34   Zea mays [maize]
ref|XP_003532940.1|  PREDICTED: uncharacterized protein LOC100812...    140   3e-34   Glycine max [soybeans]
ref|XP_011097653.1|  PREDICTED: protein PAT1 homolog 1                  132   6e-34   
gb|KJB10632.1|  hypothetical protein B456_001G212600                    130   6e-34   Gossypium raimondii
gb|KHG26425.1|  Protein PAT1                                            130   8e-34   Gossypium arboreum [tree cotton]
ref|XP_003545912.1|  PREDICTED: protein PAT1 homolog 1-like             137   1e-33   Glycine max [soybeans]
ref|XP_008378353.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    128   1e-33   
ref|XP_009375342.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    128   1e-33   
ref|XP_009375341.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    127   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_007214538.1|  hypothetical protein PRUPE_ppa002090mg             130   1e-33   
ref|XP_010109206.1|  hypothetical protein L484_002129                   129   2e-33   Morus notabilis
ref|XP_007049006.1|  Topoisomerase II-associated protein PAT1, pu...    132   2e-33   
ref|XP_007049005.1|  Topoisomerase II-associated protein PAT1, pu...    132   3e-33   
ref|XP_004970101.1|  PREDICTED: uncharacterized protein LOC101761506    138   3e-33   Setaria italica
ref|XP_008226080.1|  PREDICTED: protein PAT1 homolog 1                  129   3e-33   Prunus mume [ume]
gb|KEH38343.1|  topoisomerase II-associated protein PAT1                135   4e-33   Medicago truncatula
ref|XP_004488835.1|  PREDICTED: uncharacterized protein LOC101501...    134   5e-33   Cicer arietinum [garbanzo]
ref|XP_002456407.1|  hypothetical protein SORBIDRAFT_03g035750          137   5e-33   Sorghum bicolor [broomcorn]
ref|XP_002520595.1|  hypothetical protein RCOM_0673440                  130   6e-33   Ricinus communis
ref|XP_009416760.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    131   7e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294192.1|  PREDICTED: protein PAT1 homolog 1                  135   8e-33   Fragaria vesca subsp. vesca
ref|XP_009416762.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    131   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416761.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    131   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006585425.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    134   1e-32   
ref|XP_007149276.1|  hypothetical protein PHAVU_005G0567001g            129   2e-32   Phaseolus vulgaris [French bean]
ref|XP_009397355.1|  PREDICTED: protein PAT1 homolog 1-like             135   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775079.1|  PREDICTED: protein PAT1 homolog 1-like             129   3e-32   Phoenix dactylifera
dbj|BAJ90621.1|  predicted protein                                      128   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006597997.1|  PREDICTED: uncharacterized protein LOC100779...    131   3e-32   Glycine max [soybeans]
ref|XP_006597998.1|  PREDICTED: uncharacterized protein LOC100779...    130   3e-32   Glycine max [soybeans]
dbj|BAK00541.1|  predicted protein                                      128   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006597999.1|  PREDICTED: uncharacterized protein LOC100779...    130   3e-32   Glycine max [soybeans]
gb|EMT11670.1|  Protein PAT1-1-like protein                             128   3e-32   
gb|KHN16432.1|  hypothetical protein glysoja_046875                     130   4e-32   Glycine soja [wild soybean]
gb|EYU43158.1|  hypothetical protein MIMGU_mgv1a023840mg                125   4e-32   Erythranthe guttata [common monkey flower]
gb|ABR25724.1|  unknown                                                 124   5e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_009399054.1|  PREDICTED: protein PAT1 homolog 1-like             132   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS52590.1|  hypothetical protein TRIUR3_20541                       127   7e-32   Triticum urartu
gb|KEH38344.1|  topoisomerase II-associated protein PAT1, putative      132   9e-32   Medicago truncatula
ref|XP_003569904.1|  PREDICTED: uncharacterized protein LOC100838182    123   2e-31   Brachypodium distachyon [annual false brome]
gb|KHN27739.1|  Protein PAT1 like 1                                     130   2e-31   Glycine soja [wild soybean]
ref|XP_003568135.1|  PREDICTED: protein PAT1 homolog 1-like             126   2e-31   Brachypodium distachyon [annual false brome]
dbj|BAJ88890.1|  predicted protein                                      125   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009419549.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419548.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       130   3e-31   
gb|KJB42927.1|  hypothetical protein B456_007G174200                    125   3e-31   Gossypium raimondii
emb|CDP13609.1|  unnamed protein product                                122   3e-31   Coffea canephora [robusta coffee]
ref|XP_002308825.2|  hypothetical protein POPTR_0006s02270g             124   3e-31   
ref|XP_004514400.1|  PREDICTED: uncharacterized protein LOC101512706    129   4e-31   
gb|EAY75968.1|  hypothetical protein OsI_03887                          123   5e-31   Oryza sativa Indica Group [Indian rice]
gb|KHG07107.1|  Protein PAT1                                            124   7e-31   Gossypium arboreum [tree cotton]
ref|XP_006646364.1|  PREDICTED: uncharacterized protein LOC102701783    126   7e-31   Oryza brachyantha
ref|XP_006373646.1|  hypothetical protein POPTR_0016s02130g             124   8e-31   
ref|XP_011008549.1|  PREDICTED: uncharacterized protein LOC105113895    123   1e-30   Populus euphratica
ref|XP_004251956.1|  PREDICTED: protein PAT1 homolog 1                  124   2e-30   Solanum lycopersicum
ref|XP_006648671.1|  PREDICTED: uncharacterized protein LOC102700029    124   2e-30   Oryza brachyantha
ref|XP_006388794.1|  hypothetical protein POPTR_0098s00230g             123   2e-30   
ref|XP_011004464.1|  PREDICTED: uncharacterized protein LOC105110947    121   2e-30   Populus euphratica
ref|XP_003568134.1|  PREDICTED: uncharacterized protein LOC100841028    123   2e-30   
gb|EAZ23222.1|  hypothetical protein OsJ_06910                          129   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86044.1|  hypothetical protein OsI_07409                          129   3e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001046960.1|  Os02g0517300                                       129   3e-30   
ref|XP_011036076.1|  PREDICTED: protein PAT1 homolog 1-like             122   4e-30   Populus euphratica
ref|XP_009361780.1|  PREDICTED: protein PAT1 homolog 1-like             118   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_009405381.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    127   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405382.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    127   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647188.1|  PREDICTED: protein PAT1 homolog 1-like             124   1e-29   Oryza brachyantha
gb|KHN26819.1|  Protein PAT1 like 1                                     123   1e-29   Glycine soja [wild soybean]
gb|EYU33763.1|  hypothetical protein MIMGU_mgv1a002553mg                119   2e-29   Erythranthe guttata [common monkey flower]
emb|CAD80089.1|  hypothetical protein                                   117   2e-29   Momordica charantia [balsam pear]
gb|EEC72953.1|  hypothetical protein OsI_06835                          123   3e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001172909.1|  Os02g0295700                                       122   4e-29   
gb|EPS66560.1|  hypothetical protein M569_08215                         120   4e-29   Genlisea aurea
dbj|BAJ94686.1|  predicted protein                                      120   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001044369.2|  Os01g0769000                                       123   6e-29   
ref|XP_007149274.1|  hypothetical protein PHAVU_005G056500g             125   6e-29   Phaseolus vulgaris [French bean]
gb|EAZ13676.1|  hypothetical protein OsJ_03596                          123   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046606.2|  Os02g0294700                                       124   9e-29   
gb|EAZ22672.1|  hypothetical protein OsJ_06342                          124   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006344917.1|  PREDICTED: uncharacterized protein LOC102604...    117   1e-28   Solanum tuberosum [potatoes]
ref|XP_006344918.1|  PREDICTED: uncharacterized protein LOC102604...    117   1e-28   Solanum tuberosum [potatoes]
gb|KJB08599.1|  hypothetical protein B456_001G092700                    124   2e-28   Gossypium raimondii
gb|KDP44628.1|  hypothetical protein JCGZ_22047                         112   3e-28   Jatropha curcas
gb|EAY85452.1|  hypothetical protein OsI_06832                          119   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004961544.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    115   4e-28   Setaria italica
gb|EMS48493.1|  hypothetical protein TRIUR3_07139                       119   5e-28   Triticum urartu
gb|EMT17005.1|  Lipoyl synthase, mitochondrial                          119   5e-28   
ref|XP_004961543.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    114   5e-28   Setaria italica
ref|XP_007133386.1|  hypothetical protein PHAVU_011G174900g             122   6e-28   Phaseolus vulgaris [French bean]
ref|XP_004162291.1|  PREDICTED: uncharacterized protein LOC101226533    111   8e-28   
ref|XP_004144681.1|  PREDICTED: uncharacterized protein LOC101207256    111   8e-28   Cucumis sativus [cucumbers]
gb|KJB08598.1|  hypothetical protein B456_001G092700                    122   9e-28   Gossypium raimondii
ref|XP_003578526.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    115   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_010238435.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    115   1e-27   
ref|XP_010692206.1|  PREDICTED: protein PAT1 homolog 1                  112   2e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|ACL52964.1|  unknown                                                 115   5e-27   Zea mays [maize]
ref|XP_008444289.1|  PREDICTED: protein PAT1 homolog 1                  110   5e-27   Cucumis melo [Oriental melon]
ref|XP_002441360.1|  hypothetical protein SORBIDRAFT_09g025190          114   1e-26   Sorghum bicolor [broomcorn]
ref|XP_008649853.1|  PREDICTED: uncharacterized protein LOC103630586    110   2e-26   Zea mays [maize]
ref|XP_004952292.1|  PREDICTED: uncharacterized protein LOC101759904    115   3e-26   Setaria italica
ref|NP_001145976.1|  hypothetical protein                               113   8e-26   Zea mays [maize]
ref|XP_010228364.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    113   9e-26   
ref|XP_009767161.1|  PREDICTED: uncharacterized protein LOC104218381    116   9e-26   Nicotiana sylvestris
ref|XP_010228365.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    113   9e-26   Brachypodium distachyon [annual false brome]
ref|XP_009604527.1|  PREDICTED: uncharacterized protein LOC104099288    116   1e-25   Nicotiana tomentosiformis
ref|XP_006845982.1|  hypothetical protein AMTR_s00155p00028780          114   1e-25   Amborella trichopoda
ref|XP_002457098.1|  hypothetical protein SORBIDRAFT_03g001160          113   1e-25   
ref|XP_010684289.1|  PREDICTED: uncharacterized protein LOC104898860    110   8e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001169926.1|  uncharacterized protein LOC100383823               109   2e-24   
ref|XP_004967457.1|  PREDICTED: protein PAT1 homolog 1-like             110   2e-24   Setaria italica
ref|XP_008655297.1|  PREDICTED: uncharacterized protein LOC100383...    108   3e-24   
gb|KHG11535.1|  Protein PAT1                                          97.1    5e-24   Gossypium arboreum [tree cotton]
ref|XP_007022269.1|  Topoisomerase II-associated protein PAT1, pu...  95.9    1e-23   
gb|EMS67142.1|  hypothetical protein TRIUR3_06605                       106   1e-23   Triticum urartu
gb|EMT27507.1|  hypothetical protein F775_52260                         105   2e-23   
gb|KJB12762.1|  hypothetical protein B456_002G0355002                 94.7    2e-23   Gossypium raimondii
ref|XP_007022271.1|  Uncharacterized protein TCM_032442               94.0    3e-23   
ref|XP_002513418.1|  conserved hypothetical protein                   99.0    8e-23   Ricinus communis
ref|XP_011030729.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     96.3    4e-22   Populus euphratica
ref|XP_011030731.1|  PREDICTED: protein PAT1 homolog 1 isoform X3     96.7    4e-22   Populus euphratica
ref|XP_011030730.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     96.7    4e-22   Populus euphratica
gb|EPS71565.1|  hypothetical protein M569_03193                         102   7e-22   Genlisea aurea
ref|XP_002317021.2|  hypothetical protein POPTR_0011s14710g           97.1    7e-22   
gb|KHG10037.1|  Protein PAT1                                          95.9    1e-21   Gossypium arboreum [tree cotton]
gb|KJB26984.1|  hypothetical protein B456_004G270000                  95.1    2e-21   Gossypium raimondii
gb|KHG07822.1|  Protein PAT1                                          93.6    2e-21   Gossypium arboreum [tree cotton]
gb|KJB82133.1|  hypothetical protein B456_013G178200                  94.7    2e-21   Gossypium raimondii
gb|KDP25122.1|  hypothetical protein JCGZ_22657                       97.4    6e-21   Jatropha curcas
gb|KJB12766.1|  hypothetical protein B456_002G0357002                 94.7    6e-21   Gossypium raimondii
ref|XP_010532520.1|  PREDICTED: uncharacterized protein LOC104808528  90.1    1e-20   Tarenaya hassleriana [spider flower]
gb|KDP25124.1|  hypothetical protein JCGZ_22659                       92.8    9e-20   Jatropha curcas
ref|XP_010511200.1|  PREDICTED: uncharacterized protein LOC104787331  90.1    2e-19   
ref|XP_006414611.1|  hypothetical protein EUTSA_v10024461mg           88.2    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_002300546.2|  hypothetical protein POPTR_0001s46190g           87.4    3e-19   Populus trichocarpa [western balsam poplar]
gb|KFK23118.1|  hypothetical protein AALP_AAs49591U000400             87.4    3e-19   Arabis alpina [alpine rockcress]
gb|AAM61209.1|  unknown                                               88.2    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539589.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     87.4    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_010539588.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     87.4    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_010466506.1|  PREDICTED: uncharacterized protein LOC104746679  88.6    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010488248.1|  PREDICTED: uncharacterized protein LOC104766124  88.2    5e-19   Camelina sativa [gold-of-pleasure]
dbj|BAD94175.1|  hypothetical protein                                 87.8    6e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17049.1|  Similar to hypothetical protein product gb|Z97337...  87.8    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565199.1|  uncharacterized protein                             87.8    9e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01945.1|  unnamed protein product                              87.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525174.1|  PREDICTED: uncharacterized protein LOC104803017  86.7    1e-18   Tarenaya hassleriana [spider flower]
emb|CBI34052.3|  unnamed protein product                              94.4    2e-18   Vitis vinifera
ref|XP_011014091.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  84.7    2e-18   Populus euphratica
ref|XP_011014090.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  84.7    2e-18   Populus euphratica
ref|XP_011038109.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  84.7    2e-18   Populus euphratica
ref|XP_011038110.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  84.7    2e-18   Populus euphratica
emb|CDY54867.1|  BnaC01g22630D                                        85.9    2e-18   Brassica napus [oilseed rape]
gb|KFK39518.1|  hypothetical protein AALP_AA3G254500                  86.7    3e-18   Arabis alpina [alpine rockcress]
ref|XP_006300753.1|  hypothetical protein CARUB_v10019819mg           83.2    3e-18   
ref|XP_006297023.1|  hypothetical protein CARUB_v10013016mg           85.5    4e-18   Capsella rubella
ref|XP_006283147.1|  hypothetical protein CARUB_v10004170mg           83.2    5e-18   Capsella rubella
ref|XP_006283146.1|  hypothetical protein CARUB_v10004170mg           83.2    5e-18   
emb|CDY50269.1|  BnaAnng10330D                                        84.3    6e-18   Brassica napus [oilseed rape]
emb|CDX79293.1|  BnaC06g20100D                                        82.4    6e-18   
ref|XP_006406189.1|  hypothetical protein EUTSA_v10020108mg           84.7    9e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009104546.1|  PREDICTED: protein PAT1 homolog 1-like           82.0    9e-18   Brassica rapa
emb|CDX68009.1|  BnaA07g20490D                                        82.0    9e-18   
ref|XP_006416798.1|  hypothetical protein EUTSA_v10006845mg           83.2    1e-17   Eutrema salsugineum [saltwater cress]
gb|KJB82134.1|  hypothetical protein B456_013G178200                  77.8    2e-17   Gossypium raimondii
ref|XP_006389922.1|  hypothetical protein EUTSA_v10018148mg           81.3    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009145394.1|  PREDICTED: uncharacterized protein LOC103869095  85.1    2e-17   Brassica rapa
gb|KDO64328.1|  hypothetical protein CISIN_1g0038252mg                82.8    2e-17   Citrus sinensis [apfelsine]
emb|CAB10277.1|  hypothetical protein                                 83.2    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567452.2|  Topoisomerase II-associated protein PAT1            83.6    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429752.1|  hypothetical protein CICLE_v10013436mg           82.4    2e-17   
gb|KDO64329.1|  hypothetical protein CISIN_1g0038252mg                82.4    2e-17   Citrus sinensis [apfelsine]
ref|XP_006481341.1|  PREDICTED: uncharacterized protein LOC102618...  82.8    2e-17   Citrus sinensis [apfelsine]
ref|XP_006481340.1|  PREDICTED: uncharacterized protein LOC102618...  82.4    2e-17   Citrus sinensis [apfelsine]
gb|KDO64330.1|  hypothetical protein CISIN_1g0038252mg                82.4    2e-17   Citrus sinensis [apfelsine]
emb|CDX88505.1|  BnaC06g39490D                                        80.1    3e-17   
ref|XP_010429781.1|  PREDICTED: protein PAT1 homolog 1-like           79.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009147964.1|  PREDICTED: protein PAT1 homolog 1                81.6    4e-17   Brassica rapa
ref|NP_188866.1|  Topoisomerase II-associated protein PAT1            82.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87408.1|  BnaA07g34650D                                        80.5    4e-17   
dbj|BAF00849.1|  hypothetical protein                                 82.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01932.1|  hypothetical protein                                 82.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106629.1|  PREDICTED: protein PAT1 homolog 1                79.7    6e-17   Brassica rapa
emb|CDY39512.1|  BnaA01g24760D                                        80.5    9e-17   Brassica napus [oilseed rape]
ref|XP_002868239.1|  hypothetical protein ARALYDRAFT_915331           80.1    9e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_010419368.1|  PREDICTED: protein PAT1 homolog 1-like           78.2    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009108983.1|  PREDICTED: uncharacterized protein LOC103834...  80.1    1e-16   Brassica rapa
ref|XP_009108988.1|  PREDICTED: uncharacterized protein LOC103834...  80.1    1e-16   Brassica rapa
ref|XP_002889231.1|  predicted protein                                80.9    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_002883351.1|  hypothetical protein ARALYDRAFT_479740           80.1    1e-16   
gb|KFK42288.1|  hypothetical protein AALP_AA2G236100                  77.8    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010496132.1|  PREDICTED: protein PAT1 homolog 1-like           77.8    2e-16   Camelina sativa [gold-of-pleasure]
emb|CDY46332.1|  BnaC01g31660D                                        80.1    2e-16   Brassica napus [oilseed rape]
ref|XP_010435003.1|  PREDICTED: protein PAT1 homolog 1-like           77.4    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010440363.1|  PREDICTED: protein PAT1 homolog 1-like           76.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002890176.1|  hypothetical protein ARALYDRAFT_889054           75.5    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_010480501.1|  PREDICTED: protein PAT1 homolog 1-like           77.4    3e-15   
ref|XP_010497980.1|  PREDICTED: protein PAT1 homolog 1-like           77.4    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002980379.1|  hypothetical protein SELMODRAFT_112306           83.6    6e-15   
ref|XP_002962712.1|  hypothetical protein SELMODRAFT_165728           83.6    6e-15   
emb|CDY35105.1|  BnaA06g11150D                                        73.6    7e-15   Brassica napus [oilseed rape]
emb|CDY37402.1|  BnaC05g30280D                                        84.0    7e-15   Brassica napus [oilseed rape]
ref|XP_009149098.1|  PREDICTED: protein PAT1 homolog 1-like           73.9    7e-15   Brassica rapa
emb|CDY40046.1|  BnaC05g12690D                                        73.6    7e-15   Brassica napus [oilseed rape]
ref|XP_010459204.1|  PREDICTED: protein PAT1 homolog 1-like           75.9    8e-15   Camelina sativa [gold-of-pleasure]
emb|CDY10630.1|  BnaA05g17320D                                        83.6    9e-15   Brassica napus [oilseed rape]
ref|XP_006478033.1|  PREDICTED: uncharacterized protein LOC102611...  77.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_006478034.1|  PREDICTED: uncharacterized protein LOC102611...  77.8    1e-14   Citrus sinensis [apfelsine]
gb|KDO40140.1|  hypothetical protein CISIN_1g003844mg                 77.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_006441043.1|  hypothetical protein CICLE_v10018922mg           77.8    1e-14   Citrus clementina [clementine]
gb|KDO40142.1|  hypothetical protein CISIN_1g003844mg                 77.8    2e-14   Citrus sinensis [apfelsine]
ref|XP_002513421.1|  conserved hypothetical protein                   81.3    6e-14   Ricinus communis
ref|XP_001783364.1|  predicted protein                                73.2    1e-13   
ref|XP_001755124.1|  predicted protein                                73.6    1e-12   
emb|CDY23806.1|  BnaA01g21570D                                        63.2    3e-12   Brassica napus [oilseed rape]
gb|KJB42926.1|  hypothetical protein B456_007G174200                  56.6    9e-11   Gossypium raimondii
gb|KHM98853.1|  hypothetical protein glysoja_022263                   70.1    2e-10   Glycine soja [wild soybean]
gb|AEN81987.1|  AT3G22270-like protein                                44.3    2e-06   Capsella grandiflora
gb|AEN81985.1|  AT3G22270-like protein                                44.3    2e-06   Capsella grandiflora
gb|AEN81988.1|  AT3G22270-like protein                                44.3    2e-06   Capsella grandiflora
gb|AEN81990.1|  AT3G22270-like protein                                44.3    3e-06   Capsella rubella



>ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
 ref|XP_009594236.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=822

 Score =   182 bits (463),  Expect(3) = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLTD QAANSFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++  Q+++  ++IS
Sbjct  702  ATHLLTDSQAANSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSILTQSQSDAEMIS  761

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
            PE ARA++ EMPVELLRASLPHT+E QRK+L+NF Q S+P+ GFN+ GGSS  IN ESVS
Sbjct  762  PEAARAVSREMPVELLRASLPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPESVS  821

Query  286  C  284
            C
Sbjct  822  C  822


 Score = 36.6 bits (83),  Expect(3) = 7e-50, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  675  SEQPPLRPLGSPAGDGASIILK  696


 Score = 26.6 bits (57),  Expect(3) = 7e-50, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  688  GDGASIILKSVLERAT  703



>ref|XP_009757677.1| PREDICTED: uncharacterized protein LOC104210470 [Nicotiana sylvestris]
Length=814

 Score =   181 bits (460),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+YLLTDPQ   SFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++ AQT ++T++I 
Sbjct  694  ATYLLTDPQVGGSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSIHAQTPSNTEMIG  753

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRA LPHTNE QRK+L NF Q S+P+ GFN+ GGSS +IN ESVS
Sbjct  754  SEAARAVSREMPVELLRAGLPHTNEQQRKLLFNFAQRSMPVTGFNAHGGSSEQINPESVS  813

Query  286  C  284
            C
Sbjct  814  C  814


 Score = 38.1 bits (87),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  667  SEQPPLRPLGSPAGDGATVILK  688


 Score = 24.3 bits (51),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GA++ILKSVL+R  
Sbjct  680  GDGATVILKSVLDRAT  695



>ref|XP_009602223.1| PREDICTED: uncharacterized protein LOC104097371 [Nicotiana tomentosiformis]
Length=814

 Score =   181 bits (459),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+YLLTDPQA  SFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++ AQT ++T++I 
Sbjct  694  ATYLLTDPQAGGSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSILAQTPSNTEMIG  753

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRA LPHTNE QRK+L NF Q S+P+ GFN+ GG+S +IN ESVS
Sbjct  754  SEAARAVSREMPVELLRAGLPHTNEQQRKLLFNFAQRSMPVTGFNAHGGNSGQINPESVS  813

Query  286  C  284
            C
Sbjct  814  C  814


 Score = 38.1 bits (87),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  667  SEQPPLRPLGSPAGDGATVILK  688


 Score = 24.3 bits (51),  Expect(3) = 4e-49, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA++ILKSVL+R
Sbjct  680  GDGATVILKSVLDR  693



>ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
 ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
Length=814

 Score =   178 bits (452),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLT+ QAANSFSMPNPALWQASFDAFF LLTKYC+ K+ +IMQ++ AQ+++  ++I 
Sbjct  694  ATHLLTNSQAANSFSMPNPALWQASFDAFFGLLTKYCLSKYGSIMQSILAQSQSDAEIIG  753

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
            PE ARA++ EMPVELLRASLPHT+E QRK+L+NF Q S+P+ GFN+ GGSS  IN ESVS
Sbjct  754  PEAARAVSREMPVELLRASLPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPESVS  813

Query  286  C  284
            C
Sbjct  814  C  814


 Score = 36.6 bits (83),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  667  SEQPPLRPLGSPAGDGASIILK  688


 Score = 26.6 bits (57),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  680  GDGASIILKSVLER  693



>ref|XP_006351984.1| PREDICTED: protein PAT1 homolog 1-like [Solanum tuberosum]
Length=816

 Score =   176 bits (447),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+YLLTDPQA +SFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ+ V+  +++T++I 
Sbjct  696  ATYLLTDPQAVSSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSLVSPAQSNTELIG  755

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRASLPHTNE QRK+L+NF Q S+P+ GFN+ G SS +IN ESVS
Sbjct  756  SEAARAVSREMPVELLRASLPHTNEHQRKLLLNFAQRSMPVTGFNAHGESSGQINPESVS  815

Query  286  C  284
            C
Sbjct  816  C  816


 Score = 37.4 bits (85),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  669  SEQPPLRPLGSPAGDGASVILK  690


 Score = 26.6 bits (57),  Expect(3) = 4e-48, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  682  GDGASVILKSVLERAT  697



>ref|XP_006354416.1| PREDICTED: uncharacterized protein LOC102594467 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354417.1| PREDICTED: uncharacterized protein LOC102594467 isoform X2 [Solanum 
tuberosum]
Length=821

 Score =   175 bits (444),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLTD QAANSFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++ AQ++   ++I 
Sbjct  701  ATHLLTDSQAANSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSILAQSQPDAEMIG  760

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             + ARA++ EMPVELLRASLPHTN+ Q+K+L+NF Q S+P+ GFNS GGSS  I+ ESVS
Sbjct  761  SDAARAVSREMPVELLRASLPHTNDHQKKLLLNFAQRSMPVTGFNSHGGSSGHIDPESVS  820

Query  286  C  284
            C
Sbjct  821  C  821


 Score = 37.0 bits (84),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  674  SEQPPLRPLGSPAGDGASIILK  695


 Score = 26.6 bits (57),  Expect(3) = 9e-48, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  687  GDGASIILKSVLER  700



>ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris]
Length=817

 Score =   173 bits (439),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLTDPQA +SFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++  QT+++T+   
Sbjct  697  ATHLLTDPQAVSSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSILPQTQSNTETFD  756

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRASLPHTNE QRK+L+NF Q S+P+ G N+ GGS+ +I+ ESVS
Sbjct  757  AEAARAVSREMPVELLRASLPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPESVS  816

Query  286  C  284
            C
Sbjct  817  C  817


 Score = 36.6 bits (83),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  670  SEQPPLRPLGSPAGDGASIILK  691


 Score = 25.0 bits (53),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLE+  
Sbjct  683  GDGASIILKSVLEKAT  698



>ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=817

 Score =   172 bits (435),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLTDPQA +SFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++  QT ++T+   
Sbjct  697  ATHLLTDPQAVSSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSILPQTPSNTETFD  756

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRASLPHTNE QRK+L+NF Q S+P+ G N+ GGS+ +I+ ESVS
Sbjct  757  AEAARAVSREMPVELLRASLPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPESVS  816

Query  286  C  284
            C
Sbjct  817  C  817


 Score = 36.6 bits (83),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  670  SEQPPLRPLGSPAGDGASIILK  691


 Score = 25.0 bits (53),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLE+  
Sbjct  683  GDGASIILKSVLEKAT  698



>ref|XP_004251557.1| PREDICTED: uncharacterized protein LOC101260608 isoform X2 [Solanum 
lycopersicum]
Length=817

 Score =   168 bits (425),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLTDPQ  +  SMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++ +  +++T++I 
Sbjct  697  ATHLLTDPQTVSGLSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSLMSPAQSNTELIG  756

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRASLPHTNE QRK+L+NF Q S+P+ GFN+ G SS +IN ESVS
Sbjct  757  SEAARAVSREMPVELLRASLPHTNEHQRKLLLNFAQRSMPVTGFNAHGVSSGQINPESVS  816

Query  286  C  284
            C
Sbjct  817  C  817


 Score = 37.4 bits (85),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  670  SEQPPLRPLGSPAGDGASVILK  691


 Score = 26.6 bits (57),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  683  GDGASVILKSVLERAT  698



>ref|XP_010313689.1| PREDICTED: uncharacterized protein LOC101260608 isoform X1 [Solanum 
lycopersicum]
Length=818

 Score =   168 bits (425),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLTDPQ  +  SMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++ +  +++T++I 
Sbjct  698  ATHLLTDPQTVSGLSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSLMSPAQSNTELIG  757

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E ARA++ EMPVELLRASLPHTNE QRK+L+NF Q S+P+ GFN+ G SS +IN ESVS
Sbjct  758  SEAARAVSREMPVELLRASLPHTNEHQRKLLLNFAQRSMPVTGFNAHGVSSGQINPESVS  817

Query  286  C  284
            C
Sbjct  818  C  818


 Score = 37.4 bits (85),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  671  SEQPPLRPLGSPAGDGASVILK  692


 Score = 26.6 bits (57),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  684  GDGASVILKSVLERAT  699



>ref|XP_008451848.1| PREDICTED: uncharacterized protein LOC103493011 [Cucumis melo]
Length=808

 Score =   164 bits (414),  Expect(3) = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP AA++ SMPN ALWQASFD FF LLTKYCV K++ I+Q++ +QT +STDVI 
Sbjct  688  ATELLTDPHAASNCSMPNRALWQASFDEFFSLLTKYCVSKYETIVQSLFSQTPSSTDVIG  747

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E ARAI+ EMPVELLRASLPHTNE QRK+LM+F Q S+P++GF++ GGSS ++N+ESV
Sbjct  748  SEAARAISREMPVELLRASLPHTNEPQRKLLMDFAQRSMPVSGFSAHGGSSGQMNSESV  806


 Score = 34.3 bits (77),  Expect(3) = 3e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  661  SEQPPLRPLGSSAGDGASIVLK  682


 Score = 25.4 bits (54),  Expect(3) = 3e-43, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS++LKS+LER  
Sbjct  674  GDGASIVLKSILERAT  689



>ref|XP_008809752.1| PREDICTED: uncharacterized protein LOC103721355 [Phoenix dactylifera]
Length=200

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDPQAA+++SM N ALWQASFDA F+LLTKYC+ K+D+IMQ +     +T +I  
Sbjct  81   ATELLTDPQAASNYSMSNRALWQASFDASFRLLTKYCLSKYDSIMQMLLMQAPNTSIIGS  140

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ARAI+ EMPVELLRASLPHTNE QRKML++F Q S+P+ GF++ GG S  + +ESV
Sbjct  141  EAARAISREMPVELLRASLPHTNEHQRKMLLDFAQRSMPITGFSAHGGGSGPVTSESV  198



>ref|XP_010112872.1| hypothetical protein L484_017708 [Morus notabilis]
 gb|EXC35007.1| hypothetical protein L484_017708 [Morus notabilis]
Length=812

 Score =   159 bits (403),  Expect(3) = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP AA + SMPN ALWQASFD FF LLTKYC+ K++ I+Q++ AQT+ ST+VI 
Sbjct  692  ATELLTDPHAAGNCSMPNRALWQASFDEFFGLLTKYCLSKYETIVQSIYAQTQPSTEVIG  751

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            PE A+AI+ EMPVELLRASLPHT+E QRK+L +F Q S+P++G N+RG S  ++N+ESV
Sbjct  752  PEAAKAIHREMPVELLRASLPHTDEHQRKLLSDFAQRSMPISGINTRGSSGGQLNSESV  810


 Score = 37.0 bits (84),  Expect(3) = 9e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +EQPPLRPLGSPAGDG    LK
Sbjct  665  TEQPPLRPLGSPAGDGATVILK  686


 Score = 25.4 bits (54),  Expect(3) = 9e-43, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA++ILKSVLER
Sbjct  678  GDGATVILKSVLER  691



>ref|XP_004147742.1| PREDICTED: uncharacterized protein LOC101213130 [Cucumis sativus]
 gb|KGN53503.1| hypothetical protein Csa_4G062390 [Cucumis sativus]
Length=808

 Score =   162 bits (409),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP AA++ SMPN ALWQASFD FF LLTKYCV K++ I+Q++ +QT +STDVI 
Sbjct  688  ATELLTDPHAASNCSMPNRALWQASFDEFFSLLTKYCVSKYETIVQSLFSQTPSSTDVIG  747

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E ARAI+ EMPVELLRASLPHTNE QRK+LM+F Q S+P++GF++ GGSS ++++ESV
Sbjct  748  SEAARAISREMPVELLRASLPHTNEPQRKLLMDFAQRSMPVSGFSAHGGSSGQMSSESV  806


 Score = 34.3 bits (77),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  661  SEQPPLRPLGSSAGDGASIVLK  682


 Score = 25.4 bits (54),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS++LKS+LER  
Sbjct  674  GDGASIVLKSILERAT  689



>ref|XP_004165263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228647, 
partial [Cucumis sativus]
Length=742

 Score =   162 bits (409),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP AA++ SMPN ALWQASFD FF LLTKYCV K++ I+Q++ +QT +STDVI 
Sbjct  622  ATELLTDPHAASNCSMPNRALWQASFDEFFSLLTKYCVSKYETIVQSLFSQTPSSTDVIG  681

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E ARAI+ EMPVELLRASLPHTNE QRK+LM+F Q S+P++GF++ GGSS ++++ESV
Sbjct  682  SEAARAISREMPVELLRASLPHTNEPQRKLLMDFAQRSMPVSGFSAHGGSSGQMSSESV  740


 Score = 33.9 bits (76),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  595  SEQPPLRPLGSSAGDGASIVLK  616


 Score = 25.4 bits (54),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS++LKS+LER  
Sbjct  608  GDGASIVLKSILERAT  623



>ref|XP_008787377.1| PREDICTED: uncharacterized protein LOC103705447 [Phoenix dactylifera]
Length=347

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLT+PQAA+++SM N ALWQASFDAFF+LLTKYC+ K+D+IMQ +     +T +I  
Sbjct  228  ATELLTEPQAASNYSMSNRALWQASFDAFFRLLTKYCLSKYDSIMQMLLMQAPNTSIIGS  287

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ARAI+ EMPVELLRASLPHTNE QRKML++F Q S+P+ GF++ GG S  + +ESV
Sbjct  288  EAARAISREMPVELLRASLPHTNEHQRKMLLDFAQRSMPITGFSAHGGGSGPVTSESV  345



>ref|XP_011085449.1| PREDICTED: protein PAT1 homolog 1-like [Sesamum indicum]
Length=812

 Score =   156 bits (395),  Expect(3) = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A++LL DPQ+ ++FS+PNPALWQASFDAFF LLTKYCV K+++I+Q+ + Q   + +V+ 
Sbjct  692  ATHLLRDPQSTSNFSIPNPALWQASFDAFFGLLTKYCVSKYESIVQSLIVQNPQNAEVVG  751

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E ARA++ EMPVELLRAS+PHT+E Q+K+L+NF Q S+P+ GFNS GG+S + N ESV
Sbjct  752  SEAARAVSREMPVELLRASIPHTDESQKKLLLNFAQRSMPVTGFNSHGGNSGQANPESV  810


 Score = 36.2 bits (82),  Expect(3) = 6e-42, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GSPAGDG    LK
Sbjct  665  SEQPPLRPVGSPAGDGASVILK  686


 Score = 26.6 bits (57),  Expect(3) = 6e-42, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  678  GDGASVILKSVLERAT  693



>gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata]
Length=816

 Score =   155 bits (393),  Expect(3) = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL DP   ++FS+PNPALWQASFDAFF LLTKYCV K+D+I+Q++ AQ   + + I 
Sbjct  696  ATVLLRDPPFGSNFSIPNPALWQASFDAFFGLLTKYCVSKYDSIVQSIIAQNAPNAESID  755

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E ARA++ EMPVELLRASLPHT+E Q+K+L+NF Q S+P+ GFN+ GGSS +IN ESV
Sbjct  756  SEAARAVSREMPVELLRASLPHTDESQKKLLLNFAQRSMPVTGFNAHGGSSGQINPESV  814


 Score = 36.2 bits (82),  Expect(3) = 6e-42, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GSPAGDG    LK
Sbjct  669  SEQPPLRPVGSPAGDGASVILK  690


 Score = 26.9 bits (58),  Expect(3) = 6e-42, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GAS+ILKSVLER  +
Sbjct  682  GDGASVILKSVLERATV  698



>ref|XP_004239250.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321026.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321027.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321028.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
Length=820

 Score =   156 bits (395),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -3

Query  649  KGASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDV  473
            +GA++LLTD +AA+SFSMPNPALWQASFDAFF LLTKYC+ K+D+IMQ++ AQ++   ++
Sbjct  698  EGATHLLTDSKAASSFSMPNPALWQASFDAFFGLLTKYCLSKYDSIMQSILAQSQPDAEI  757

Query  472  ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAES  293
            I  E ARA++ EMPVELLRASLPHTN+ Q+K+L+NF Q S+P+ GF+S GGSS  I+ ES
Sbjct  758  IGAEAARAVSREMPVELLRASLPHTNDHQKKLLLNFAQRSMPVTGFSSHGGSSGHIDPES  817

Query  292  VSC  284
            VSC
Sbjct  818  VSC  820


 Score = 39.3 bits (90),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 22/31 (71%), Gaps = 1/31 (3%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK-ICSGKGHL  637
            SEQPPLRPLGSPAGDG    LK +  G  HL
Sbjct  673  SEQPPLRPLGSPAGDGASIILKSVLEGATHL  703



>ref|XP_011100381.1| PREDICTED: uncharacterized protein LOC105178578 [Sesamum indicum]
Length=815

 Score =   158 bits (400),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+YLL DPQ +++FS+PNP LWQASFDAFF LLTKYCV K+D+I+Q+ +AQ   +T+ I 
Sbjct  695  ATYLLRDPQFSSNFSIPNPTLWQASFDAFFGLLTKYCVSKYDSIVQSLIAQNVPNTEAIG  754

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E ARA++ E+PVELLRASLPHT+E Q+K+L+NF Q S+P+ GFN+  GSS +IN ESV
Sbjct  755  SEAARAVSREIPVELLRASLPHTDESQKKLLLNFAQRSMPVTGFNAHSGSSAQINPESV  813


 Score = 32.0 bits (71),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SE+PPLRP+GSPA DG    LK
Sbjct  668  SERPPLRPVGSPARDGASVILK  689


 Score = 24.6 bits (52),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  680  GASLILKSVLERGI  639
            GAS+ILKSVLER  
Sbjct  683  GASVILKSVLERAT  696



>emb|CDP16041.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 98/119 (82%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A++LLT+ +AA ++S+PNPALWQASFDAFF LLTKYC+ K+D+I+Q++  Q +   ++  
Sbjct  718  ATHLLTESKAAGNYSIPNPALWQASFDAFFGLLTKYCLSKYDSIVQSIFNQNQPDAEMNV  777

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            PE ARA++ EMPVELLRASLPHT+E QRK+L+NF Q S+PL GFN+ GGSS +IN ESV
Sbjct  778  PEAARAVSREMPVELLRASLPHTDERQRKLLLNFAQRSMPLTGFNAHGGSSGQINPESV  836



>ref|XP_002264820.1| PREDICTED: protein PAT1 homolog 1-like [Vitis vinifera]
Length=812

 Score =   150 bits (379),  Expect(3) = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP  A   SMPN ALWQASFD FF LLTKYC+ K++ I+Q++ +QT+  T++IS
Sbjct  693  ATELLTDPHVAGKCSMPNRALWQASFDEFFSLLTKYCLSKYETIIQSIFSQTQPGTEIIS  752

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  RAI+ EMPVELLRASLPHT+E QRK+L++F Q S+P+ GFN+R GSS ++ +ESV
Sbjct  753  SESTRAISREMPVELLRASLPHTDEHQRKLLLDFAQRSMPITGFNTR-GSSGQVTSESV  810


 Score = 36.6 bits (83),  Expect(3) = 3e-40, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  666  SEQPPLRPLGSPAGDGASIILK  687


 Score = 26.6 bits (57),  Expect(3) = 3e-40, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  679  GDGASIILKSVLERAT  694



>emb|CAN68728.1| hypothetical protein VITISV_033604 [Vitis vinifera]
Length=867

 Score =   150 bits (378),  Expect(3) = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP  A   SMPN ALWQASFD FF LLTKYC+ K++ I+Q++ +QT+  T++IS
Sbjct  748  ATELLTDPHVAGKCSMPNRALWQASFDEFFSLLTKYCLSKYETIIQSIFSQTQPGTEIIS  807

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  RAI+ EMPVELLRASLPHT+E QRK+L++F Q S+P+ GFN+R GSS ++ +ESV
Sbjct  808  SESTRAISREMPVELLRASLPHTDEHQRKLLLDFAQRSMPITGFNTR-GSSGQVTSESV  865


 Score = 36.6 bits (83),  Expect(3) = 4e-40, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  721  SEQPPLRPLGSPAGDGASIILK  742


 Score = 26.6 bits (57),  Expect(3) = 4e-40, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  734  GDGASIILKSVLER  747



>ref|XP_004303935.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=806

 Score =   144 bits (364),  Expect(3) = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP A  + S+ N ALWQASFD FF LLTKYC+ K++ I+Q++  QT+ S++VI 
Sbjct  686  ATVLLTDPHAVGNCSVSNRALWQASFDEFFGLLTKYCLSKYETILQSIFTQTQQSSEVIG  745

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  +AI+ EMPVELLRASLPHTNE QRK+L +F   S+P++G N+ GGS  ++N+ESV
Sbjct  746  SEATKAIHREMPVELLRASLPHTNENQRKLLSDFAHRSMPISGLNAHGGSGGQMNSESV  804


 Score = 37.4 bits (85),  Expect(3) = 1e-38, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  659  SEQPPLRPLGSPAGDGATIILK  680


 Score = 25.8 bits (55),  Expect(3) = 1e-38, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GA++ILKSVLER  +
Sbjct  672  GDGATIILKSVLERATV  688



>ref|XP_010907163.1| PREDICTED: uncharacterized protein LOC105033889 [Elaeis guineensis]
Length=821

 Score =   147 bits (371),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP A +++SM N ALWQASFDAFF LLTKYC+ K+D+I+Q +      T +I  
Sbjct  702  ATDLLTDPHATSNYSMSNRALWQASFDAFFGLLTKYCLSKYDSILQMLLMQALDTSIIGS  761

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ARAI+ EMPVELLRASLPHTNE QRKML++F Q S+P+ GF+  G  S  + +ESV
Sbjct  762  EAARAISREMPVELLRASLPHTNEHQRKMLLDFAQRSMPVTGFSVHGSGSGPVTSESV  819


 Score = 34.3 bits (77),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  675  SEQPPLRPLGSSAGDGASMILK  696


 Score = 25.4 bits (54),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVL+R
Sbjct  688  GDGASMILKSVLDR  701



>ref|XP_008342293.1| PREDICTED: protein PAT1 homolog 1-like [Malus domestica]
Length=803

 Score =   143 bits (360),  Expect(3) = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+DP AA S S+ N  LWQASFD FF LLTKYC+ K++ I+Q++  Q++ S +VI 
Sbjct  683  ATVLLSDPHAAGSCSISNRTLWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSAEVIG  742

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  RAI+ EMPVELLRASLPHT+E QRK+L +F   S+P++G N+ GGS  ++N+ESV
Sbjct  743  SEATRAIHREMPVELLRASLPHTDEHQRKLLSDFSHRSMPISGLNAHGGSGGQMNSESV  801


 Score = 37.4 bits (85),  Expect(3) = 5e-38, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  656  SEQPPLRPLGSPAGDGATIILK  677


 Score = 25.8 bits (55),  Expect(3) = 5e-38, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GA++ILKSVLER  +
Sbjct  669  GDGATIILKSVLERATV  685



>ref|XP_009377953.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=817

 Score =   143 bits (360),  Expect(3) = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+DP AA S S+ N  LWQASFD FF LLTKYC+ K++ I+Q++  Q++ S +VI 
Sbjct  697  ATVLLSDPHAAGSCSISNRTLWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSAEVIG  756

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  RAI+ EMPVELLRASLPHT+E QRK+L +F   S+P++G N+ GGS  ++N+ESV
Sbjct  757  SEATRAIHREMPVELLRASLPHTDEHQRKLLSDFAHRSMPISGLNAHGGSGGQMNSESV  815


 Score = 37.4 bits (85),  Expect(3) = 5e-38, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  670  SEQPPLRPLGSPAGDGATIILK  691


 Score = 25.8 bits (55),  Expect(3) = 5e-38, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GA++ILKSVLER  +
Sbjct  683  GDGATIILKSVLERATV  699



>ref|XP_008793552.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Phoenix dactylifera]
Length=815

 Score =   145 bits (367),  Expect(3) = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ +LT+P AA+++SM N ALWQASFDAFF LLTKYC  K+D+I+Q +     +T +I  
Sbjct  696  ATDVLTEPHAASNYSMSNRALWQASFDAFFGLLTKYCGSKYDSILQMLHMQALNTSIIGS  755

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ARA++ EMPVELLRASLPHTNE QRKML++F Q S P+ GF+  GG S  + +ESV
Sbjct  756  EAARAVSREMPVELLRASLPHTNEHQRKMLLDFAQRSKPVTGFSVHGGGSGPVTSESV  813


 Score = 34.3 bits (77),  Expect(3) = 8e-38, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  669  SEQPPLRPLGSSAGDGASMILK  690


 Score = 25.4 bits (54),  Expect(3) = 8e-38, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVL+R
Sbjct  682  GDGASMILKSVLDR  695



>ref|XP_008793553.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Phoenix dactylifera]
Length=688

 Score =   145 bits (366),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ +LT+P AA+++SM N ALWQASFDAFF LLTKYC  K+D+I+Q +     +T +I  
Sbjct  569  ATDVLTEPHAASNYSMSNRALWQASFDAFFGLLTKYCGSKYDSILQMLHMQALNTSIIGS  628

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ARA++ EMPVELLRASLPHTNE QRKML++F Q S P+ GF+  GG S  + +ESV
Sbjct  629  EAARAVSREMPVELLRASLPHTNEHQRKMLLDFAQRSKPVTGFSVHGGGSGPVTSESV  686


 Score = 34.3 bits (77),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  542  SEQPPLRPLGSSAGDGASMILK  563


 Score = 25.4 bits (54),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVL+R
Sbjct  555  GDGASMILKSVLDR  568



>ref|XP_010243929.1| PREDICTED: protein PAT1 homolog 1-like [Nelumbo nucifera]
Length=826

 Score =   146 bits (369),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLT+PQAA++++M N ALWQASFDAFF LLTKYCV K+D+I+Q++  Q   +T  I 
Sbjct  705  ATELLTNPQAASNYNMQNRALWQASFDAFFTLLTKYCVSKYDSIVQSLLMQAPPNTASIG  764

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG-GSSRKINAESV  290
             E ARAI+ EMP+ELLRAS+PHTNE QRK+L++F Q S+P+ GFN+ G GS  ++N+ESV
Sbjct  765  SEAARAISREMPIELLRASIPHTNEHQRKILLDFAQRSMPVTGFNTHGNGSGGQMNSESV  824


 Score = 34.7 bits (78),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  678  SEQPPLRPLGSSAGDGASVLLK  699


 Score = 23.9 bits (50),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++LKSVL+R
Sbjct  691  GDGASVLLKSVLDR  704



>gb|ACF84116.1| unknown [Zea mays]
Length=199

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++PN ALWQASFDAFF LLTKYCV KF++I Q    T+T +  I P
Sbjct  81   ATELLTDRHAAASYTVPNRALWQASFDAFFGLLTKYCVSKFESIQQMFV-TQTPSSGIGP  139

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ L++F Q S+P+ GFN  G     I +ESV
Sbjct  140  EASKATSKEMPVELLRASLPHTNEQQRQRLLDFAQRSMPVTGFNPSGARGGHITSESV  197



>ref|XP_010243918.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Nelumbo nucifera]
Length=825

 Score =   147 bits (372),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLT+PQAA+++SM N ALWQASFDAFF LLTKYC+ K+D+I+Q++  Q   +T  I 
Sbjct  704  ATELLTNPQAASNYSMQNRALWQASFDAFFTLLTKYCLSKYDSILQSLLMQAPPNTASIG  763

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG-GSSRKINAESV  290
             E ARAI+ EMP+ELLR+SLPHTNE QRK+L++F Q S+P+ GFN+ G GS  +IN+ESV
Sbjct  764  SEAARAISREMPIELLRSSLPHTNEHQRKILLDFAQRSMPVTGFNAHGSGSGSQINSESV  823


 Score = 34.7 bits (78),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  677  SEQPPLRPLGSTAGDGASVILK  698



>ref|XP_010243919.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Nelumbo nucifera]
Length=824

 Score =   147 bits (372),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLT+PQAA+++SM N ALWQASFDAFF LLTKYC+ K+D+I+Q++  Q   +T  I 
Sbjct  703  ATELLTNPQAASNYSMQNRALWQASFDAFFTLLTKYCLSKYDSILQSLLMQAPPNTASIG  762

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG-GSSRKINAESV  290
             E ARAI+ EMP+ELLR+SLPHTNE QRK+L++F Q S+P+ GFN+ G GS  +IN+ESV
Sbjct  763  SEAARAISREMPIELLRSSLPHTNEHQRKILLDFAQRSMPVTGFNAHGSGSGSQINSESV  822


 Score = 34.7 bits (78),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  676  SEQPPLRPLGSTAGDGASVILK  697



>ref|XP_010923783.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923784.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923785.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
Length=814

 Score =   147 bits (370),  Expect(3) = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLT   AA+++SM N ALWQASFDAFF LLTKYC+ K+D+IMQ +     +T +I  
Sbjct  695  ATELLTGSHAASNYSMSNRALWQASFDAFFGLLTKYCLSKYDSIMQMLLMQAPNTSIIGS  754

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ARAI+ EMPVELLRASLPHTNE QR+ML++F Q S+P+ GF++ GG S  + +ESV
Sbjct  755  EAARAISREMPVELLRASLPHTNEHQRQMLLDFAQRSMPVTGFSAHGGGSGPVTSESV  812


 Score = 33.5 bits (75),  Expect(3) = 6e-37, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    +K
Sbjct  668  SEQPPLRPLGSSAGDGASIIIK  689


 Score = 22.3 bits (46),  Expect(3) = 6e-37, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -2

Query  686  GMGASLILKSVLE  648
            G GAS+I+KSVL+
Sbjct  681  GDGASIIIKSVLD  693



>ref|XP_008229675.1| PREDICTED: protein PAT1 homolog 1-like [Prunus mume]
Length=808

 Score =   139 bits (350),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ +L+DP AA + S PN ALWQASFD FF LLTKYC+ K++ I+Q +  Q + ST+VI 
Sbjct  688  ATEILSDPHAAGNCSRPNRALWQASFDEFFGLLTKYCLSKYETIVQTIFTQPQQSTEVIG  747

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  +AI+ EMPVELLRASLPHT+E QRK+L +F Q S+P+AG N+ GG   ++N+ESV
Sbjct  748  SEATKAIHREMPVELLRASLPHTDERQRKLLSDFAQRSMPIAGLNAHGGGGGQMNSESV  806


 Score = 36.2 bits (82),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP+GDG    LK
Sbjct  661  SEQPPLRPLGSPSGDGATIILK  682


 Score = 25.4 bits (54),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA++ILKSVLER
Sbjct  674  GDGATIILKSVLER  687



>ref|XP_010036063.1| PREDICTED: protein PAT1 homolog 1-like [Eucalyptus grandis]
 gb|KCW47590.1| hypothetical protein EUGRSUZ_K01336 [Eucalyptus grandis]
Length=806

 Score =   144 bits (364),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLT   A NS SMPN ALWQASF+ FF LLTKYC+ K++ I Q++ AQT+ S+++I 
Sbjct  686  ATDLLTGLHAPNSCSMPNRALWQASFNEFFALLTKYCLTKYETIAQSILAQTQVSSEIIG  745

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  RAIN EMPVELLRASLPHT+E QRK+L++F Q S+P+  FN+R G S + N+ESV
Sbjct  746  TEATRAINREMPVELLRASLPHTDENQRKLLLDFAQRSMPINAFNARMGGSSQTNSESV  804


 Score = 34.7 bits (78),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  659  SEQPPLRPLGSAAGDGASVILK  680



>ref|XP_007217055.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
 gb|EMJ18254.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
Length=886

 Score =   136 bits (342),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ +L+DP AA + S PN ALWQASFD FF LLTKYC+ K++ I+Q +  Q + ST+VI 
Sbjct  766  ATEILSDPLAAGNCSRPNRALWQASFDEFFGLLTKYCLSKYETIVQTIFTQPQQSTEVIG  825

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  +AI+ EMPVELLRASLPHT+E QRK+L +F Q S+P++G N+ GG   ++N+ESV
Sbjct  826  SEATKAIHREMPVELLRASLPHTDERQRKLLSDFAQRSMPISGLNAHGGGGGQMNSESV  884


 Score = 36.2 bits (82),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP+GDG    LK
Sbjct  739  SEQPPLRPLGSPSGDGATIILK  760


 Score = 25.4 bits (54),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA++ILKSVLER
Sbjct  752  GDGATIILKSVLER  765



>ref|XP_010645006.1| PREDICTED: uncharacterized protein LOC100267869 isoform X1 [Vitis 
vinifera]
Length=828

 Score =   137 bits (344),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ +LTDP  A + +M N ALWQASFD FF LLTKYC+ K+D+IMQ++  Q  ++   + 
Sbjct  707  ATEILTDPHVAGNCNMNNRALWQASFDEFFGLLTKYCLNKYDSIMQSLLMQASSNMTAVG  766

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI+ EMPVELLRASLPHTNE Q+K+L++F   S+P+ GFNS+ GGS   +N+ESV
Sbjct  767  ADAARAISREMPVELLRASLPHTNEHQKKLLLDFAHRSMPVMGFNSQGGGSGSHVNSESV  826


 Score = 34.7 bits (78),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  680  SEQPPLRPLGSSAGDGASVILK  701


 Score = 26.2 bits (56),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  693  GDGASVILKSVLER  706



>ref|XP_003545913.2| PREDICTED: uncharacterized protein LOC100787648 [Glycine max]
 gb|KHN27738.1| Protein PAT1 like 1 [Glycine soja]
Length=886

 Score =   143 bits (360),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA +F+M N + WQASFD FF LLTKYC+ K+ +IMQ+ + Q+ +  D I 
Sbjct  765  ATELLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCMNKYHSIMQSMLIQSTSDVDDIG  824

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
            P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q SIP+ GFNS  GGS   +N+E+V
Sbjct  825  PDAAKSIGREMPVELLRASLPHTDERQRKLLLDFAQRSIPVVGFNSNTGGSGSHVNSETV  884


 Score = 30.4 bits (67),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            +EQPPLRP+GS +GDG 
Sbjct  738  AEQPPLRPIGSTSGDGA  754


 Score = 23.9 bits (50),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLIL SVLER  
Sbjct  751  GDGASLILISVLERAT  766



>ref|XP_009406732.1| PREDICTED: uncharacterized protein LOC103989576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=811

 Score =   139 bits (349),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP AAN++++ +  LWQASFDAFF LLTKYC+ K+D+IMQ +     ST V+  
Sbjct  692  ATDLLTDPHAANNYTVSSRTLWQASFDAFFGLLTKYCLSKYDSIMQMLLMQAPSTAVVGS  751

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E  RAI+ EMPVELL ASLPHTN+ QRK+L++F Q S+P+   ++ GG+SR  ++ESV
Sbjct  752  EATRAISREMPVELLHASLPHTNDHQRKVLLDFAQRSMPVVRVSTHGGNSRPESSESV  809


 Score = 33.9 bits (76),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    +K
Sbjct  665  SEQPPLRPLGSSAGDGASIIIK  686


 Score = 24.6 bits (52),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+I+KSVL+R
Sbjct  678  GDGASIIIKSVLDR  691



>ref|XP_010645007.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Vitis vinifera]
Length=781

 Score =   136 bits (343),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ +LTDP  A + +M N ALWQASFD FF LLTKYC+ K+D+IMQ++  Q  ++   + 
Sbjct  660  ATEILTDPHVAGNCNMNNRALWQASFDEFFGLLTKYCLNKYDSIMQSLLMQASSNMTAVG  719

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI+ EMPVELLRASLPHTNE Q+K+L++F   S+P+ GFNS+ GGS   +N+ESV
Sbjct  720  ADAARAISREMPVELLRASLPHTNEHQKKLLLDFAHRSMPVMGFNSQGGGSGSHVNSESV  779


 Score = 34.3 bits (77),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  633  SEQPPLRPLGSSAGDGASVILK  654


 Score = 26.2 bits (56),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  646  GDGASVILKSVLER  659



>ref|XP_010645008.1| PREDICTED: protein PAT1 homolog 1 isoform X3 [Vitis vinifera]
Length=778

 Score =   136 bits (343),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ +LTDP  A + +M N ALWQASFD FF LLTKYC+ K+D+IMQ++  Q  ++   + 
Sbjct  657  ATEILTDPHVAGNCNMNNRALWQASFDEFFGLLTKYCLNKYDSIMQSLLMQASSNMTAVG  716

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI+ EMPVELLRASLPHTNE Q+K+L++F   S+P+ GFNS+ GGS   +N+ESV
Sbjct  717  ADAARAISREMPVELLRASLPHTNEHQKKLLLDFAHRSMPVMGFNSQGGGSGSHVNSESV  776


 Score = 34.3 bits (77),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  630  SEQPPLRPLGSSAGDGASVILK  651


 Score = 26.2 bits (56),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  643  GDGASVILKSVLER  656



>ref|XP_008383068.1| PREDICTED: uncharacterized protein LOC103445792 isoform X2 [Malus 
domestica]
Length=824

 Score =   136 bits (343),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++++M N  LWQASFD FF LLTKYCV K+D +MQ+ + Q   +  VI 
Sbjct  703  ATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCVNKYDTVMQSLLTQAPPNVTVIG  762

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI  EMPVELLRASLPHT+E QR++L++F Q S+P+   NSR GG+   +N+ESV
Sbjct  763  SDAARAIGREMPVELLRASLPHTDEHQRQLLLDFTQRSMPIGASNSRDGGNGAHMNSESV  822


 Score = 35.0 bits (79),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  676  SEQPPLRPLGSPAGDGA  692


 Score = 25.4 bits (54),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  689  GDGASLILNSVLER  702



>ref|XP_008383066.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Malus domestica]
Length=844

 Score =   136 bits (343),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++++M N  LWQASFD FF LLTKYCV K+D +MQ+ + Q   +  VI 
Sbjct  723  ATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCVNKYDTVMQSLLTQAPPNVTVIG  782

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI  EMPVELLRASLPHT+E QR++L++F Q S+P+   NSR GG+   +N+ESV
Sbjct  783  SDAARAIGREMPVELLRASLPHTDEHQRQLLLDFTQRSMPIGASNSRDGGNGAHMNSESV  842


 Score = 35.0 bits (79),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  696  SEQPPLRPLGSPAGDGA  712


 Score = 25.4 bits (54),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  709  GDGASLILNSVLER  722



>ref|XP_010062704.1| PREDICTED: protein PAT1 homolog 1 [Eucalyptus grandis]
 gb|KCW69830.1| hypothetical protein EUGRSUZ_F03181 [Eucalyptus grandis]
Length=841

 Score =   133 bits (335),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV--AQTETSTDVI  470
            A+ LLTDPQA  ++++ N  LWQASFD F+ LLTKYCV K+D+I+Q++      TS  VI
Sbjct  719  ATELLTDPQAGTNYTITNRQLWQASFDEFYVLLTKYCVNKYDSIIQSLLLQAPMTSMPVI  778

Query  469  SPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAES  293
              + A+AI+ EMPVELLRASLPHT+E QRK+L++F Q S+P+ G NS  GG+  +I++ES
Sbjct  779  GADAAKAISREMPVELLRASLPHTDEDQRKLLLDFAQRSMPVVGLNSHEGGNGGQISSES  838

Query  292  V  290
            V
Sbjct  839  V  839


 Score = 37.0 bits (84),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  692  SEQPPLRPLGSPAGDGATLILK  713


 Score = 26.2 bits (56),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA+LILKSVLER
Sbjct  705  GDGATLILKSVLER  718



>ref|XP_010926895.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Elaeis guineensis]
Length=794

 Score =   140 bits (354),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA ++SM N ALWQASFDAFF LLTKYC  K+D IMQ+     +S   I  
Sbjct  675  ATELLTDRHAATNYSMSNRALWQASFDAFFGLLTKYCENKYDTIMQSSHMQASSAGFIGS  734

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            +  RAI+ EMPVELLRASLPHT+E QR +L++F Q S+P+ G+N+RGG +  I++ESV
Sbjct  735  DAPRAISKEMPVELLRASLPHTDEHQRMLLLDFAQRSMPVIGYNARGGGNGPISSESV  792


 Score = 32.3 bits (72),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GS AGDG    +K
Sbjct  648  SEQPPLRPVGSSAGDGASIIIK  669


 Score = 23.5 bits (49),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -2

Query  686  GMGASLILKSVLE  648
            G GAS+I+KSVLE
Sbjct  661  GDGASIIIKSVLE  673



>ref|XP_010926894.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Elaeis guineensis]
Length=822

 Score =   140 bits (353),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA ++SM N ALWQASFDAFF LLTKYC  K+D IMQ+     +S   I  
Sbjct  703  ATELLTDRHAATNYSMSNRALWQASFDAFFGLLTKYCENKYDTIMQSSHMQASSAGFIGS  762

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            +  RAI+ EMPVELLRASLPHT+E QR +L++F Q S+P+ G+N+RGG +  I++ESV
Sbjct  763  DAPRAISKEMPVELLRASLPHTDEHQRMLLLDFAQRSMPVIGYNARGGGNGPISSESV  820


 Score = 32.3 bits (72),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GS AGDG    +K
Sbjct  676  SEQPPLRPVGSSAGDGASIIIK  697


 Score = 23.5 bits (49),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -2

Query  686  GMGASLILKSVLE  648
            G GAS+I+KSVLE
Sbjct  689  GDGASIIIKSVLE  701



>ref|XP_009345080.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=823

 Score =   134 bits (338),  Expect(3) = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++++M N  LWQASFD FF LLTKYCV K+D +MQ+ + Q   +  VI 
Sbjct  702  ATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCVNKYDTVMQSLLMQAPPNVAVIG  761

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI  EMPVELLRASLPHT+E QR++LM+F Q S+P+   NS  GG+   +N+ESV
Sbjct  762  SDAARAIGREMPVELLRASLPHTDEHQRQLLMDFTQRSMPIGASNSHDGGNGAHMNSESV  821


 Score = 35.0 bits (79),  Expect(3) = 8e-35, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  675  SEQPPLRPLGSPAGDGA  691


 Score = 25.4 bits (54),  Expect(3) = 8e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  688  GDGASLILNSVLER  701



>ref|XP_009345081.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=734

 Score =   134 bits (338),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++++M N  LWQASFD FF LLTKYCV K+D +MQ+ + Q   +  VI 
Sbjct  613  ATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCVNKYDTVMQSLLMQAPPNVAVIG  672

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + ARAI  EMPVELLRASLPHT+E QR++LM+F Q S+P+   NS  GG+   +N+ESV
Sbjct  673  SDAARAIGREMPVELLRASLPHTDEHQRQLLMDFTQRSMPIGASNSHDGGNGAHMNSESV  732


 Score = 35.0 bits (79),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  586  SEQPPLRPLGSPAGDGA  602


 Score = 25.0 bits (53),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  599  GDGASLILNSVLER  612



>ref|XP_006585424.1| PREDICTED: uncharacterized protein LOC100812450 isoform X2 [Glycine 
max]
Length=938

 Score =   140 bits (354),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ +LTDP AA +F+M N + WQASFD FF LLTKYC+ K+ +IMQ+ + Q+ ++ D I 
Sbjct  817  ATEVLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCMNKYHSIMQSMLIQSTSNVDDIG  876

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
            P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q S+P+ GFNS  GGS   +N+E+V
Sbjct  877  PDAAKSIGREMPVELLRASLPHTDEHQRKLLLDFAQRSVPVVGFNSNTGGSGGHVNSETV  936


 Score = 30.4 bits (67),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            +EQPPLRP+GS +GDG 
Sbjct  790  AEQPPLRPIGSTSGDGA  806


 Score = 23.5 bits (49),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASL+L SVLER  
Sbjct  803  GDGASLVLISVLERAT  818



>ref|XP_004488834.1| PREDICTED: uncharacterized protein LOC101500903 [Cicer arietinum]
Length=879

 Score =   140 bits (352),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP AA +++M N + WQASFD FF LLTKYC+ K+ +IMQ++  Q+ T+ D I 
Sbjct  758  AAELLTDPHAACNYNMGNRSFWQASFDEFFGLLTKYCMNKYHSIMQSLLIQSTTNVDDIG  817

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
            P+ A AI+ EMPVELLRASLPHT++ QRK+L++F Q S+P+ GFNS  GGS   +N+E+V
Sbjct  818  PDAANAISKEMPVELLRASLPHTDDRQRKLLLDFAQRSVPVVGFNSNAGGSGGLVNSETV  877


 Score = 29.6 bits (65),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            +E PPLRP+GS AGDG 
Sbjct  731  AEHPPLRPVGSTAGDGA  747


 Score = 24.3 bits (51),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  744  GDGASLILVSVLER  757



>ref|NP_001140581.1| uncharacterized protein LOC100272651 [Zea mays]
 gb|ACN25795.1| unknown [Zea mays]
 gb|ACN33341.1| unknown [Zea mays]
 tpg|DAA57454.1| TPA: hypothetical protein ZEAMMB73_966891 [Zea mays]
Length=807

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++PN ALWQASFDAFF LLTKYCV KF++I Q    T+T +  I P
Sbjct  689  ATELLTDRHAAASYTVPNRALWQASFDAFFGLLTKYCVSKFESIQQMFV-TQTPSSGIGP  747

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ L++F Q S+P+ GFN  G     I +ESV
Sbjct  748  EASKATSKEMPVELLRASLPHTNEQQRQRLLDFAQRSMPVTGFNPSGARGGHITSESV  805



>ref|XP_003532940.1| PREDICTED: uncharacterized protein LOC100812450 isoform X1 [Glycine 
max]
Length=886

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ +LTDP AA +F+M N + WQASFD FF LLTKYC+ K+ +IMQ+ + Q+ ++ D I 
Sbjct  765  ATEVLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCMNKYHSIMQSMLIQSTSNVDDIG  824

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
            P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q S+P+ GFNS  GGS   +N+E+V
Sbjct  825  PDAAKSIGREMPVELLRASLPHTDEHQRKLLLDFAQRSVPVVGFNSNTGGSGGHVNSETV  884



>ref|XP_011097653.1| PREDICTED: protein PAT1 homolog 1 [Sesamum indicum]
Length=817

 Score =   132 bits (333),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP AA + S PN A WQASFDAFF LLTKYC  K+D+++Q+      S   I  
Sbjct  703  ATELLTDPHAAGNCSPPNRAFWQASFDAFFGLLTKYCFNKYDSVVQSFLSQGPSEATIGA  762

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKIN  302
            +VA+AI+ EMPVELLRASLPHT+E QRK+L+ F Q S+P+ GF  + G S ++N
Sbjct  763  DVAKAISKEMPVELLRASLPHTSEQQRKLLLEFAQRSMPVLGFGGQSGGSAQMN  816


 Score = 33.1 bits (74),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +E PPLRP+GSPAGDG    LK
Sbjct  676  AEHPPLRPIGSPAGDGASVILK  697


 Score = 26.2 bits (56),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKSVLER
Sbjct  689  GDGASVILKSVLER  702



>gb|KJB10632.1| hypothetical protein B456_001G212600 [Gossypium raimondii]
Length=796

 Score =   130 bits (326),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            AS LL+ P  + + SMPN  LW+ASFD FF LLTKYCV K++ I+Q++  QT+ +T+VI 
Sbjct  681  ASQLLSHP--SGNCSMPNYTLWRASFDEFFALLTKYCVSKYETIIQSIHNQTQPTTEVIG  738

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E   AI  EMP ELLRASLPHTNE Q+K+LM+F Q S+P+ G NS  GS+ +IN+E+V
Sbjct  739  SE---AIRREMPCELLRASLPHTNESQKKLLMDFSQRSVPMNGSNSPAGSTSRINSETV  794


 Score = 36.6 bits (83),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    +K
Sbjct  654  SEQPPLRPLGSPAGDGASVIIK  675


 Score = 25.4 bits (54),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+I+KSVLER
Sbjct  667  GDGASVIIKSVLER  680



>gb|KHG26425.1| Protein PAT1 [Gossypium arboreum]
Length=795

 Score =   130 bits (326),  Expect(3) = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            AS LL+ P  + + SMPN  LW+ASFD FF LLTKYCV K++ I+Q++  Q + +T+VI 
Sbjct  680  ASQLLSHP--SGNCSMPNYTLWRASFDEFFALLTKYCVSKYETIIQSIHNQPQPTTEVIG  737

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+P+ G NS  GS+ +IN+ESV
Sbjct  738  SE---AIRREMPCELLRASLPHTNESQRKLLMDFSQRSVPMNGSNSPAGSTSRINSESV  793


 Score = 36.6 bits (83),  Expect(3) = 8e-34, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    +K
Sbjct  653  SEQPPLRPLGSPAGDGASVIIK  674


 Score = 25.4 bits (54),  Expect(3) = 8e-34, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+I+KSVLER
Sbjct  666  GDGASVIIKSVLER  679



>ref|XP_003545912.1| PREDICTED: protein PAT1 homolog 1-like [Glycine max]
Length=828

 Score =   137 bits (346),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA+++++ N +LWQA+FD FF LLTKYCV K+D++MQ+ + Q   +   I 
Sbjct  707  ATELLTDPHAASNYNIANRSLWQATFDEFFGLLTKYCVNKYDSVMQSFLIQGTPNMASIG  766

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             +VARAI+ EMPVELLRASLPHT++ Q+K L++F Q SIP+ GFNS  GG    +N+ESV
Sbjct  767  SDVARAISKEMPVELLRASLPHTDDRQKKQLLDFAQRSIPIVGFNSNSGGQGHHVNSESV  826


 Score = 29.6 bits (65),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SE PPLRPLGS AGDG 
Sbjct  680  SEPPPLRPLGSSAGDGA  696


 Score = 24.3 bits (51),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  693  GDGASLILVSVLER  706



>ref|XP_008378353.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441447 
[Malus domestica]
Length=804

 Score =   128 bits (321),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+DP AA S S+ N ALWQASFD FF LLTKYC+ K++ I+Q++  Q++ ST+ I 
Sbjct  684  ATVLLSDPHAAGSCSISNRALWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSTEAIG  743

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  +AI+ EMPVELLRASLPHT+E QRK+L +F   S+P++G N  GG+  ++N+ESV
Sbjct  744  SEATKAIHREMPVELLRASLPHTDERQRKLLSDFAHRSMPISGLNGHGGNGGQMNSESV  802


 Score = 37.4 bits (85),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  657  SEQPPLRPLGSPAGDGATIILK  678


 Score = 26.2 bits (56),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GA++ILKSVLER  +
Sbjct  670  GDGATIILKSVLERATV  686



>ref|XP_009375342.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=801

 Score =   128 bits (321),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+DP AA S S+ N ALWQASFD FF LLTKYC+ K++ I+Q++  Q++ ST+ I 
Sbjct  681  ATVLLSDPHAAGSCSISNRALWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSTEAIG  740

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  +AI+ EMPVELLRASLPHT+E QRK+L +F   S+P++G N  GG+  ++N+ESV
Sbjct  741  SEATKAIHREMPVELLRASLPHTDERQRKLLSDFAHRSMPISGLNGHGGNGGQMNSESV  799


 Score = 37.4 bits (85),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  654  SEQPPLRPLGSPAGDGATIILK  675


 Score = 26.2 bits (56),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GA++ILKSVLER  +
Sbjct  667  GDGATIILKSVLERATV  683



>ref|XP_009375341.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=804

 Score =   127 bits (320),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+DP AA S S+ N ALWQASFD FF LLTKYC+ K++ I+Q++  Q++ ST+ I 
Sbjct  684  ATVLLSDPHAAGSCSISNRALWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSTEAIG  743

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E  +AI+ EMPVELLRASLPHT+E QRK+L +F   S+P++G N  GG+  ++N+ESV
Sbjct  744  SEATKAIHREMPVELLRASLPHTDERQRKLLSDFAHRSMPISGLNGHGGNGGQMNSESV  802


 Score = 37.4 bits (85),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  657  SEQPPLRPLGSPAGDGATIILK  678


 Score = 26.2 bits (56),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGIL  636
            G GA++ILKSVLER  +
Sbjct  670  GDGATIILKSVLERATV  686



>ref|XP_007214538.1| hypothetical protein PRUPE_ppa002090mg [Prunus persica]
 gb|EMJ15737.1| hypothetical protein PRUPE_ppa002090mg [Prunus persica]
Length=718

 Score =   130 bits (327),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA+++++ N ALWQASFD FF LLTKYCV K+D+IMQ+ + +   +  VI 
Sbjct  597  ATELLTDPHAASNYNVTNRALWQASFDEFFGLLTKYCVNKYDSIMQSRLMEAPPNVPVIG  656

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + A + + EMPVELLRASLPHT+E QR+ML++F Q S+P+   NSR GG+   +N+ESV
Sbjct  657  ADTAISFSREMPVELLRASLPHTDEHQRQMLLDFTQRSMPIGASNSRDGGNGTHMNSESV  716


 Score = 35.4 bits (80),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  570  SEQPPLRPLGSPAGDGA  586


 Score = 25.4 bits (54),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLIL SVLER  
Sbjct  583  GDGASLILNSVLERAT  598



>ref|XP_010109206.1| hypothetical protein L484_002129 [Morus notabilis]
 gb|EXC21328.1| hypothetical protein L484_002129 [Morus notabilis]
Length=816

 Score =   129 bits (325),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++++M N ALWQASFD FF LLTKYC  K+D+IMQ+ + Q  T+T VI 
Sbjct  695  ATELLTDPNAASNYNMQNRALWQASFDEFFGLLTKYCSNKYDSIMQSLLTQGPTNTAVIG  754

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNS-RGGSSRKINAESV  290
             + ARAI+ EMPVEL+RASLPHT+  QR++L++F Q S+ L   N+  GG+  ++N+ESV
Sbjct  755  ADAARAISREMPVELVRASLPHTDVRQRQLLLDFTQRSMSLGASNTPPGGNDGRMNSESV  814


 Score = 33.5 bits (75),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  668  SEQPPLRPLGSSAGDGASLILK  689


 Score = 27.3 bits (59),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLILKSVLER
Sbjct  681  GDGASLILKSVLER  694



>ref|XP_007049006.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
 gb|EOX93163.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
Length=724

 Score =   132 bits (333),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV K++ IMQ++  QT+ +T+VI 
Sbjct  609  ATQLLSHP--SGNCSMPNYAFWRASFDEFFALLTKYCVSKYETIMQSMHTQTQPTTEVIG  666

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+P+ G NS  G++ +IN+ESV
Sbjct  667  SE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSVPMNGSNSHAGNTSQINSESV  722


 Score = 37.4 bits (85),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  582  SEQPPLRPLGSPAGDGASVILK  603



>ref|XP_007049005.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
 gb|EOX93162.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
Length=798

 Score =   132 bits (332),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV K++ IMQ++  QT+ +T+VI 
Sbjct  683  ATQLLSHP--SGNCSMPNYAFWRASFDEFFALLTKYCVSKYETIMQSMHTQTQPTTEVIG  740

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+P+ G NS  G++ +IN+ESV
Sbjct  741  SE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSVPMNGSNSHAGNTSQINSESV  796


 Score = 37.4 bits (85),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  656  SEQPPLRPLGSPAGDGASVILK  677



>ref|XP_004970101.1| PREDICTED: uncharacterized protein LOC101761506 [Setaria italica]
Length=810

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++PN  LWQASFDAFF LLTKYCV KF++I Q     +  + VI P
Sbjct  692  ATELLTDHHAAASYTVPNRTLWQASFDAFFGLLTKYCVSKFESIQQMFV-MQAPSPVIGP  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ L++F Q S+P+ GFN +G     I +ESV
Sbjct  751  EASKATSKEMPVELLRASLPHTNEQQRQRLLDFAQRSMPVTGFNPQGARGGHITSESV  808



>ref|XP_008226080.1| PREDICTED: protein PAT1 homolog 1 [Prunus mume]
Length=833

 Score =   129 bits (324),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA+++++ N ALWQASFD FF LLTKYCV K+D+IMQ+ + +   +  VI 
Sbjct  712  ATELLTDPHAASNYNVTNRALWQASFDEFFGLLTKYCVNKYDSIMQSRLMEAPPNVPVIG  771

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + A + + EMPVELLRASLPHT+E QR+ML++F Q S+P+   N+R GG+   +N+ESV
Sbjct  772  ADTAISFSREMPVELLRASLPHTDEHQRQMLLDFTQRSMPIGASNNRDGGNGTHMNSESV  831


 Score = 35.4 bits (80),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  685  SEQPPLRPLGSPAGDGA  701


 Score = 25.4 bits (54),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  698  GDGASLILNSVLER  711



>gb|KEH38343.1| topoisomerase II-associated protein PAT1 [Medicago truncatula]
Length=880

 Score =   135 bits (341),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ LLTDPQAA +++M N + WQASFD FF L+TKYC+ K+ +IMQ++  Q   + D I 
Sbjct  759  ATELLTDPQAACNYNMGNRSFWQASFDEFFGLITKYCMNKYHSIMQSLLLQNAPNVDDIG  818

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + A+AI+ EMPVELLRASLPHT++ QRK+L++F Q S+P+ GFNS  GGS   +N+E+V
Sbjct  819  SDAAKAISKEMPVELLRASLPHTDDRQRKLLLDFAQRSVPVIGFNSNAGGSGGLVNSETV  878


 Score = 29.6 bits (65),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            +E PPLRP+GS AGDG 
Sbjct  732  AEHPPLRPVGSTAGDGA  748


 Score = 24.3 bits (51),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLIL SVLER  
Sbjct  745  GDGASLILVSVLERAT  760



>ref|XP_004488835.1| PREDICTED: uncharacterized protein LOC101501230 isoform X1 [Cicer 
arietinum]
Length=827

 Score =   134 bits (338),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP+AA+++++ N +LWQASFD FF LLTKYCV K+D+I+Q+ ++Q  ++  VI 
Sbjct  708  ATELLTDPRAASNYNIANRSLWQASFDEFFGLLTKYCVNKYDSIIQSFLSQGTSNMAVIG  767

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
            P+VARAI+ EMPVELLRASLPHT++ Q+K+L++F Q S+   G+NS  GG+   +N++SV
Sbjct  768  PDVARAISREMPVELLRASLPHTDDRQKKILLDFAQRSV--VGYNSNSGGNGHHVNSQSV  825


 Score = 32.0 bits (71),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDG  679
            SE PPLRPLGSPAGDG
Sbjct  681  SEPPPLRPLGSPAGDG  696


 Score = 22.7 bits (47),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G G SLIL SVLER
Sbjct  694  GDGTSLILVSVLER  707



>ref|XP_002456407.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
 gb|EES01527.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
Length=810

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++PN ALWQASFDAFF LLTKYCV KF++I Q       S+  I P
Sbjct  692  ATELLTDRHAAASYTVPNRALWQASFDAFFGLLTKYCVSKFESIQQMFVMQAPSSG-IGP  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ L++F Q S+P+ GFN  G     I +ESV
Sbjct  751  EASKATSKEMPVELLRASLPHTNEQQRQRLLDFAQRSMPVTGFNPSGARGGHITSESV  808



>ref|XP_002520595.1| hypothetical protein RCOM_0673440 [Ricinus communis]
 gb|EEF41828.1| hypothetical protein RCOM_0673440 [Ricinus communis]
Length=739

 Score =   130 bits (328),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL DPQ A S ++PN ALWQASFD FF LLTKYC+ K++ I+Q+V A+  +  + I 
Sbjct  619  ASKLLNDPQTAASRAVPNFALWQASFDEFFDLLTKYCLIKYETILQSVYAKDSSCPEGIE  678

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHTNE Q ++L +FGQ   P+ GFN+  GS+  +N+ESV
Sbjct  679  LEVRAATKREMPVELLRACLPHTNERQMELLRHFGQQRSPITGFNAHSGSNNHMNSESV  737


 Score = 33.9 bits (76),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPP RPLGSP+GDG    LK
Sbjct  593  EQPPFRPLGSPSGDGASVILK  613


 Score = 24.6 bits (52),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKS+LER
Sbjct  605  GDGASVILKSLLER  618



>ref|XP_009416760.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score =   131 bits (329),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP AA+++S+ +  LWQASFDAFF LLTKYC+ K+D+ MQ +     ST +   
Sbjct  717  ATDLLTDPYAASNYSVSSRTLWQASFDAFFGLLTKYCLSKYDSTMQTLLMQAPSTAITGS  776

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E  RAI+ EMP+ELL ASLPHTNE QRK+L++F Q S+P+  F++ G  SR  ++ESV
Sbjct  777  EATRAISREMPIELLHASLPHTNENQRKVLLDFTQRSMPVVHFSTHGVLSRAESSESV  834


 Score = 32.7 bits (73),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  690  SEQPPLRPVGSSAGDGA  706


 Score = 24.6 bits (52),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERG  642
            G GAS+I+KSVL+R 
Sbjct  703  GDGASIIVKSVLDRA  717



>ref|XP_004294192.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=820

 Score =   135 bits (341),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++++M N ALWQASFD FF LLTKYCV K+D IMQ+ +    T+  VI 
Sbjct  702  ATELLTDPNAASNYNMTNRALWQASFDQFFGLLTKYCVNKYDTIMQSLLLHAPTNMAVIG  761

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             + ARAI+ EMPVELLRASLPHT++ QR++L+NF Q S+P+ G N+  G+   IN+ESV
Sbjct  762  SDAARAISREMPVELLRASLPHTDDHQRQLLLNFTQRSMPVGGSNNHDGA--HINSESV  818


 Score = 32.3 bits (72),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  675  SEQPPLRPIGSSAGDGA  691



>ref|XP_009416762.1| PREDICTED: protein PAT1 homolog 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=742

 Score =   131 bits (329),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP AA+++S+ +  LWQASFDAFF LLTKYC+ K+D+ MQ +     ST +   
Sbjct  623  ATDLLTDPYAASNYSVSSRTLWQASFDAFFGLLTKYCLSKYDSTMQTLLMQAPSTAITGS  682

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E  RAI+ EMP+ELL ASLPHTNE QRK+L++F Q S+P+  F++ G  SR  ++ESV
Sbjct  683  EATRAISREMPIELLHASLPHTNENQRKVLLDFTQRSMPVVHFSTHGVLSRAESSESV  740


 Score = 32.7 bits (73),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  596  SEQPPLRPVGSSAGDGA  612


 Score = 24.6 bits (52),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+KSVL+R  
Sbjct  609  GDGASIIVKSVLDRAT  624



>ref|XP_009416761.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=808

 Score =   131 bits (329),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP AA+++S+ +  LWQASFDAFF LLTKYC+ K+D+ MQ +     ST +   
Sbjct  689  ATDLLTDPYAASNYSVSSRTLWQASFDAFFGLLTKYCLSKYDSTMQTLLMQAPSTAITGS  748

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E  RAI+ EMP+ELL ASLPHTNE QRK+L++F Q S+P+  F++ G  SR  ++ESV
Sbjct  749  EATRAISREMPIELLHASLPHTNENQRKVLLDFTQRSMPVVHFSTHGVLSRAESSESV  806


 Score = 32.7 bits (73),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  662  SEQPPLRPVGSSAGDGA  678


 Score = 24.6 bits (52),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+KSVL+R  
Sbjct  675  GDGASIIVKSVLDRAT  690



>ref|XP_006585425.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Glycine max]
Length=682

 Score =   134 bits (337),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA+++++ N +LWQA+FD FF LLTKYCV K+D++MQ+ + Q   +   I 
Sbjct  561  ATELLTDPHAASNYNIANRSLWQATFDEFFGLLTKYCVNKYDSVMQSFLIQGTPNMASIG  620

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGS-SRKINAESV  290
             +VARAI+ EMPVELLRASLPHT++ Q+K L++F Q SIP+ GFNS  G     +N+ESV
Sbjct  621  SDVARAISREMPVELLRASLPHTDDRQKKQLLDFAQRSIPVVGFNSNSGDQGHHVNSESV  680


 Score = 29.6 bits (65),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SE PPLRPLGS AGDG 
Sbjct  534  SEPPPLRPLGSSAGDGA  550


 Score = 24.3 bits (51),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  547  GDGASLILVSVLER  560



>ref|XP_007149276.1| hypothetical protein PHAVU_005G0567001g, partial [Phaseolus vulgaris]
 gb|ESW21270.1| hypothetical protein PHAVU_005G0567001g, partial [Phaseolus vulgaris]
Length=220

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA +++M N + WQASFD FF LLTKYC+ K+ +IMQ+ + Q+ ++ D + 
Sbjct  100  ATELLTDPHAACNYNMGNRSFWQASFDEFFGLLTKYCMNKYHSIMQSMLIQSTSNVDDVG  159

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            P+ A+AI+ EMPVELLRASLPHT+E QRK+L++F Q SIP+ GFN+ GG+   +N+E+V
Sbjct  160  PDAAKAISREMPVELLRASLPHTDERQRKLLLDFAQHSIPVVGFNNTGGNGGHVNSETV  218



>ref|XP_009397355.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=844

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTDP +ANS S+ N +LWQASFDAFF LLTKYC  K+D+I+Q +     +  VI  
Sbjct  725  ATNLLTDPHSANSCSISNRSLWQASFDAFFGLLTKYCWSKYDSILQMLLIQAPNDTVIGS  784

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + +RAI+ EMP++LLRASLPHTNE QR++L++F Q S+P+ GF + G SS    +ESV
Sbjct  785  DASRAISREMPIDLLRASLPHTNEHQREVLLDFAQTSMPITGFRAHGSSSGPATSESV  842



>ref|XP_008775079.1| PREDICTED: protein PAT1 homolog 1-like [Phoenix dactylifera]
Length=808

 Score =   129 bits (323),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA ++SM N ALWQASFDAFF LLTKYC  K+D I Q++     +  +I P
Sbjct  702  ATELLTDRHAATNYSMSNRALWQASFDAFFGLLTKYCQNKYDTITQSLLMQAPNPAIIGP  761

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNS  329
            +  RAI+ EMPVELLRASLPHT+E QRK+L+ F Q S+P+ G+N+
Sbjct  762  DATRAISREMPVELLRASLPHTDEHQRKLLLAFAQRSMPVTGYNA  806


 Score = 32.3 bits (72),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GS AGDG    +K
Sbjct  675  SEQPPLRPVGSSAGDGASIIIK  696


 Score = 25.8 bits (55),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+I+KSVLER
Sbjct  688  GDGASIIIKSVLER  701



>dbj|BAJ90621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   128 bits (322),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  A +S++  N ALWQASFDAFF LLTKYC+ K+++I+Q + + + S  VI  
Sbjct  692  ATELLTDQHAVSSYTSSNRALWQASFDAFFGLLTKYCLSKYESILQ-MFRMQASGSVIGS  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ML++F Q + P + FN  G S   I +ESV
Sbjct  751  EASQATSREMPVELLRASLPHTNEQQRQMLLDFAQRTTPASSFNPPGASGGHITSESV  808


 Score = 33.1 bits (74),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  665  SEQPPLRPLGSSAGDGA  681


 Score = 25.0 bits (53),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  678  GDGASLIIKSVLDR  691



>ref|XP_006597997.1| PREDICTED: uncharacterized protein LOC100779096 isoform X1 [Glycine 
max]
Length=881

 Score =   131 bits (329),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP  A S+ + N + WQASFD FF LLT YC+ K+ +IMQ++  Q   +  VI 
Sbjct  761  ATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCMNKYQSIMQSLLVQGMENVSVIG  819

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNS-RGGSSRKINAESV  290
             + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+P+ GFNS  G SS  +N+E+V
Sbjct  820  SDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQRSVPVVGFNSYTGSSSGHVNSETV  879


 Score = 33.5 bits (75),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  734  SEQPPLRPLGSTAGDGA  750


 Score = 21.9 bits (45),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  701  LEALLGMGASLILKSVLER  645
            L +  G GAS IL SVLER
Sbjct  742  LGSTAGDGASRILVSVLER  760



>ref|XP_006597998.1| PREDICTED: uncharacterized protein LOC100779096 isoform X2 [Glycine 
max]
Length=878

 Score =   130 bits (328),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP  A S+ + N + WQASFD FF LLT YC+ K+ +IMQ++  Q   +  VI 
Sbjct  758  ATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCMNKYQSIMQSLLVQGMENVSVIG  816

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNS-RGGSSRKINAESV  290
             + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+P+ GFNS  G SS  +N+E+V
Sbjct  817  SDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQRSVPVVGFNSYTGSSSGHVNSETV  876


 Score = 33.5 bits (75),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  731  SEQPPLRPLGSTAGDGA  747


 Score = 21.9 bits (45),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  701  LEALLGMGASLILKSVLER  645
            L +  G GAS IL SVLER
Sbjct  739  LGSTAGDGASRILVSVLER  757



>dbj|BAK00541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   128 bits (321),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  A +S++  N ALWQASFDAFF LLTKYC+ K+++I+Q + + + S  VI  
Sbjct  692  ATELLTDQHAVSSYTSSNRALWQASFDAFFGLLTKYCLSKYESILQ-MFRMQASGSVIGS  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ML++F Q + P + FN  G S   I +ESV
Sbjct  751  EASQATSREMPVELLRASLPHTNEQQRQMLLDFAQRTTPASSFNPPGASGGHITSESV  808


 Score = 33.1 bits (74),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  665  SEQPPLRPLGSSAGDGA  681


 Score = 25.0 bits (53),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  678  GDGASLIIKSVLDR  691



>ref|XP_006597999.1| PREDICTED: uncharacterized protein LOC100779096 isoform X3 [Glycine 
max]
Length=826

 Score =   130 bits (328),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP  A S+ + N + WQASFD FF LLT YC+ K+ +IMQ++  Q   +  VI 
Sbjct  706  ATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCMNKYQSIMQSLLVQGMENVSVIG  764

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNS-RGGSSRKINAESV  290
             + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+P+ GFNS  G SS  +N+E+V
Sbjct  765  SDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQRSVPVVGFNSYTGSSSGHVNSETV  824


 Score = 33.5 bits (75),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  679  SEQPPLRPLGSTAGDGA  695


 Score = 21.9 bits (45),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  701  LEALLGMGASLILKSVLER  645
            L +  G GAS IL SVLER
Sbjct  687  LGSTAGDGASRILVSVLER  705



>gb|EMT11670.1| Protein PAT1-1-like protein [Aegilops tauschii]
Length=809

 Score =   128 bits (321),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD +A +S++  N ALWQASFDAFF LLTKYC+ K+++I+Q     + S  VI  
Sbjct  691  ATELLTDQRAVSSYTPSNRALWQASFDAFFGLLTKYCLSKYESILQMFV-MQASGSVIGS  749

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ML++F Q + P + FN  G S   I++ESV
Sbjct  750  EASQATSREMPVELLRASLPHTNEQQRQMLLDFAQRTTPASSFNPTGASGGHISSESV  807


 Score = 33.1 bits (74),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    +K
Sbjct  664  SEQPPLRPLGSSAGDGASLIIK  685


 Score = 25.4 bits (54),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  677  GDGASLIIKSVLDR  690



>gb|KHN16432.1| hypothetical protein glysoja_046875 [Glycine soja]
Length=823

 Score =   130 bits (328),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP  A S+ + N + WQASFD FF LLT YC+ K+ +IMQ++  Q   +  VI 
Sbjct  703  ATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCMNKYQSIMQSLLVQGMENVSVIG  761

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNS-RGGSSRKINAESV  290
             + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+P+ GFNS  G SS  +N+E+V
Sbjct  762  SDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQCSVPVVGFNSYTGSSSGHVNSETV  821


 Score = 33.5 bits (75),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  676  SEQPPLRPLGSTAGDGA  692


 Score = 21.9 bits (45),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  701  LEALLGMGASLILKSVLER  645
            L +  G GAS IL SVLER
Sbjct  684  LGSTAGDGASRILVSVLER  702



>gb|EYU43158.1| hypothetical protein MIMGU_mgv1a023840mg, partial [Erythranthe 
guttata]
Length=674

 Score =   125 bits (313),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ LL +PQ+A+S  +PNPALWQASFDAFF LL KYC  K+++I+Q++  Q   + +V+ 
Sbjct  575  ATQLLREPQSASSLGIPNPALWQASFDAFFGLLMKYCTSKYESIVQSLMNQNPENKEVVG  634

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
            PE  RA++ EMP+ELLRAS+PHT++ Q+K+LMNF Q S+
Sbjct  635  PEAGRAVSREMPIELLRASIPHTDDTQKKLLMNFAQRSM  673


 Score = 34.7 bits (78),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +EQPPLRPLG PAGDG    LK
Sbjct  548  TEQPPLRPLGIPAGDGASVILK  569


 Score = 26.6 bits (57),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+ILKSVLER  
Sbjct  561  GDGASVILKSVLERAT  576



>gb|ABR25724.1| unknown [Oryza sativa Indica Group]
Length=119

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q     ++   V   
Sbjct  1    ATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIKQMFVM-QSPCSVTGS  59

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  60   EVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  117



>ref|XP_009399054.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=822

 Score =   132 bits (333),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL+DPQAANS S+ N  LWQASFDAFF LLTKYC+ K+D+I+Q +     +  V+  
Sbjct  703  ATDLLSDPQAANSCSISNRTLWQASFDAFFGLLTKYCLSKYDSILQMLLIQAPNDAVVGS  762

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E  RAI+ EMPV+LLRASLPHT+E Q K+L++F Q  +P+ GF++ G  S  +  ESV
Sbjct  763  EATRAISREMPVDLLRASLPHTDEHQHKVLLDFAQRLMPVTGFSAHGSDSGSVTYESV  820


 Score = 32.3 bits (72),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPPLRP+GS AGDG    +K
Sbjct  677  EQPPLRPVGSSAGDGATVVVK  697



>gb|EMS52590.1| hypothetical protein TRIUR3_20541 [Triticum urartu]
Length=809

 Score =   127 bits (318),  Expect(3) = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD +A +S++  N ALWQASFDAFF LLTKYC+ K+++I+Q     + S  VI  
Sbjct  691  ATELLTDQRAVSSYTPSNRALWQASFDAFFGLLTKYCLSKYESILQMFV-MQASGSVIGS  749

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ML++F Q + P + FN  G S   I++ESV
Sbjct  750  EASQAPSREMPVELLRASLPHTNEQQRQMLLDFAQRTTPASSFNPPGASGGHISSESV  807


 Score = 33.1 bits (74),  Expect(3) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    +K
Sbjct  664  SEQPPLRPLGSSAGDGASLIIK  685


 Score = 25.4 bits (54),  Expect(3) = 7e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  677  GDGASLIIKSVLDR  690



>gb|KEH38344.1| topoisomerase II-associated protein PAT1, putative [Medicago 
truncatula]
Length=825

 Score =   132 bits (332),  Expect(3) = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 94/120 (78%), Gaps = 4/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ +LTDP AA+++++ N +LWQASFD FF LLTKYCV K+D+IMQ+ +AQ  ++  VI 
Sbjct  706  ATEVLTDPHAASNYNIRNRSLWQASFDEFFGLLTKYCVNKYDSIMQSFLAQGTSNMAVIG  765

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
            P+VARAI+ EMPVELLRASLPHT++ Q+K+L++F Q S+   G++S  GG+    N++SV
Sbjct  766  PDVARAISREMPVELLRASLPHTDDRQKKILLDFAQRSV--VGYSSNAGGNGHHANSQSV  823


 Score = 29.3 bits (64),  Expect(3) = 9e-32, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDG  679
            +E PPLRPLGSP GDG
Sbjct  679  AEPPPLRPLGSPVGDG  694


 Score = 23.1 bits (48),  Expect(3) = 9e-32, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -2

Query  701  LEALLGMGASLILKSVLER  645
            L + +G G SLIL SVLER
Sbjct  687  LGSPVGDGTSLILVSVLER  705



>ref|XP_003569904.1| PREDICTED: uncharacterized protein LOC100838182 [Brachypodium 
distachyon]
Length=805

 Score =   123 bits (308),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  A +S++  N ALWQASFDAFF LLTKYC+ K+++I+Q     + S   I  
Sbjct  687  ATELLTDHHAVSSYTPSNRALWQASFDAFFGLLTKYCLSKYESILQMFV-MQGSGSAIGS  745

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASL HTNE QR+ML++F Q + P  GFN  G S   I +ESV
Sbjct  746  EASQATSREMPVELLRASLHHTNEQQRQMLLDFAQRTTPATGFNPPGPSGGHITSESV  803


 Score = 35.8 bits (81),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  660  SEQPPLRPLGSPAGDGA  676


 Score = 25.4 bits (54),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  673  GDGASLIIKSVLDR  686



>gb|KHN27739.1| Protein PAT1 like 1 [Glycine soja]
Length=837

 Score =   130 bits (327),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA+++++ N +LWQA+FD FF LLTKYCV K+D++MQ+ + Q   +   I 
Sbjct  707  ATELLTDPHAASNYNIANRSLWQATFDEFFGLLTKYCVNKYDSVMQSFLIQGTPNMASIG  766

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGG  320
             +VARAI+ EMPVELLRASLPHT++ Q+K L++F Q SIP+ GFNS  G
Sbjct  767  SDVARAISREMPVELLRASLPHTDDRQKKQLLDFAQRSIPIVGFNSNSG  815


 Score = 29.3 bits (64),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SE PPLRPLGS AGDG 
Sbjct  680  SEPPPLRPLGSSAGDGA  696


 Score = 24.3 bits (51),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  693  GDGASLILVSVLER  706



>ref|XP_003568135.1| PREDICTED: protein PAT1 homolog 1-like [Brachypodium distachyon]
Length=806

 Score =   126 bits (316),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A  +S    +LWQASFDAFF LLTKYC  K+ +I+Q  +  + S  +   
Sbjct  688  ATELLADPHSAADYSRSTRSLWQASFDAFFGLLTKYCDSKYGSILQMFS-MQGSNSIARS  746

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
            E ++A++ EMPVELLRASLPHTNE QR+ML++F + S+P+ GFN  G SS    +ESV+
Sbjct  747  EASKAVSREMPVELLRASLPHTNEQQRQMLLDFARKSMPVTGFNHSGASSGHFTSESVA  805


 Score = 32.0 bits (71),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S+QPPLRPLGS AGDG 
Sbjct  661  SQQPPLRPLGSSAGDGA  677


 Score = 25.4 bits (54),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLI+KSVL+R  
Sbjct  674  GDGASLIIKSVLDRAT  689



>dbj|BAJ88890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   125 bits (314),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  A +S++  N A WQASFDAFF LLTKYC+ K+++I+Q + + + S  VI  
Sbjct  692  ATELLTDQHAVSSYTSSNRAPWQASFDAFFGLLTKYCLSKYESILQ-MFRMQASGSVIGS  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A + EMPVELLRASLPHTNE QR+ML++F Q + P + FN  G S   I +ESV
Sbjct  751  EASQATSREMPVELLRASLPHTNEQQRQMLLDFAQRTTPASSFNPPGASGGHITSESV  808


 Score = 33.1 bits (74),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    +K
Sbjct  665  SEQPPLRPLGSSAGDGASLIIK  686


 Score = 25.4 bits (54),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  678  GDGASLIIKSVLDR  691



>ref|XP_009419549.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=813

 Score =   130 bits (328),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD + A ++S+P+  LWQASF+AFF LLTKYC+ K+++IMQ+++    +  V   
Sbjct  702  ATQLLTDQKNAGNYSIPSCNLWQASFNAFFGLLTKYCLSKYESIMQSLSMQSANAAVAGS  761

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
            EV RAI+ EMPVELLRASLPHTNE QRK+L++F Q +IP  G N+ GGS+
Sbjct  762  EVTRAISREMPVELLRASLPHTNEHQRKLLLDFAQRTIPATGQNAHGGSN  811


 Score = 32.3 bits (72),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPPLRPLGS AGDG    +K
Sbjct  676  EQPPLRPLGSSAGDGASIIIK  696



>ref|XP_009419548.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=739

 Score =   130 bits (328),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD + A ++S+P+  LWQASF+AFF LLTKYC+ K+++IMQ+++    +  V   
Sbjct  628  ATQLLTDQKNAGNYSIPSCNLWQASFNAFFGLLTKYCLSKYESIMQSLSMQSANAAVAGS  687

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
            EV RAI+ EMPVELLRASLPHTNE QRK+L++F Q +IP  G N+ GGS+
Sbjct  688  EVTRAISREMPVELLRASLPHTNEHQRKLLLDFAQRTIPATGQNAHGGSN  737


 Score = 32.3 bits (72),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPPLRPLGS AGDG    +K
Sbjct  602  EQPPLRPLGSSAGDGASIIIK  622



>gb|KJB42927.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=797

 Score =   125 bits (314),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV K++ I Q++     + +VI  
Sbjct  683  ATQLLSHP--SGNCSMPNYAFWRASFDEFFTLLTKYCVNKYETIKQSIQNQSPTMEVIGS  740

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E   A+  EMP ELLR+SLPHTNE QRK+LM+F Q S+P+ G NS  GS+ +IN+ESV
Sbjct  741  E---AMRQEMPCELLRSSLPHTNEAQRKLLMDFSQRSVPMNGANSHAGSTSQINSESV  795


 Score = 37.4 bits (85),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  656  SEQPPLRPLGSPAGDGASVILK  677



>emb|CDP13609.1| unnamed protein product [Coffea canephora]
Length=817

 Score =   122 bits (307),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LL DP+A+ + SMPN A WQASFDAFF LLTKYC  K+D IMQ+ ++QT      +S
Sbjct  709  ATDLLRDPRASGNCSMPNRAFWQASFDAFFGLLTKYCFNKYDTIMQSFLSQTLPDMSNVS  768

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
             + A+AI+ EMPVELLRASLPHT+E QRK+L++F Q S+PL
Sbjct  769  SDAAKAISKEMPVELLRASLPHTSEQQRKLLLDFAQQSMPL  809


 Score = 32.7 bits (73),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +E PPLRP+GSPAGDG    LK
Sbjct  682  AEHPPLRPIGSPAGDGASLILK  703


 Score = 27.7 bits (60),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLILKSVLER  
Sbjct  695  GDGASLILKSVLERAT  710



>ref|XP_002308825.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
 gb|EEE92348.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
Length=789

 Score =   124 bits (311),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL  PQA+ + +MPN ALWQASFD FF LLTKYC+ K+D I+ +V A+T  ST+ I 
Sbjct  669  ASKLLHGPQASANCAMPNFALWQASFDEFFDLLTKYCLIKYDTILHSVYAKTPPSTEGID  728

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHTNE Q ++L +FGQ      G ++  G+S  IN+ESV
Sbjct  729  LEVRAATKQEMPVELLRACLPHTNERQMELLRHFGQQRNASTGLSAHPGNSGHINSESV  787


 Score = 37.0 bits (84),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPP RPLGSPAGDG    LK
Sbjct  642  SEQPPFRPLGSPAGDGATVILK  663


 Score = 21.9 bits (45),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA++ILK +LER
Sbjct  655  GDGATVILKCLLER  668



>ref|XP_004514400.1| PREDICTED: uncharacterized protein LOC101512706 [Cicer arietinum]
Length=880

 Score =   129 bits (324),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (73%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDPQA  S +M N + WQASFD FF LLTKYC+ K+ +IMQ++  Q   +   I 
Sbjct  759  ATELLTDPQAPCSNNMGNRSFWQASFDEFFGLLTKYCMSKYHSIMQSLLMQGTQNVAAIG  818

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSR-KINAESV  290
             + A+A++ EMPVELLRASLPHT++ QRK+L++F Q S P+ GFNS  GSS   +N+E+V
Sbjct  819  SDAAKAVSKEMPVELLRASLPHTDDPQRKLLLDFAQRSAPVIGFNSHAGSSNSHVNSETV  878


 Score = 31.6 bits (70),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGD  
Sbjct  732  SEQPPLRPLGSSAGDAA  748


 Score = 21.6 bits (44),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G  ASLIL SVLER  
Sbjct  745  GDAASLILVSVLERAT  760



>gb|EAY75968.1| hypothetical protein OsI_03887 [Oryza sativa Indica Group]
Length=827

 Score =   123 bits (309),  Expect(3) = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q  V Q+  S  V  
Sbjct  709  ATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIKQMFVMQSPCS--VTG  766

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  767  SEVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  825


 Score = 33.5 bits (75),  Expect(3) = 5e-31, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AGDG 
Sbjct  682  SEQPPLRPLGSSAGDGA  698


 Score = 25.4 bits (54),  Expect(3) = 5e-31, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLI+KSVL+R  
Sbjct  695  GDGASLIIKSVLDRAT  710



>gb|KHG07107.1| Protein PAT1 [Gossypium arboreum]
Length=716

 Score =   124 bits (311),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV K++ I Q++     + +VI  
Sbjct  602  ATQLLSYP--SGNCSMPNYAFWRASFDEFFTLLTKYCVNKYETIKQSIQNQSPTMEVIGS  659

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E   A+  EMP ELLR+SLPHTNE QRK+LM+F Q S+P+ G NS  GS+ +IN+ESV
Sbjct  660  E---AMRQEMPCELLRSSLPHTNEAQRKLLMDFSQRSVPMNGANSHAGSTSQINSESV  714


 Score = 37.4 bits (85),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  575  SEQPPLRPLGSPAGDGASVILK  596



>ref|XP_006646364.1| PREDICTED: uncharacterized protein LOC102701783 [Oryza brachyantha]
Length=808

 Score =   126 bits (316),  Expect(3) = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q  V Q+  S  VI 
Sbjct  690  ATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIRQMFVMQSPCS--VIG  747

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ GFN  G +     +ESV
Sbjct  748  AEVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGFNPTGANGGHATSESV  806


 Score = 30.4 bits (67),  Expect(3) = 7e-31, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPL S +GDG 
Sbjct  663  SEQPPLRPLASSSGDGA  679


 Score = 25.4 bits (54),  Expect(3) = 7e-31, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLI+KSVL+R  
Sbjct  676  GDGASLIIKSVLDRAT  691



>ref|XP_006373646.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
 gb|ERP51443.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
Length=788

 Score =   124 bits (311),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL  PQA+++  MPN ALWQASFD FF LL KYC+ K+D I+Q+V A+T  S + I 
Sbjct  668  ASKLLHGPQASSNCGMPNFALWQASFDEFFDLLMKYCLIKYDTILQSVYAKTPPSAEGID  727

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHTNE Q ++L +FGQ    + G ++  G+S  IN+ESV
Sbjct  728  SEVRAATKREMPVELLRACLPHTNERQMELLRHFGQQRNTITGLSAHPGNSGHINSESV  786


 Score = 37.0 bits (84),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKI  658
            SEQPP RPLGSPAGDG    LK 
Sbjct  641  SEQPPFRPLGSPAGDGATVILKC  663



>ref|XP_011008549.1| PREDICTED: uncharacterized protein LOC105113895 [Populus euphratica]
Length=788

 Score =   123 bits (309),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL  PQA+++  MPN ALWQASFD FF LL KYC+ K+D I Q+V A+T  S + I 
Sbjct  668  ASKLLHGPQASSNCGMPNFALWQASFDEFFSLLMKYCLIKYDTIWQSVYAKTPPSAEGID  727

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHTNE Q + L +FGQ    + G N+  G+S  +N+ESV
Sbjct  728  SEVRAATKREMPVELLRACLPHTNERQMERLRHFGQQRNTITGLNAHPGNSGHVNSESV  786


 Score = 37.0 bits (84),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKI  658
            SEQPP RPLGSPAGDG    LK 
Sbjct  641  SEQPPFRPLGSPAGDGATVILKC  663



>ref|XP_004251956.1| PREDICTED: protein PAT1 homolog 1 [Solanum lycopersicum]
Length=817

 Score =   124 bits (310),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LL DP AA   SMPN A WQASFDAFF LLTKYC  K+D +MQ  + Q      V  
Sbjct  704  ATELLRDPHAAGKCSMPNRAFWQASFDAFFGLLTKYCFSKYDTVMQCFLTQGPPDVAVSG  763

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
             + A+AI+ EMPVELLRASLPHT+E QRK+L+ F   S+P+ G  S+ G+S
Sbjct  764  SDAAKAISREMPVELLRASLPHTSEQQRKVLLEFAHRSMPVLGVGSQSGAS  814


 Score = 31.6 bits (70),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +E PPLRP+GSPAGDG    LK
Sbjct  677  AEPPPLRPVGSPAGDGASVVLK  698


 Score = 25.0 bits (53),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++LKS+LER
Sbjct  690  GDGASVVLKSILER  703



>ref|XP_006648671.1| PREDICTED: uncharacterized protein LOC102700029 [Oryza brachyantha]
Length=782

 Score =   124 bits (312),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q  V Q   S  V+ 
Sbjct  664  ATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCISKYESIRQMFVMQPPGS--VVG  721

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ GFN    +   I +ESV
Sbjct  722  SEVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGFNPTDANGGHITSESV  780


 Score = 30.4 bits (67),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPL S +GDG 
Sbjct  637  SEQPPLRPLASSSGDGA  653


 Score = 25.4 bits (54),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  650  GDGASLIIKSVLDR  663



>ref|XP_006388794.1| hypothetical protein POPTR_0098s00230g [Populus trichocarpa]
 gb|ERP47708.1| hypothetical protein POPTR_0098s00230g [Populus trichocarpa]
Length=655

 Score =   123 bits (308),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL  PQA+++  MPN ALWQASFD FF LL KYC+ K+D I+Q+V A+T  S + I 
Sbjct  535  ASKLLHGPQASSNCGMPNFALWQASFDEFFDLLMKYCLIKYDTILQSVYAKTPPSAEGID  594

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVE LRA LPHTNE Q ++L +FGQ    + G ++  G+S  IN+ESV
Sbjct  595  SEVRAATKREMPVEFLRACLPHTNERQMELLRHFGQQRNTITGLSAHPGNSGHINSESV  653


 Score = 37.0 bits (84),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKI  658
            SEQPP RPLGSPAGDG    LK 
Sbjct  508  SEQPPFRPLGSPAGDGATVILKC  530



>ref|XP_011004464.1| PREDICTED: uncharacterized protein LOC105110947 [Populus euphratica]
Length=789

 Score =   121 bits (303),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL  PQA+ + +MPN ALWQASFD FF LLTKYC+ K+D I+ +V A+T  ST+ I 
Sbjct  669  ASKLLHGPQASANCAMPNFALWQASFDEFFDLLTKYCLIKYDTILHSVYAKTPPSTEGID  728

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHTN+ Q ++L +FGQ      G ++  G+S  IN+ESV
Sbjct  729  LEVRAATKQEMPVELLRACLPHTNDRQMELLRHFGQQRKTSTGLSAYPGNSGLINSESV  787


 Score = 37.0 bits (84),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPP RPLGSPAGDG    LK
Sbjct  642  SEQPPFRPLGSPAGDGATVILK  663


 Score = 21.9 bits (45),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GA++ILK +LER
Sbjct  655  GDGATVILKCLLER  668



>ref|XP_003568134.1| PREDICTED: uncharacterized protein LOC100841028 [Brachypodium 
distachyon]
Length=805

 Score =   123 bits (309),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A  +S    +LWQASFDAFF LLTKYC  K+ +I+Q  +   +++   S 
Sbjct  687  ATELLADPHSAADYSRSTRSLWQASFDAFFGLLTKYCDSKYGSILQMFSMQGSNSTARS-  745

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
            E ++A++ EMPVELLRASLPHTNE QR+ML+ F + S+P+ GFN  G SS    +ESV+
Sbjct  746  EASKAVSREMPVELLRASLPHTNEQQRQMLLGFARKSMPVTGFNHSGTSSGHFTSESVA  804


 Score = 31.2 bits (69),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRP GS AGDG    +K
Sbjct  660  SQQPPLRPFGSSAGDGASLIIK  681


 Score = 25.4 bits (54),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLI+KSVL+R
Sbjct  673  GDGASLIIKSVLDR  686



>gb|EAZ23222.1| hypothetical protein OsJ_06910 [Oryza sativa Japonica Group]
Length=825

 Score =   129 bits (324),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q     ++   VI  
Sbjct  707  ATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIRQMFT-MQSPGSVIGS  765

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ GFN+ G +   I +ESV
Sbjct  766  EVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGFNASGANGGHITSESV  823


 Score = 30.4 bits (67),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPPLRPL S AGDG    +K
Sbjct  681  EQPPLRPLASSAGDGASLIIK  701



>gb|EAY86044.1| hypothetical protein OsI_07409 [Oryza sativa Indica Group]
Length=825

 Score =   129 bits (324),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q     ++   VI  
Sbjct  707  ATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIRQMFT-MQSPGSVIGS  765

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ GFN+ G +   I +ESV
Sbjct  766  EVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGFNASGANGGHITSESV  823


 Score = 30.4 bits (67),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPPLRPL S AGDG    +K
Sbjct  681  EQPPLRPLASSAGDGASLIIK  701



>ref|NP_001046960.1| Os02g0517300 [Oryza sativa Japonica Group]
 dbj|BAD46717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08874.1| Os02g0517300 [Oryza sativa Japonica Group]
Length=815

 Score =   129 bits (324),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q     ++   VI  
Sbjct  697  ATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIRQMFT-MQSPGSVIGS  755

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ GFN+ G +   I +ESV
Sbjct  756  EVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGFNASGANGGHITSESV  813


 Score = 30.4 bits (67),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            EQPPLRPL S AGDG    +K
Sbjct  671  EQPPLRPLASSAGDGASLIIK  691



>ref|XP_011036076.1| PREDICTED: protein PAT1 homolog 1-like [Populus euphratica]
Length=789

 Score =   122 bits (306),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            AS LL  PQA+ + +MPN ALWQASFD FF LLTKYC+ K+D I+ +V A+T  ST+ I 
Sbjct  669  ASKLLHGPQASANCAMPNFALWQASFDEFFDLLTKYCLIKYDTILHSVYAKTPPSTEGID  728

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHTN+ Q ++L +FGQ      G ++  G+S  IN+ESV
Sbjct  729  LEVRAATKQEMPVELLRACLPHTNDRQMELLRHFGQQRKTSTGLSAHPGNSGLINSESV  787


 Score = 37.0 bits (84),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKI  658
            SEQPP RPLGSPAGDG    LK 
Sbjct  642  SEQPPFRPLGSPAGDGATVILKC  664



>ref|XP_009361780.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=821

 Score =   118 bits (296),  Expect(3) = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP A ++ +M N  LWQASFD FF LLTKYCV K+D +MQ+ + Q   +  +I 
Sbjct  700  ATELLTDPHAVSNCNMTNRQLWQASFDEFFGLLTKYCVNKYDTVMQSLLMQAPPNVAIIG  759

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
             + ARAI  EMPVELLRASLPHT+E QR++L++F Q S+P+
Sbjct  760  SDAARAIGREMPVELLRASLPHTDEHQRQLLLDFTQRSMPI  800


 Score = 35.4 bits (80),  Expect(3) = 4e-30, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGDG 
Sbjct  673  SEQPPLRPLGSPAGDGA  689


 Score = 25.4 bits (54),  Expect(3) = 4e-30, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLIL SVLER  
Sbjct  686  GDGASLILNSVLERAT  701



>ref|XP_009405381.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=801

 Score =   127 bits (318),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A + S+P+  +WQASFDAFF LLTKYC+ K+D+IMQ+V     +  +  P
Sbjct  690  ATELLTDRNTATNHSIPSRNMWQASFDAFFGLLTKYCLSKYDSIMQSVPLQAPNAAIAGP  749

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
            EV  AI  EMPVELLRASLPHTN+ QRK+L++F Q +IP A  N+ GG++
Sbjct  750  EVTGAIRREMPVELLRASLPHTNDHQRKLLLDFAQRTIPAAEHNADGGNN  799


 Score = 31.6 bits (70),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGD     +K
Sbjct  663  SEQPPLRPLGSSAGDCATVIIK  684



>ref|XP_009405382.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=756

 Score =   127 bits (318),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A + S+P+  +WQASFDAFF LLTKYC+ K+D+IMQ+V     +  +  P
Sbjct  645  ATELLTDRNTATNHSIPSRNMWQASFDAFFGLLTKYCLSKYDSIMQSVPLQAPNAAIAGP  704

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
            EV  AI  EMPVELLRASLPHTN+ QRK+L++F Q +IP A  N+ GG++
Sbjct  705  EVTGAIRREMPVELLRASLPHTNDHQRKLLLDFAQRTIPAAEHNADGGNN  754


 Score = 31.6 bits (70),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGD     +K
Sbjct  618  SEQPPLRPLGSSAGDCATVIIK  639



>ref|XP_006647188.1| PREDICTED: protein PAT1 homolog 1-like [Oryza brachyantha]
Length=827

 Score =   124 bits (310),  Expect(3) = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+ KFD+ + A+ QT+       P
Sbjct  710  ATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSAIHAL-QTQ-------P  761

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A  I+ EMPVELLRASLPHTNE QRK L++F Q ++P+   +S G  SR I +ES 
Sbjct  762  AAAAVISREMPVELLRASLPHTNERQRKQLLSFAQRTVPVNNHSSHGSDSRPITSEST  819


 Score = 28.9 bits (63),  Expect(3) = 1e-29, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S QPPLRPLG  AGDG    +K
Sbjct  683  SLQPPLRPLGQAAGDGASVIIK  704


 Score = 24.6 bits (52),  Expect(3) = 1e-29, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+KSVL+R  
Sbjct  696  GDGASVIIKSVLDRAT  711



>gb|KHN26819.1| Protein PAT1 like 1 [Glycine soja]
Length=981

 Score =   123 bits (309),  Expect(3) = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ +LTDP AA +F+M N + WQASFD FF LLTKYC+ K+ +IMQ+ + Q+ ++ D I 
Sbjct  833  ATEVLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCMNKYHSIMQSMLIQSTSNVDDIG  892

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
            P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q S+P+
Sbjct  893  PDAAKSIGREMPVELLRASLPHTDEHQRKLLLDFAQRSVPV  933


 Score = 30.4 bits (67),  Expect(3) = 1e-29, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            +EQPPLRP+GS +GDG 
Sbjct  806  AEQPPLRPIGSTSGDGA  822


 Score = 23.5 bits (49),  Expect(3) = 1e-29, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASL+L SVLER  
Sbjct  819  GDGASLVLISVLERAT  834



>gb|EYU33763.1| hypothetical protein MIMGU_mgv1a002553mg [Erythranthe guttata]
Length=660

 Score =   119 bits (298),  Expect(3) = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA++ S  N   WQASFD FF LLTKYC  K+D+++Q+ ++Q  T    I+
Sbjct  553  ATELLTDPVAASNCSSSNRVFWQASFDEFFGLLTKYCFSKYDSVVQSFISQGSTDVASIA  612

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAG  338
             +VA+AI  EMPVELLRASLPHTNE QRK+L+ F Q S+P+ G
Sbjct  613  ADVAKAITREMPVELLRASLPHTNEQQRKVLLEFAQRSMPVLG  655


 Score = 33.1 bits (74),  Expect(3) = 2e-29, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            E PPLRP+GSPAGDG    LK
Sbjct  527  EHPPLRPIGSPAGDGASVVLK  547


 Score = 24.6 bits (52),  Expect(3) = 2e-29, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS++LKSVL+R  
Sbjct  539  GDGASVVLKSVLDRAT  554



>emb|CAD80089.1| hypothetical protein [Momordica charantia]
Length=90

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -3

Query  556  FKLLTKYCVCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRK  380
            F LLTKYCV K++ I+Q++ +QT +STD+I  E ARAI  EMPVELLRASLPHTNE QRK
Sbjct  1    FSLLTKYCVSKYETIVQSLFSQTPSSTDIIESEAARAIGREMPVELLRASLPHTNEPQRK  60

Query  379  MLMNFGQGSIPLAGFNSRGGSSRKINA  299
            +LM+F Q S+P++GF++ GGSS ++N+
Sbjct  61   LLMDFAQRSMPVSGFSAHGGSSGQMNS  87



>gb|EEC72953.1| hypothetical protein OsI_06835 [Oryza sativa Indica Group]
Length=830

 Score =   123 bits (308),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 85/118 (72%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+ KFD+++ A+ QT+       P
Sbjct  713  ATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------P  764

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             VA  I+ EMPVELLRASLPHTNE QRK L++F Q ++P+   +S G ++  + +ES+
Sbjct  765  AVAAVISREMPVELLRASLPHTNEYQRKQLLSFAQRTVPVNNHSSHGSNNGPMTSESI  822


 Score = 28.5 bits (62),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  686  SLQPPLRPLGHAAGDGA  702


 Score = 24.6 bits (52),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS I+KSVL+R  
Sbjct  699  GDGASFIIKSVLDRAT  714



>ref|NP_001172909.1| Os02g0295700 [Oryza sativa Japonica Group]
 dbj|BAD22185.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ22674.1| hypothetical protein OsJ_06343 [Oryza sativa Japonica Group]
 dbj|BAG91987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91638.1| Os02g0295700 [Oryza sativa Japonica Group]
Length=830

 Score =   122 bits (307),  Expect(3) = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 85/118 (72%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+ KFD+++ A+ QT+       P
Sbjct  713  ATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------P  764

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             VA  I+ EMPVELLRASLPHTNE QRK L++F Q ++P+   +S G ++  + +ES+
Sbjct  765  AVAAVISREMPVELLRASLPHTNEYQRKQLLSFSQRTVPVNNHSSHGSNNGPMTSESI  822


 Score = 28.5 bits (62),  Expect(3) = 4e-29, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  686  SLQPPLRPLGHAAGDGA  702


 Score = 24.6 bits (52),  Expect(3) = 4e-29, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS I+KSVL+R  
Sbjct  699  GDGASFIIKSVLDRAT  714



>gb|EPS66560.1| hypothetical protein M569_08215, partial [Genlisea aurea]
Length=772

 Score =   120 bits (302),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 8/120 (7%)
 Frame = -3

Query  643  ASYLLT-DPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVIS  467
            A+YL + DPQ       P  ALWQASFDAFF LLTKYCVCK+D+ +  V++   S D + 
Sbjct  659  ATYLRSSDPQFFGGIP-PYLALWQASFDAFFSLLTKYCVCKYDSAVHLVSRRMASGDAL-  716

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  287
             E AR +  EMPVELL AS+PHT+E Q+K+L+NF Q S+PL+GFN  G    +I+ ESV+
Sbjct  717  -EAARTVGREMPVELLCASVPHTDESQKKLLLNFSQRSVPLSGFNVHG----RIDPESVA  771


 Score = 34.7 bits (78),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGS AGDG    LK
Sbjct  632  SEQPPLRPLGSVAGDGASVILK  653



>dbj|BAJ94686.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86063.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   120 bits (300),  Expect(3) = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A S+S    +LWQASFDAFF LLTKYC  K+ +I+Q     + S  +  P
Sbjct  692  ATELLADPHSAASYSRSTRSLWQASFDAFFGLLTKYCDSKYGSILQRFT-MQGSDSMGGP  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E ++A++ EMP ELLRASLPHT+E QR+ML++F + S+P+ G+N  G S  +  +E V
Sbjct  751  EASKAVSREMPAELLRASLPHTSEEQRQMLLDFARKSMPVIGYNHSGASGGRPASEPV  808


 Score = 31.6 bits (70),  Expect(3) = 5e-29, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLK  661
            +QPPLRPLGS AGDG    +K
Sbjct  666  QQPPLRPLGSSAGDGASVIIK  686


 Score = 24.3 bits (51),  Expect(3) = 5e-29, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+I+KSVL+R
Sbjct  678  GDGASVIIKSVLDR  691



>ref|NP_001044369.2| Os01g0769000 [Oryza sativa Japonica Group]
 dbj|BAD52714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94608.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06283.2| Os01g0769000 [Oryza sativa Japonica Group]
Length=809

 Score =   123 bits (309),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q  V Q+  S  V  
Sbjct  691  ATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIKQMFVMQSPCS--VTG  748

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  749  SEVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  807


 Score = 31.6 bits (70),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPL S AGDG 
Sbjct  664  SEQPPLRPLASSAGDGA  680



>ref|XP_007149274.1| hypothetical protein PHAVU_005G056500g [Phaseolus vulgaris]
 gb|ESW21268.1| hypothetical protein PHAVU_005G056500g [Phaseolus vulgaris]
Length=828

 Score =   125 bits (314),  Expect(3) = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA+++++ N +LWQ++FD FF LLTKYCV K+D +MQ+ + Q   +   I 
Sbjct  707  ATELLTDPHAASNYNIANRSLWQSTFDEFFGLLTKYCVSKYDGVMQSFLIQGTPNMAAIG  766

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  290
             + A AI+ EMPVELLRASLPHT++ Q+K+L++F Q SIP+ GFN   GG    +N+ESV
Sbjct  767  ADAANAISKEMPVELLRASLPHTDDRQKKLLLDFAQRSIPVVGFNGNSGGHGHHVNSESV  826


 Score = 25.4 bits (54),  Expect(3) = 6e-29, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S+ PPLRPL S AGDG 
Sbjct  680  SDPPPLRPLRSSAGDGA  696


 Score = 24.3 bits (51),  Expect(3) = 6e-29, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  701  LEALLGMGASLILKSVLERGI  639
            L +  G GASLIL SVLER  
Sbjct  688  LRSSAGDGASLILVSVLERAT  708



>gb|EAZ13676.1| hypothetical protein OsJ_03596 [Oryza sativa Japonica Group]
Length=827

 Score =   123 bits (308),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+ K+++I Q  V Q+  S  V  
Sbjct  709  ATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCLSKYESIKQMFVMQSPCS--VTG  766

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  767  SEVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  825


 Score = 31.6 bits (70),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPL S AGDG 
Sbjct  682  SEQPPLRPLASSAGDGA  698



>ref|NP_001046606.2| Os02g0294700 [Oryza sativa Japonica Group]
 dbj|BAD22175.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08520.2| Os02g0294700 [Oryza sativa Japonica Group]
Length=657

 Score =   124 bits (310),  Expect(3) = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+ KFD+++ A+ QT+       P
Sbjct  540  ATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------P  591

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             VA  I  EMPVELLRASLPHTNE QRK L+ F Q ++P+   +S G S+  + +ES+
Sbjct  592  AVAAVIGREMPVELLRASLPHTNEYQRKQLLGFAQRTVPVNNHSSHGSSNGPMTSESI  649


 Score = 28.5 bits (62),  Expect(3) = 9e-29, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  513  SLQPPLRPLGHAAGDGA  529


 Score = 22.3 bits (46),  Expect(3) = 9e-29, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -2

Query  686  GMGASLILKSVLE  648
            G GAS I+KSVL+
Sbjct  526  GDGASFIIKSVLD  538



>gb|EAZ22672.1| hypothetical protein OsJ_06342 [Oryza sativa Japonica Group]
Length=898

 Score =   124 bits (310),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+ KFD+++ A+ QT+       P
Sbjct  781  ATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------P  832

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             VA  I  EMPVELLRASLPHTNE QRK L+ F Q ++P+   +S G S+  + +ES+
Sbjct  833  AVAAVIGREMPVELLRASLPHTNEYQRKQLLGFAQRTVPVNNHSSHGSSNGPMTSESI  890


 Score = 28.5 bits (62),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  754  SLQPPLRPLGHAAGDGA  770


 Score = 22.3 bits (46),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -2

Query  686  GMGASLILKSVLE  648
            G GAS I+KSVL+
Sbjct  767  GDGASFIIKSVLD  779



>ref|XP_006344917.1| PREDICTED: uncharacterized protein LOC102604826 isoform X1 [Solanum 
tuberosum]
Length=816

 Score =   117 bits (293),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LL DP AA   SMPN A WQASFDAFF LLTKYC  K+D +MQ  + Q      V  
Sbjct  703  ATELLRDPHAAGKCSMPNRAFWQASFDAFFGLLTKYCFSKYDTVMQCFLTQGPPDVAVSG  762

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
             + A+AI+ EMPVELLRASLPHT+E QRK+L+ F   S+P+
Sbjct  763  SDAAKAISREMPVELLRASLPHTSEQQRKVLLEFAHRSMPV  803


 Score = 31.6 bits (70),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +E PPLRP+GSPAGDG    LK
Sbjct  676  AEPPPLRPVGSPAGDGASVVLK  697


 Score = 25.0 bits (53),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++LKS+LER
Sbjct  689  GDGASVVLKSILER  702



>ref|XP_006344918.1| PREDICTED: uncharacterized protein LOC102604826 isoform X2 [Solanum 
tuberosum]
Length=815

 Score =   117 bits (293),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LL DP AA   SMPN A WQASFDAFF LLTKYC  K+D +MQ  + Q      V  
Sbjct  702  ATELLRDPHAAGKCSMPNRAFWQASFDAFFGLLTKYCFSKYDTVMQCFLTQGPPDVAVSG  761

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
             + A+AI+ EMPVELLRASLPHT+E QRK+L+ F   S+P+
Sbjct  762  SDAAKAISREMPVELLRASLPHTSEQQRKVLLEFAHRSMPV  802


 Score = 31.6 bits (70),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +E PPLRP+GSPAGDG    LK
Sbjct  675  AEPPPLRPVGSPAGDGASVVLK  696


 Score = 25.0 bits (53),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++LKS+LER
Sbjct  688  GDGASVVLKSILER  701



>gb|KJB08599.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=792

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ +LT P  + +F MP+   W+ASFD FF LLTKYCV K+++I+Q++  Q+  +T+VI 
Sbjct  677  ATQVLTHP--SGNFPMPHYTFWRASFDEFFTLLTKYCVTKYESIIQSIHNQSLPTTEVIG  734

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+P  G NS  GS+ +IN+ESV
Sbjct  735  SE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSVPDNGSNSPAGSNSQINSESV  790



>gb|KDP44628.1| hypothetical protein JCGZ_22047 [Jatropha curcas]
Length=737

 Score =   112 bits (279),  Expect(3) = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LL DPQAA + S+ N ALWQASF+ FF LLTKYC+ K+D I+Q V A    + +   
Sbjct  617  ANKLLIDPQAAANCSVTNFALWQASFNEFFDLLTKYCLIKYDTILQTVYANNPPNAEGND  676

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             EV  A   EMPVELLRA LPHT+E Q ++L +FGQ    + G N+  G+S ++N+E V
Sbjct  677  LEVRAATKREMPVELLRACLPHTDERQMELLRHFGQQRNSVTGLNAHSGNSGQMNSELV  735


 Score = 35.8 bits (81),  Expect(3) = 3e-28, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPP RPLGSPAGDG    LK
Sbjct  590  SEQPPFRPLGSPAGDGASIILK  611


 Score = 25.0 bits (53),  Expect(3) = 3e-28, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS+ILKS+LER
Sbjct  603  GDGASIILKSLLER  616



>gb|EAY85452.1| hypothetical protein OsI_06832 [Oryza sativa Indica Group]
Length=898

 Score =   119 bits (298),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+ KFD+++ A+ QT+       P
Sbjct  781  ATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------P  832

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
             VA  I  EMPVELLRASLPHTN  QRK L+ F Q ++P+   +S G  +  + +ES+
Sbjct  833  AVAAVIGREMPVELLRASLPHTNAYQRKQLLGFAQRTVPVNNHSSHGSITGPMTSESI  890


 Score = 28.5 bits (62),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  754  SLQPPLRPLGHAAGDGA  770


 Score = 24.6 bits (52),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS I+KSVL+R  
Sbjct  767  GDGASFIIKSVLDRAT  782



>ref|XP_004961544.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Setaria italica]
Length=731

 Score =   115 bits (287),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A ++S    +LWQASFDAFF LLTKYC  K+++I+Q  A    S  +  P
Sbjct  614  ATDLLADPHSAANYSRSTRSLWQASFDAFFGLLTKYCDSKYESIVQRFA-MHGSNSLGGP  672

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFN---SRGGSSRKINAES  293
            E  +A++ EMPVELLRASLPHTNE  R+ L++F + S  ++GF+   SRG     IN+ES
Sbjct  673  EATKAVSREMPVELLRASLPHTNEQHRQTLLDFARKSTHVSGFSPNASRG----HINSES  728

Query  292  V  290
            V
Sbjct  729  V  729


 Score = 32.0 bits (71),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S+QPPLRPLGS AGDG 
Sbjct  587  SQQPPLRPLGSSAGDGA  603


 Score = 25.4 bits (54),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLI+KSVL+R  
Sbjct  600  GDGASLIIKSVLDRAT  615



>gb|EMS48493.1| hypothetical protein TRIUR3_07139 [Triticum urartu]
Length=813

 Score =   119 bits (299),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A ++S    +LWQASFDAFF LLTKYC  K+ +I+Q  +  + S  +  P
Sbjct  694  ATELLADPHSAANYSRSTRSLWQASFDAFFGLLTKYCDSKYGSILQRFS-MQGSNSMAGP  752

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGS  317
            E ++A++ EMPVELLRASLPHT+E QR+ML++F + S+P+ G+N  G S
Sbjct  753  EASKAVSREMPVELLRASLPHTSEEQRQMLLDFARKSMPVIGYNHSGAS  801


 Score = 32.3 bits (72),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLGS AGDG    +K
Sbjct  667  SQQPPLRPLGSSAGDGAALIIK  688



>gb|EMT17005.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=1181

 Score =   119 bits (298),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A ++S    +LWQASFDAFF LLTKYC  K+ +I+Q  +  + S  +  P
Sbjct  695  ATELLADPHSAANYSRSTRSLWQASFDAFFGLLTKYCDSKYGSILQRFSM-QGSNSMAGP  753

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFN---SRGGSS  314
            E ++A++ EMPVELLRASLPHT+E QR+ML++F + S+P+ G+N   +RGG S
Sbjct  754  EASKAVSREMPVELLRASLPHTSEEQRQMLLDFARKSMPVIGYNHSGARGGHS  806


 Score = 32.7 bits (73),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLGS AGDG    +K
Sbjct  668  SQQPPLRPLGSSAGDGAALIIK  689



>ref|XP_004961543.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Setaria italica]
Length=813

 Score =   114 bits (286),  Expect(3) = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A ++S    +LWQASFDAFF LLTKYC  K+++I+Q  A    S  +  P
Sbjct  696  ATDLLADPHSAANYSRSTRSLWQASFDAFFGLLTKYCDSKYESIVQRFA-MHGSNSLGGP  754

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFN---SRGGSSRKINAES  293
            E  +A++ EMPVELLRASLPHTNE  R+ L++F + S  ++GF+   SRG     IN+ES
Sbjct  755  EATKAVSREMPVELLRASLPHTNEQHRQTLLDFARKSTHVSGFSPNASRG----HINSES  810

Query  292  V  290
            V
Sbjct  811  V  811


 Score = 32.0 bits (71),  Expect(3) = 5e-28, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S+QPPLRPLGS AGDG 
Sbjct  669  SQQPPLRPLGSSAGDGA  685


 Score = 25.4 bits (54),  Expect(3) = 5e-28, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLI+KSVL+R  
Sbjct  682  GDGASLIIKSVLDRAT  697



>ref|XP_007133386.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
 gb|ESW05380.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
Length=882

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 3/120 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAV-AQTETSTDVIS  467
            A+ LLTDP    S+ + N + WQASFD FF LLT YC+ K+ +IMQ++  Q   +  VI 
Sbjct  762  ATELLTDPHGGCSY-IANRSFWQASFDEFFGLLTMYCMNKYQSIMQSLLVQGTPNVSVIG  820

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS-RKINAESV  290
             + A+AI+ EMPVELLR SLPHTN+ QRK+L++F Q S+P+ GFN+  GSS   +N+E+V
Sbjct  821  SDAAKAISREMPVELLRVSLPHTNDHQRKLLLDFAQRSVPVVGFNNYTGSSGGHVNSETV  880



>ref|XP_004162291.1| PREDICTED: uncharacterized protein LOC101226533 [Cucumis sativus]
Length=808

 Score =   111 bits (278),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA ++++ + +LWQASFD FF +LTKYCV K+D IMQ+ V  ++ +    +
Sbjct  685  ATLLLTDPNAACNYNLTHRSLWQASFDDFFDILTKYCVNKYDTIMQSLVRHSQQNAAAAA  744

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGF  335
             E A A++ EMPVE+LRASLPHT+  Q+KML+NF Q S+P+ GF
Sbjct  745  SEAAAAMSREMPVEVLRASLPHTDGYQKKMLLNFAQRSMPVGGF  788


 Score = 39.7 bits (91),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKICSGKGHL  637
            SEQPPLRPLGSPAGDG    LK C  +  L
Sbjct  658  SEQPPLRPLGSPAGDGASLILKSCLERATL  687



>ref|XP_004144681.1| PREDICTED: uncharacterized protein LOC101207256 [Cucumis sativus]
 gb|KGN54923.1| hypothetical protein Csa_4G604530 [Cucumis sativus]
Length=808

 Score =   111 bits (278),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA ++++ + +LWQASFD FF +LTKYCV K+D IMQ+ V  ++ +    +
Sbjct  685  ATLLLTDPNAACNYNLTHRSLWQASFDDFFDILTKYCVNKYDTIMQSLVRHSQQNAAAAA  744

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGF  335
             E A A++ EMPVE+LRASLPHT+  Q+KML+NF Q S+P+ GF
Sbjct  745  SEAAAAMSREMPVEVLRASLPHTDGYQKKMLLNFAQRSMPVGGF  788


 Score = 39.7 bits (91),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKICSGKGHL  637
            SEQPPLRPLGSPAGDG    LK C  +  L
Sbjct  658  SEQPPLRPLGSPAGDGASLILKSCLERATL  687



>gb|KJB08598.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=810

 Score =   122 bits (306),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ +LT P  + +F MP+   W+ASFD FF LLTKYCV K+++I+Q++  Q+  +T+VI 
Sbjct  677  ATQVLTHP--SGNFPMPHYTFWRASFDEFFTLLTKYCVTKYESIIQSIHNQSLPTTEVIG  734

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAES  293
             E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+P  G NS  GS+ +IN+ES
Sbjct  735  SE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSVPDNGSNSPAGSNSQINSES  789



>ref|XP_003578526.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Brachypodium 
distachyon]
Length=722

 Score =   115 bits (288),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++S+ N ALWQASFDAFF+LL +YC+ KFD ++  V         + P
Sbjct  611  ATELLTDQHVASTYSIQNRALWQASFDAFFRLLMEYCMSKFDTVVHTVQ--------MQP  662

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A  I SE PVELLRASLPHTNE QRK L++F Q S+P+   +S G  +  + +ESV
Sbjct  663  AAAAVIRSETPVELLRASLPHTNEYQRKQLLSFAQRSMPVNNSSSHGSGNVPMASESV  720


 Score = 30.8 bits (68),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLG  AGDG    +K
Sbjct  584  SQQPPLRPLGYAAGDGASVIIK  605


 Score = 24.6 bits (52),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+KSVL+R  
Sbjct  597  GDGASVIIKSVLDRAT  612



>ref|XP_010238435.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
Length=718

 Score =   115 bits (287),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++S+ N ALWQASFDAFF+LL +YC+ KFD ++  V         + P
Sbjct  607  ATELLTDQHVASTYSIQNRALWQASFDAFFRLLMEYCMSKFDTVVHTVQ--------MQP  658

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A  I SE PVELLRASLPHTNE QRK L++F Q S+P+   +S G  +  + +ESV
Sbjct  659  AAAAVIRSETPVELLRASLPHTNEYQRKQLLSFAQRSMPVNNSSSHGSGNVPMASESV  716


 Score = 30.8 bits (68),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLG  AGDG    +K
Sbjct  580  SQQPPLRPLGYAAGDGASVIIK  601


 Score = 24.6 bits (52),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+KSVL+R  
Sbjct  593  GDGASVIIKSVLDRAT  608



>ref|XP_010692206.1| PREDICTED: protein PAT1 homolog 1 [Beta vulgaris subsp. vulgaris]
Length=784

 Score =   112 bits (279),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL D  A +S++M N A WQASFD FF LL KYC+ K+D I+Q +         ++ 
Sbjct  673  AAELLRDAHAGSSYNMANSAFWQASFDEFFNLLLKYCLNKYDIIVQPMQMQGLPN--LAT  730

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGS  317
            +VA+AI  EMPVELLRASLPHT+E QRK+L++    S+PL G  + GG+
Sbjct  731  DVAKAIKKEMPVELLRASLPHTSEHQRKLLLDLAHRSVPLVGSGAHGGN  779


 Score = 33.5 bits (75),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GS AGDG    LK
Sbjct  646  SEQPPLRPIGSSAGDGASVVLK  667


 Score = 24.6 bits (52),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++LKSVL+R
Sbjct  659  GDGASVVLKSVLDR  672



>gb|ACL52964.1| unknown [Zea mays]
Length=286

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N +LWQASFDAFF LLT+YC+ KFD ++         T  + P
Sbjct  186  ATVLLTDHHVASNYSMRNRSLWQASFDAFFGLLTQYCMSKFDRVVH--------TAQLQP  237

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG  323
              A  I  EMPVELLRASLPHTNE QRK L++F Q ++P+   +S G
Sbjct  238  AAATVITREMPVELLRASLPHTNEAQRKQLLSFAQRTVPVGTHSSHG  284



>ref|XP_008444289.1| PREDICTED: protein PAT1 homolog 1 [Cucumis melo]
Length=808

 Score =   110 bits (275),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LLTDP AA ++++ + +LWQASFD FF +LTKYCV K+D IMQ+ V  +  +    +
Sbjct  685  ATLLLTDPNAACNYNLTHRSLWQASFDDFFNILTKYCVNKYDTIMQSLVRHSPQNAAAAA  744

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGF  335
             + A A++ EMPVE+LRASLPHT+  Q+KML+NF Q S+P+ GF
Sbjct  745  SDAAAAMSREMPVEVLRASLPHTDGYQKKMLLNFAQRSMPVGGF  788


 Score = 38.1 bits (87),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  723  EQPPLRPLGSPAGDGGLAHLKICSGKGHL  637
            EQPPLRPLGSPAGDG    LK C  +  L
Sbjct  659  EQPPLRPLGSPAGDGASLILKSCLERATL  687



>ref|XP_002441360.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
 gb|EES19790.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
Length=802

 Score =   114 bits (285),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A ++S    +LWQASFDAFF LLTKYC  K+++I+Q  A  + S  +  P
Sbjct  685  ATVLLADPHSAANYSRSARSLWQASFDAFFGLLTKYCDSKYESIVQRFA-MQGSNSMGGP  743

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFN---SRGGSSRKINAES  293
            E  +A++ EMPVELLRASLPHTNE  R+ L++F + S  ++GF+   SRG     IN+ES
Sbjct  744  ETTKAVSREMPVELLRASLPHTNEQHRQTLLDFARKSTHVSGFSPNASRG----LINSES  799

Query  292  V  290
            V
Sbjct  800  V  800


 Score = 32.7 bits (73),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLGS AGDG    +K
Sbjct  658  SQQPPLRPLGSAAGDGASVVIK  679



>ref|XP_008649853.1| PREDICTED: uncharacterized protein LOC103630586 [Zea mays]
 gb|AFW78649.1| hypothetical protein ZEAMMB73_732523 [Zea mays]
Length=797

 Score =   110 bits (276),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 8/121 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL DP +A ++S    +LW ASFDAFF LLTKYC  K+++I+Q  A  + S  +  P
Sbjct  680  ATELLADPHSAANYSRSARSLWHASFDAFFGLLTKYCDSKYESIVQRFA-MQGSNSMGGP  738

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFN---SRGGSSRKINAES  293
            E  +A++ EMPVELLRASLPHTNE  R+ L++F + S  L GF+   +RG     +N+ES
Sbjct  739  ETTKAVSREMPVELLRASLPHTNEQHRQTLLDFARKSTHLPGFSPTANRG----LVNSES  794

Query  292  V  290
            V
Sbjct  795  V  795


 Score = 30.8 bits (68),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S+QPPLRPLGS +GDG 
Sbjct  653  SQQPPLRPLGSASGDGA  669


 Score = 25.4 bits (54),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GASLI+KSVL+R  
Sbjct  666  GDGASLIIKSVLDRAT  681



>ref|XP_004952292.1| PREDICTED: uncharacterized protein LOC101759904 [Setaria italica]
Length=820

 Score =   115 bits (288),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 79/118 (67%), Gaps = 8/118 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++S+ N ALWQASFDAFF LLT+YC+ KFD+++         T  + P
Sbjct  709  ATVLLTDQHVASAYSVQNRALWQASFDAFFGLLTQYCMTKFDSVVH--------TAQLQP  760

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A  I+ EMPVELLRASLPHTN  QRK L++F Q ++P+   +S G  S  + ++SV
Sbjct  761  AAAAVISREMPVELLRASLPHTNADQRKQLLSFAQRTVPVGTHSSHGSGSGPMTSDSV  818


 Score = 30.8 bits (68),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S QPPLRPLGSPAGD     +K
Sbjct  682  SLQPPLRPLGSPAGDWASVIIK  703



>ref|NP_001145976.1| hypothetical protein [Zea mays]
 gb|ACN33235.1| unknown [Zea mays]
 gb|AFW70877.1| hypothetical protein ZEAMMB73_167578 [Zea mays]
Length=791

 Score =   113 bits (283),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N +LWQASFDAFF LLT+YC+ KFD ++         T  + P
Sbjct  691  ATVLLTDHHVASNYSMRNRSLWQASFDAFFGLLTQYCMSKFDRVVH--------TAQLQP  742

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG  323
              A  I  EMPVELLRASLPHTNE QRK L++F Q ++P+   +S G
Sbjct  743  AAATVITREMPVELLRASLPHTNEAQRKQLLSFAQRTVPVGTHSSHG  789


 Score = 30.8 bits (68),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKICSGKG  643
            S QPPLRPLGSPAGD     +K    + 
Sbjct  664  SLQPPLRPLGSPAGDWASVIIKYVLDRA  691



>ref|XP_010228364.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Brachypodium 
distachyon]
Length=919

 Score =   113 bits (283),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 8/100 (8%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N  LWQASFDAFF+LLT+YC+ +FD+++  V         + P
Sbjct  806  ATELLTDQHVASTYSMQNRGLWQASFDAFFRLLTEYCMSRFDSVVHTVQ--------MQP  857

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
              A AI+ E+PVELLRASLPHTNE QRK L+NF Q ++P+
Sbjct  858  SAAAAISREIPVELLRASLPHTNENQRKQLLNFAQRTVPI  897


 Score = 28.5 bits (62),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  779  SLQPPLRPLGHAAGDGA  795


 Score = 22.7 bits (47),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+ SVLER  
Sbjct  792  GDGASIIIISVLERAT  807



>ref|XP_009767161.1| PREDICTED: uncharacterized protein LOC104218381 [Nicotiana sylvestris]
Length=800

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ +L DP AA   SMPN + WQASFDAFF LLTKYC  K+D +MQ    Q      V  
Sbjct  690  ATEILRDPHAAAQCSMPNRSFWQASFDAFFGLLTKYCFNKYDIVMQCFFTQAPPGVAVSG  749

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
             + A+AI+ EMPVELLRASLPHT+E Q+K+L++F   S+P+ G  S+ G +
Sbjct  750  SDAAKAISREMPVELLRASLPHTSEQQKKVLLDFAHRSMPVLGVGSQSGGT  800



>ref|XP_010228365.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228366.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
Length=860

 Score =   113 bits (283),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 8/100 (8%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N  LWQASFDAFF+LLT+YC+ +FD+++  V         + P
Sbjct  747  ATELLTDQHVASTYSMQNRGLWQASFDAFFRLLTEYCMSRFDSVVHTVQ--------MQP  798

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  344
              A AI+ E+PVELLRASLPHTNE QRK L+NF Q ++P+
Sbjct  799  SAAAAISREIPVELLRASLPHTNENQRKQLLNFAQRTVPI  838


 Score = 28.5 bits (62),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            S QPPLRPLG  AGDG 
Sbjct  720  SLQPPLRPLGHAAGDGA  736


 Score = 22.7 bits (47),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS+I+ SVLER  
Sbjct  733  GDGASIIIISVLERAT  748



>ref|XP_009604527.1| PREDICTED: uncharacterized protein LOC104099288 [Nicotiana tomentosiformis]
Length=800

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ +L DP AA   S+PN + WQASFDAFF LLTKYC  K+D +MQ    Q      V  
Sbjct  690  ATEILRDPHAAAQCSIPNRSFWQASFDAFFGLLTKYCFNKYDTVMQCFFTQAPPGVAVSG  749

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  314
             + A+AI+ EMPVELLRASLPHT+E Q+K+L++F   S+P+ G  S+ G +
Sbjct  750  SDAAKAISREMPVELLRASLPHTSEQQKKVLLDFAHRSMPVLGVGSQSGGT  800



>ref|XP_006845982.1| hypothetical protein AMTR_s00155p00028780 [Amborella trichopoda]
 gb|ERN07657.1| hypothetical protein AMTR_s00155p00028780 [Amborella trichopoda]
Length=808

 Score =   114 bits (284),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 5/109 (5%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQA-VAQTETSTDVIS  467
            A+ LL DP    S+SMPN  LWQASFDAFF LLTKYC  K+++I+QA V+       + +
Sbjct  698  ATELLMDPHG--SYSMPNRTLWQASFDAFFGLLTKYCFSKYESIIQAVVSGPGGPGPIGA  755

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGG  320
             EVARA+  EMPVELLRASLPHT+E QRK+L+ F Q S  ++G    GG
Sbjct  756  REVARAVAREMPVELLRASLPHTSEAQRKVLVEFSQRS--MSGLTGPGG  802


 Score = 30.0 bits (66),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            +E PPLRPLGS AGDG    +K
Sbjct  671  NEHPPLRPLGSSAGDGASVVVK  692



>ref|XP_002457098.1| hypothetical protein SORBIDRAFT_03g001160 [Sorghum bicolor]
 gb|EES02218.1| hypothetical protein SORBIDRAFT_03g001160 [Sorghum bicolor]
Length=592

 Score =   113 bits (282),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLT+  AA  +S PN ALWQASF+AFF LLTKYCV KFD+++  + +         P
Sbjct  494  ATDLLTEHPAAPDYSAPNRALWQASFNAFFGLLTKYCVSKFDSMVHTMHK--------HP  545

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG  323
              A  I+ E+PVELLRASLPHT+E QR++L+ F Q ++P+AG +S G
Sbjct  546  AAATVIHKELPVELLRASLPHTDEQQRRLLLEFAQRTLPVAGHSSDG  592


 Score = 30.8 bits (68),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SE PPLRPLG  AGDG    +K
Sbjct  467  SEHPPLRPLGYAAGDGATVIIK  488



>ref|XP_010684289.1| PREDICTED: uncharacterized protein LOC104898860 [Beta vulgaris 
subsp. vulgaris]
Length=844

 Score =   110 bits (274),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = -3

Query  625  DPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAI  446
            +PQ+  S ++P+   W+ASF  FF LLTKYCV K+D I+Q+ ++  +S      E ARAI
Sbjct  734  NPQSPGSCNIPHYNFWKASFTTFFTLLTKYCVSKYDTIIQSNSEFSSS------EAARAI  787

Query  445  NSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLA--GFNSRG-GSSRKINAESV  290
              EMPVELLRASLPHT+E QR+MLM+F   SIP +  GFN R   +S  I +ESV
Sbjct  788  RREMPVELLRASLPHTDEHQRRMLMDFAHQSIPFSGTGFNLRDEENSGWITSESV  842


 Score = 31.2 bits (69),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGD  682
            +EQPPLRPLGSP GD
Sbjct  700  TEQPPLRPLGSPTGD  714



>ref|NP_001169926.1| uncharacterized protein LOC100383823 [Zea mays]
 gb|ACN35277.1| unknown [Zea mays]
Length=574

 Score =   109 bits (272),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 7/107 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLT+  AA  +  PN ALWQASF+AFF LLTKYC+ KFD+++  + +       +  
Sbjct  475  ATELLTEQPAAPDYGAPNRALWQASFNAFFGLLTKYCMSKFDSMVHTMHK-------LGA  527

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG  323
              A AI  E+PVELLRASLPHT+E QR++L+ F Q ++P++G  S G
Sbjct  528  AAATAIRKELPVELLRASLPHTDEQQRRLLLEFAQRTVPVSGHGSDG  574


 Score = 30.8 bits (68),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SE PPLRPLG  AGDG    +K
Sbjct  448  SEHPPLRPLGHAAGDGATVVIK  469



>ref|XP_004967457.1| PREDICTED: protein PAT1 homolog 1-like [Setaria italica]
Length=829

 Score =   110 bits (276),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLT+  AA+++S+PN  LWQASF+AFF LLTKYC+ KFD+++  +            
Sbjct  722  ATELLTEQLAASNYSVPNRGLWQASFNAFFGLLTKYCISKFDSLVHTM------------  769

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A AI  E+PVELLRASLPHT+E QR++L+ F Q ++P  G NS+      + +E++
Sbjct  770  HTASAIGRELPVELLRASLPHTDEQQRRILLEFAQRTVPATGHNSQRAPGGTMASETI  827


 Score = 29.3 bits (64),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+ PPLRPLG  AGDG    +K
Sbjct  695  SDHPPLRPLGYAAGDGATVIIK  716



>ref|XP_008655297.1| PREDICTED: uncharacterized protein LOC100383823 isoform X1 [Zea 
mays]
 gb|AFW80455.1| hypothetical protein ZEAMMB73_854795 [Zea mays]
Length=812

 Score =   108 bits (271),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 7/107 (7%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLT+  AA  +  PN ALWQASF+AFF LLTKYC+ KFD+++  + +       +  
Sbjct  713  ATELLTEQPAAPDYGAPNRALWQASFNAFFGLLTKYCMSKFDSMVHTMHK-------LGA  765

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRG  323
              A AI  E+PVELLRASLPHT+E QR++L+ F Q ++P++G  S G
Sbjct  766  AAATAIRKELPVELLRASLPHTDEQQRRLLLEFAQRTVPVSGHGSDG  812


 Score = 30.4 bits (67),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SE PPLRPLG  AGDG    +K
Sbjct  686  SEHPPLRPLGHAAGDGATVVIK  707



>gb|KHG11535.1| Protein PAT1 [Gossypium arboreum]
Length=579

 Score = 97.1 bits (240),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+TD +AA +++M N +LW+ASFD FF LLTKYC+ K+D +MQ++  Q + +  +  
Sbjct  476  ATKLMTDSRAAGNYNMTNLSLWKASFDEFFNLLTKYCINKYDTVMQSLRMQAKPNMAIDE  535

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQ  359
             + A+AI  EMPV+LL A LPH N+ Q+K L++  Q
Sbjct  536  SDSAKAIKREMPVDLLHACLPHLNDQQKKQLLDLSQ  571


 Score = 36.6 bits (83),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  449  SEQPPLRPLGSPAGDGASFILK  470


 Score = 25.0 bits (53),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERGI  639
            G GAS ILKSVL+R  
Sbjct  462  GDGASFILKSVLDRAT  477



>ref|XP_007022269.1| Topoisomerase II-associated protein PAT1, putative [Theobroma 
cacao]
 gb|EOY13794.1| Topoisomerase II-associated protein PAT1, putative [Theobroma 
cacao]
Length=841

 Score = 95.9 bits (237),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+ D +AA +++M N +LW+ASFD FF LLTKYCV K+D +MQ++  Q +    +  
Sbjct  740  ATKLMIDFRAAGNYNMTNQSLWKASFDEFFNLLTKYCVNKYDTVMQSLRLQVKPDMAIDE  799

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
             +  RAI  EMPV+LL A LPH N+ Q+K++ +  Q S+
Sbjct  800  SDATRAIKREMPVDLLHACLPHINDQQKKLIWDLSQRSV  838


 Score = 35.8 bits (81),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GSPAGDG    LK
Sbjct  713  SEQPPLRPVGSPAGDGASLILK  734


 Score = 26.2 bits (56),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLILKSVL+R
Sbjct  726  GDGASLILKSVLDR  739



>gb|EMS67142.1| hypothetical protein TRIUR3_06605 [Triticum urartu]
Length=698

 Score =   106 bits (265),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 8/99 (8%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N  LWQASFDAFF LL  YC+ KFD ++  V         I P
Sbjct  587  ATELLTDQHVASAYSMQNRTLWQASFDAFFGLLMGYCMSKFDTVVHTVQ--------IQP  638

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  347
              A  I+ E PVELLRASLPHTNE QRK L++F Q ++P
Sbjct  639  AAAAVISRETPVELLRASLPHTNEYQRKQLLSFAQRTVP  677


 Score = 30.8 bits (68),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLG  AGDG    +K
Sbjct  560  SQQPPLRPLGYAAGDGASVIIK  581



>gb|EMT27507.1| hypothetical protein F775_52260 [Aegilops tauschii]
Length=806

 Score =   105 bits (263),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 8/99 (8%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LLTD   A+++SM N  LWQASFDAFF LL  YC+ KFD ++  V         + P
Sbjct  695  ATELLTDQHVASAYSMQNRTLWQASFDAFFGLLMGYCMSKFDTVVHTVQ--------MQP  746

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  347
              A  I+ E PVELLRASLPHTNE QRK L++F Q ++P
Sbjct  747  AAAAVISRETPVELLRASLPHTNEYQRKQLLSFAQRTVP  785


 Score = 31.2 bits (69),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            S+QPPLRPLG  AGDG    +K
Sbjct  668  SQQPPLRPLGYAAGDGASVIIK  689



>gb|KJB12762.1| hypothetical protein B456_002G0355002, partial [Gossypium raimondii]
Length=373

 Score = 94.7 bits (234),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+TD +AA +++  N +LW+ASFD FF LLTKYC+ K+D +MQ++  Q + +  +  
Sbjct  270  ATKLMTDSRAAGNYNTTNLSLWKASFDEFFNLLTKYCINKYDTVMQSLRMQAKPNMAIDE  329

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQ  359
             + A+AI  EMPV+LL A LPH N+ Q+K L++  Q
Sbjct  330  SDSAKAIKREMPVDLLHACLPHLNDQQKKQLLDLSQ  365


 Score = 37.0 bits (84),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGDG    LK
Sbjct  243  SEQPPLRPLGSPAGDGASFILK  264


 Score = 25.0 bits (53),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERG  642
            G GAS ILKSVL+R 
Sbjct  256  GDGASFILKSVLDRA  270



>ref|XP_007022271.1| Uncharacterized protein TCM_032442 [Theobroma cacao]
 gb|EOY13796.1| Uncharacterized protein TCM_032442 [Theobroma cacao]
Length=512

 Score = 94.0 bits (232),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+ D +AA++++M N +LW+ASFD FF LLTKYCV KFD +MQ++  Q + +  +  
Sbjct  411  ATKLMIDFRAADNYNMTNQSLWKASFDEFFNLLTKYCVNKFDTVMQSLRMQVKPNMAIGK  470

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
             +  RA   EMPV+LL A LPH N  Q+K++ +  Q S+
Sbjct  471  SDATRAFKREMPVDLLHACLPHINAQQKKLIWDLSQRSM  509


 Score = 35.8 bits (81),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GSPAGDG    LK
Sbjct  384  SEQPPLRPVGSPAGDGASLILK  405


 Score = 26.2 bits (56),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERG  642
            G GASLILKSVL+R 
Sbjct  397  GDGASLILKSVLDRA  411



>ref|XP_002513418.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48821.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score = 99.0 bits (245),  Expect(3) = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 77/118 (65%), Gaps = 15/118 (13%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL + Q A+++++ N ALW+ASFD FF LL KYC+ K+D+IMQ+  Q          
Sbjct  705  AAELLGELQDASNYNVTNRALWKASFDEFFVLLVKYCINKYDSIMQSPIQ----------  754

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A AI  E+P+ELLR S+PHTN+ Q+KML +  Q S  L G NS GG    +N+E+V
Sbjct  755  DPAEAIKRELPMELLRVSVPHTNDYQKKMLYDLSQRS--LVGQNSNGG---HMNSEAV  807


 Score = 31.2 bits (69),  Expect(3) = 8e-23, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  678  SEQPPLRPLGSSAGNGA  694


 Score = 24.3 bits (51),  Expect(3) = 8e-23, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  691  GNGASLILMSVLER  704



>ref|XP_011030729.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Populus euphratica]
Length=794

 Score = 96.3 bits (238),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 13/118 (11%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ L  DP  A ++++ + ALW+ASFD FF LL K+C+ K+D+IMQ+ + ++        
Sbjct  688  ATELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCINKYDSIMQSQSDSDP-------  740

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+        GG+   IN+++V
Sbjct  741  --AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL----VGQDGGNGGHINSQAV  792


 Score = 31.2 bits (69),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  661  SEQPPLRPLGSSAGNGA  677


 Score = 24.6 bits (52),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  674  GNGASLILMSVLER  687



>ref|XP_011030731.1| PREDICTED: protein PAT1 homolog 1 isoform X3 [Populus euphratica]
Length=791

 Score = 96.7 bits (239),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 13/118 (11%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ L  DP  A ++++ + ALW+ASFD FF LL K+C+ K+D+IMQ+ + ++        
Sbjct  685  ATELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCINKYDSIMQSQSDSDP-------  737

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+        GG+   IN+++V
Sbjct  738  --AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL----VGQDGGNGGHINSQAV  789


 Score = 31.2 bits (69),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  658  SEQPPLRPLGSSAGNGA  674


 Score = 24.6 bits (52),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  671  GNGASLILMSVLER  684



>ref|XP_011030730.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Populus euphratica]
Length=793

 Score = 96.7 bits (239),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 13/118 (11%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ L  DP  A ++++ + ALW+ASFD FF LL K+C+ K+D+IMQ+ + ++        
Sbjct  687  ATELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCINKYDSIMQSQSDSDP-------  739

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+        GG+   IN+++V
Sbjct  740  --AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL----VGQDGGNGGHINSQAV  791


 Score = 31.2 bits (69),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  660  SEQPPLRPLGSSAGNGA  676


 Score = 24.6 bits (52),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  673  GNGASLILMSVLER  686



>gb|EPS71565.1| hypothetical protein M569_03193, partial [Genlisea aurea]
Length=420

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTET---STDV  473
            A+ LLTDP  A+  S    + WQASFDAFF +LTKYC   +D +M+ V   +      D 
Sbjct  317  ATELLTDPLHASDCSPSIRSFWQASFDAFFGVLTKYCFNIYDAVMRTVLVHQGPLEEADS  376

Query  472  ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
            + PEVA+    EMPVELLRASLPHTNE QRK+L+ F Q S+
Sbjct  377  VGPEVAKTARKEMPVELLRASLPHTNEQQRKLLLEFTQRSM  417



>ref|XP_002317021.2| hypothetical protein POPTR_0011s14710g [Populus trichocarpa]
 gb|EEE97633.2| hypothetical protein POPTR_0011s14710g [Populus trichocarpa]
Length=736

 Score = 97.1 bits (240),  Expect(3) = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 76/118 (64%), Gaps = 13/118 (11%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ L  DP  A ++++ + ALW+ASFD FF LL K+C+ K+D+IMQ+++ ++        
Sbjct  630  AAELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCINKYDSIMQSLSDSDP-------  682

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
              A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+        GG+   IN+++V
Sbjct  683  --AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL----VGQDGGNGGHINSQAV  734


 Score = 29.6 bits (65),  Expect(3) = 7e-22, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SE PPLRPLGS AG+G 
Sbjct  603  SEHPPLRPLGSSAGNGA  619


 Score = 24.6 bits (52),  Expect(3) = 7e-22, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  616  GNGASLILMSVLER  629



>gb|KHG10037.1| Protein PAT1 [Gossypium arboreum]
Length=782

 Score = 95.9 bits (237),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+ D +AA +++M N +LW+ASFD FF LLTKYC+ K+D +MQ++  Q + +  +  
Sbjct  679  ATKLMIDFRAAGNYNMANQSLWKASFDEFFNLLTKYCINKYDTVMQSLCMQVKPNMAINE  738

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
             +V +AI  EMPV+LL A LPH N+ Q+K++ +  Q S+
Sbjct  739  SDVTKAIKREMPVDLLHACLPHINDQQKKLIFDLSQRSL  777


 Score = 32.0 bits (71),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLG+P+GD     LK
Sbjct  652  SEQPPLRPLGNPSGDWASLILK  673


 Score = 23.1 bits (48),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G  ASLILKSVL+R
Sbjct  665  GDWASLILKSVLDR  678



>gb|KJB26984.1| hypothetical protein B456_004G270000 [Gossypium raimondii]
Length=764

 Score = 95.1 bits (235),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+ D +AA +++M N +LW+ASF+ FF LLTKYC+ K+D +MQ++  Q + +  +  
Sbjct  661  ATKLMIDFRAAGNYNMANQSLWKASFNEFFNLLTKYCINKYDTVMQSLRMQVKPNVAIDE  720

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
             +V +AI  EMPV+LL A LPH N+ Q+K++++  Q S+
Sbjct  721  SDVTKAIKREMPVDLLHACLPHINDQQKKLILDLSQRSL  759


 Score = 32.0 bits (71),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLG+P+GD     LK
Sbjct  634  SEQPPLRPLGNPSGDWASLILK  655


 Score = 23.1 bits (48),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G  ASLILKSVL+R
Sbjct  647  GDWASLILKSVLDR  660



>gb|KHG07822.1| Protein PAT1 [Gossypium arboreum]
Length=785

 Score = 93.6 bits (231),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+TD +A   +++ N +LW+ASFD FF LLTKYCV K+D +MQ++  Q + +  +  
Sbjct  682  ATKLVTDFKAGGDYNISNQSLWKASFDEFFNLLTKYCVNKYDTVMQSLRMQVKPNMVIDE  741

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
             +  +AI  EMPV+LL A LPH NE Q+K++ +  Q S+
Sbjct  742  ADATKAIKREMPVDLLHACLPHINEQQKKLIWDLSQRSM  780


 Score = 36.6 bits (83),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKIC  655
            SEQPPLRPLGSPAGDG    LK  
Sbjct  655  SEQPPLRPLGSPAGDGASFILKCV  678



>gb|KJB82133.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=785

 Score = 94.7 bits (234),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ L+TD +A   +++ N +LW+ASFD FF LLTKYCV K+D +MQ++   +    VI  
Sbjct  682  ATKLVTDFKAGGDYNISNQSLWKASFDEFFNLLTKYCVNKYDTVMQSLRMQDKPNMVIDE  741

Query  463  -EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  350
             +  +AI  EMPV+LL A LPH NE Q+K++ +  Q S+
Sbjct  742  ADATKAIKREMPVDLLHACLPHINEQQKKLIWDLSQRSM  780


 Score = 35.0 bits (79),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLKIC  655
            SEQPPLRPLGSP GDG    LK  
Sbjct  655  SEQPPLRPLGSPTGDGASFILKCV  678



>gb|KDP25122.1| hypothetical protein JCGZ_22657 [Jatropha curcas]
Length=805

 Score = 97.4 bits (241),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL + Q AN+++M N ALW+ASFD FF LL KYC+ K+D+IMQ+             
Sbjct  701  ATELLIELQDANNYNMTNRALWKASFDEFFGLLIKYCINKYDSIMQSSLS----------  750

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A AI  E+P+ELLRAS+PH N+ Q+K+L +  Q S+      S+ G+   +N+ESV
Sbjct  751  DPAEAIKRELPMELLRASVPHVNDYQKKLLYDLSQRSL-----ASQDGNGGHMNSESV  803


 Score = 26.6 bits (57),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SE PPLRPLG+ AG+G 
Sbjct  674  SEPPPLRPLGNSAGNGA  690


 Score = 24.3 bits (51),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  687  GNGASLILMSVLER  700



>gb|KJB12766.1| hypothetical protein B456_002G0357002, partial [Gossypium raimondii]
Length=104

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVA-QTETSTDVIS  467
            A+ L+TD  AA +++  N +LW+ASFD FF LLTKYC+ K+D +MQ++  Q + +  +  
Sbjct  1    ATKLMTDSSAAGNYNTTNLSLWKASFDEFFNLLTKYCINKYDTVMQSLRMQAKPNMAIDE  60

Query  466  PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQ  359
             + A+AI  EMPV+LL A LPH N+ Q+K L++  Q
Sbjct  61   SDSAKAIKREMPVDLLHACLPHLNDQQKKQLLDLSQ  96



>ref|XP_010532520.1| PREDICTED: uncharacterized protein LOC104808528 [Tarenaya hassleriana]
Length=785

 Score = 90.1 bits (222),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 12/103 (12%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I    +Q + S D++      AI  EMP ELLRA
Sbjct  691  NDGLWRASFDEFFTLLTKYCRSKYETIR---SQNQGSADIME----LAIKREMPAELLRA  743

Query  412  SLPHTNELQRKMLMNFGQGSIPL--AGFNSRGGSSRKINAESV  290
            SL HT+E+QR  L+NFG+   P+  +  ++RGG   +IN+E+V
Sbjct  744  SLRHTSEVQRNYLLNFGRKPSPVGESSSHARGG---QINSETV  783


 Score = 35.0 bits (79),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSPAGDG 
Sbjct  650  SEQPPLRPIGSPAGDGA  666


 Score = 21.6 bits (44),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASL+L S+LER
Sbjct  663  GDGASLVLISLLER  676



>gb|KDP25124.1| hypothetical protein JCGZ_22659 [Jatropha curcas]
Length=779

 Score = 92.8 bits (229),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 11/93 (12%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL   Q A+++++ N ALW+ASFD FF LL KYC+ K D+IMQ+           SP
Sbjct  687  ATELLNKLQDASNYNLTNRALWKASFDEFFSLLVKYCINKLDSIMQS-----------SP  735

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNF  365
            + A AI  E+P+ELLRAS+PHTN+ Q+KM+ + 
Sbjct  736  DSAEAIKRELPLELLRASIPHTNDYQKKMIYDI  768


 Score = 31.6 bits (70),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  660  SEQPPLRPLGSSAGNGA  676



>ref|XP_010511200.1| PREDICTED: uncharacterized protein LOC104787331 [Camelina sativa]
Length=782

 Score = 90.1 bits (222),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 12/105 (11%)
 Frame = -3

Query  595  PNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELL  419
            PN  LW+ASFD FF LLTKYC  K++ I     Q + S  DV+      AI  EMP ELL
Sbjct  685  PNDGLWRASFDEFFNLLTKYCRSKYETIR---GQNQGSAADVLE----LAIKREMPAELL  737

Query  418  RASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            RASL HTN++QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  738  RASLRHTNDVQRNYLLNFGRKPSAISESASHARGGG--QINSESV  780


 Score = 32.7 bits (73),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  644  SEQPPLRPIGSSAGDGA  660


 Score = 20.8 bits (42),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  657  GDGASVVLISLLER  670



>ref|XP_006414611.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 ref|XP_006414612.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56064.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56065.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
Length=784

 Score = 88.2 bits (217),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 13/103 (13%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI  EMP ELLRA
Sbjct  691  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NQDNAADVL------AIKREMPAELLRA  742

Query  412  SLPHTNELQRKMLMNFGQGSIPL--AGFNSRGGSSRKINAESV  290
            SL HTNE QR  L+NFG+ + P+  A   +RGG   +I++ESV
Sbjct  743  SLRHTNEDQRNFLLNFGRKASPVSEAATRARGG---QISSESV  782


 Score = 33.9 bits (76),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  648  SEQPPLRPIGSPSGDGA  664


 Score = 20.8 bits (42),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  661  GDGASVVLVSLLER  674



>ref|XP_002300546.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
 gb|EEE85351.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
Length=801

 Score = 87.4 bits (215),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL D   A+ ++  N ALW+ASFD FF LL KYC+ K+D IMQ        + +   
Sbjct  694  ATELLNDLHDASDYNATNGALWKASFDEFFSLLIKYCINKYDGIMQ--------SSLSDS  745

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A +I  E+P+ELLRAS+P TN+ Q+K+L +  Q S+        G +   IN+E V
Sbjct  746  DPAESIKRELPMELLRASVPLTNDYQKKLLYDLSQRSL----VGQDGDNGGDINSEVV  799


 Score = 31.2 bits (69),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  667  SEQPPLRPLGSSAGNGA  683


 Score = 23.9 bits (50),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  680  GNGASLILLSVLER  693



>gb|KFK23118.1| hypothetical protein AALP_AAs49591U000400 [Arabis alpina]
Length=788

 Score = 87.4 bits (215),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI  EMP ELLRA
Sbjct  693  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NQDNAADVLE----LAIKREMPAELLRA  746

Query  412  SLPHTNELQRKMLMNFGQGSIPL--AGFNSRGGSSRKINAESV  290
            SL HTN+ QR  L+NFG+ + P+  +   +RGG   +IN+ESV
Sbjct  747  SLRHTNDDQRNFLLNFGRKASPISESTTRTRGG---QINSESV  786


 Score = 34.3 bits (77),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  649  SEQPPLRPIGSPSGDGA  665


 Score = 20.8 bits (42),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  662  GDGASVVLVSLLER  675



>gb|AAM61209.1| unknown [Arabidopsis thaliana]
Length=148

 Score = 88.2 bits (217),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEM  434
            AN+F+    ALW+ASF+ FF +L +YC+ K+D+IMQ++         IS E A+AI  EM
Sbjct  50   ANNFNNAGIALWRASFNEFFNMLMRYCISKYDSIMQSLQLPPHFATEISEEAAKAIVREM  109

Query  433  PVELLRASLPHTNELQRKMLMNFGQGSI  350
            P+ELLR+S PH +E Q+++LM F + S+
Sbjct  110  PIELLRSSFPHIDEQQKRILMEFLKRSM  137


 Score = 34.7 bits (78),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQ PLRPLGSP GDG    LK
Sbjct  17   SEQAPLRPLGSPVGDGASTVLK  38



>ref|XP_010539589.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Tarenaya hassleriana]
Length=820

 Score = 87.4 bits (215),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEM  434
            AN+++  + ALW+ASFD FF LL K+CV K+D IMQA+     +++ +S   A+AI  EM
Sbjct  715  ANNYNNSSMALWRASFDEFFNLLMKHCVRKYDGIMQALNSQHFASE-MSEAAAQAIVREM  773

Query  433  PVELLRASLPHTNELQRKMLMNF  365
            P+ELLRAS PH +E Q+++LM F
Sbjct  774  PIELLRASFPHISEQQKRILMEF  796


 Score = 35.0 bits (79),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGD     LK
Sbjct  682  SEQPPLRPLGSPAGDAASIVLK  703



>ref|XP_010539588.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Tarenaya hassleriana]
Length=822

 Score = 87.4 bits (215),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEM  434
            AN+++  + ALW+ASFD FF LL K+CV K+D IMQA+     +++ +S   A+AI  EM
Sbjct  717  ANNYNNSSMALWRASFDEFFNLLMKHCVRKYDGIMQALNSQHFASE-MSEAAAQAIVREM  775

Query  433  PVELLRASLPHTNELQRKMLMNF  365
            P+ELLRAS PH +E Q+++LM F
Sbjct  776  PIELLRASFPHISEQQKRILMEF  798


 Score = 35.0 bits (79),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSPAGD     LK
Sbjct  684  SEQPPLRPLGSPAGDAASIVLK  705



>ref|XP_010466506.1| PREDICTED: uncharacterized protein LOC104746679 [Camelina sativa]
Length=782

 Score = 88.6 bits (218),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -3

Query  595  PNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELL  419
            PN  LW+ASFD FF LLTKYC  K++ I     Q + S  DV+      AI  EMP ELL
Sbjct  685  PNDGLWRASFDEFFNLLTKYCRSKYETIR---GQNQGSAADVLE----LAIKREMPAELL  737

Query  418  RASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            RASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  738  RASLRHTNDDQRNYLLNFGRKPSAISESASHARGGG--QINSESV  780


 Score = 32.7 bits (73),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  644  SEQPPLRPIGSSAGDGA  660


 Score = 20.8 bits (42),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  657  GDGASVVLISLLER  670



>ref|XP_010488248.1| PREDICTED: uncharacterized protein LOC104766124 [Camelina sativa]
Length=784

 Score = 88.2 bits (217),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 12/105 (11%)
 Frame = -3

Query  595  PNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELL  419
            PN  LW+ASFD FF LLTKYC  K++ I     Q + S  DV+      AI  EMP ELL
Sbjct  687  PNDGLWRASFDEFFNLLTKYCRSKYETIR---GQNQGSAADVLE----LAIKREMPAELL  739

Query  418  RASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            RASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  740  RASLRHTNDDQRNYLLNFGRKPSAISESASHARGGG--QINSESV  782


 Score = 32.7 bits (73),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  646  SEQPPLRPIGSSAGDGA  662


 Score = 20.8 bits (42),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  659  GDGASVVLISLLER  672



>dbj|BAD94175.1| hypothetical protein [Arabidopsis thaliana]
Length=376

 Score = 87.8 bits (216),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEM  434
            AN+F+    ALW+ASF  FF +L +YC+ K+D+IMQ++         IS E A+AI  EM
Sbjct  278  ANNFNNAGIALWRASFKEFFNMLMRYCISKYDSIMQSLQLPPHFATEISEEAAKAIVREM  337

Query  433  PVELLRASLPHTNELQRKMLMNFGQGSI  350
            P+ELLR+S PH +E Q+++LM F + S+
Sbjct  338  PIELLRSSFPHIDEQQKRILMEFLKRSM  365


 Score = 33.9 bits (76),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQ PLRPLGSP GDG    LK
Sbjct  245  SEQAPLRPLGSPVGDGASTVLK  266



>gb|AAC17049.1| Similar to hypothetical protein product gb|Z97337 from A. thaliana. 
EST gb|H76597 comes from this gene [Arabidopsis thaliana]
Length=841

 Score = 87.8 bits (216),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEM  434
            AN+F+    ALW+ASF+ FF +L +YC+ K+D+IMQ++         IS E A+AI  EM
Sbjct  743  ANNFNNAGIALWRASFNEFFNMLMRYCISKYDSIMQSLQLPPHFATEISEEAAKAIVREM  802

Query  433  PVELLRASLPHTNELQRKMLMNF  365
            P+ELLR+S PH +E Q+++LM F
Sbjct  803  PIELLRSSFPHIDEQQKRILMEF  825


 Score = 33.5 bits (75),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQ PLRPLGSP GDG    LK
Sbjct  710  SEQAPLRPLGSPVGDGASTVLK  731



>ref|NP_565199.1| uncharacterized protein  [Arabidopsis thaliana]
 ref|NP_849904.1| uncharacterized protein  [Arabidopsis thaliana]
 dbj|BAF00945.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH56808.1| AT1G79090 [Arabidopsis thaliana]
 gb|AEE36202.1| uncharacterized protein AT1G79090 [Arabidopsis thaliana]
 gb|AEE36203.1| uncharacterized protein AT1G79090 [Arabidopsis thaliana]
Length=793

 Score = 87.8 bits (216),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEM  434
            AN+F+    ALW+ASF+ FF +L +YC+ K+D+IMQ++         IS E A+AI  EM
Sbjct  695  ANNFNNAGIALWRASFNEFFNMLMRYCISKYDSIMQSLQLPPHFATEISEEAAKAIVREM  754

Query  433  PVELLRASLPHTNELQRKMLMNF  365
            P+ELLR+S PH +E Q+++LM F
Sbjct  755  PIELLRSSFPHIDEQQKRILMEF  777


 Score = 33.1 bits (74),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQ PLRPLGSP GDG    LK
Sbjct  662  SEQAPLRPLGSPVGDGASTVLK  683



>dbj|BAB01945.1| unnamed protein product [Arabidopsis thaliana]
Length=703

 Score = 87.4 bits (215),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLR  416
            N  LW+ASFD FF LLTKYC  K+D I     Q + S  DV+      AI  EMP ELLR
Sbjct  608  NDGLWRASFDEFFNLLTKYCRSKYDTIR---GQNQGSAADVLE----LAIKREMPAELLR  660

Query  415  ASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            ASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  661  ASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  701


 Score = 32.7 bits (73),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  566  SEQPPLRPIGSSAGDGA  582


 Score = 20.8 bits (42),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  579  GDGASVVLISLLER  592



>ref|XP_010525174.1| PREDICTED: uncharacterized protein LOC104803017 [Tarenaya hassleriana]
Length=784

 Score = 86.7 bits (213),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I     Q + + DV+      AI  EMP ELLRA
Sbjct  690  NDGLWRASFDEFFTLLTKYCRSKYETIR---CQNQGNADVME----LAIKKEMPAELLRA  742

Query  412  SLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            SL HT+E QR  L++FG+   P+    S G  S +IN+ESV
Sbjct  743  SLRHTSEEQRNSLLSFGRKPSPIGESTSHGRGS-QINSESV  782


 Score = 33.5 bits (75),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP GDG 
Sbjct  649  SEQPPLRPIGSPVGDGA  665



>emb|CBI34052.3| unnamed protein product [Vitis vinifera]
Length=513

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 22/95 (23%)
 Frame = -3

Query  574  ASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTN  395
            ASFD FF LLTKYC+ K++ I                     I+ EMPVELLRASLPHT+
Sbjct  439  ASFDEFFSLLTKYCLSKYETI---------------------IHREMPVELLRASLPHTD  477

Query  394  ELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            E QRK+L++F Q S+P+ GFN+R GSS ++ +ESV
Sbjct  478  EHQRKLLLDFAQRSMPITGFNTR-GSSGQVTSESV  511



>ref|XP_011014091.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=796

 Score = 84.7 bits (208),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL D   ++ +++ N ALW+ASFD FF LL KYC+ K+D IMQ        + +   
Sbjct  689  ATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCINKYDGIMQ--------SSLSDS  740

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+         G+   IN+E V
Sbjct  741  DPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL----VGQDDGNGGDINSEVV  794


 Score = 31.2 bits (69),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  662  SEQPPLRPLGSSAGNGA  678


 Score = 23.9 bits (50),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  675  GNGASLILLSVLER  688



>ref|XP_011014090.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=797

 Score = 84.7 bits (208),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL D   ++ +++ N ALW+ASFD FF LL KYC+ K+D IMQ        + +   
Sbjct  690  ATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCINKYDGIMQ--------SSLSDS  741

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+         G+   IN+E V
Sbjct  742  DPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL----VGQDDGNGGDINSEVV  795


 Score = 31.2 bits (69),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  663  SEQPPLRPLGSSAGNGA  679


 Score = 23.9 bits (50),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  676  GNGASLILLSVLER  689



>ref|XP_011038109.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=798

 Score = 84.7 bits (208),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL D   ++ +++ N ALW+ASFD FF LL KYC+ K+D IMQ        + +   
Sbjct  691  ATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCINKYDGIMQ--------SSLSDS  742

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+         G+   IN+E V
Sbjct  743  DPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL----VGQDDGNGGDINSEVV  796


 Score = 31.2 bits (69),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  664  SEQPPLRPLGSSAGNGA  680


 Score = 23.9 bits (50),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  677  GNGASLILLSVLER  690



>ref|XP_011038110.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=797

 Score = 84.7 bits (208),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ LL D   ++ +++ N ALW+ASFD FF LL KYC+ K+D IMQ        + +   
Sbjct  690  ATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCINKYDGIMQ--------SSLSDS  741

Query  463  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  290
            + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+         G+   IN+E V
Sbjct  742  DPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL----VGQDDGNGGDINSEVV  795


 Score = 31.2 bits (69),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGS AG+G 
Sbjct  663  SEQPPLRPLGSSAGNGA  679


 Score = 23.9 bits (50),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GASLIL SVLER
Sbjct  676  GNGASLILLSVLER  689



>emb|CDY54867.1| BnaC01g22630D [Brassica napus]
Length=764

 Score = 85.9 bits (211),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 69/122 (57%), Gaps = 8/122 (7%)
 Frame = -3

Query  646  GASYLLTD--PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDV  473
            GAS +L      AA      N  LW+ASFD FF LLTKYC  K++ I     Q   + DV
Sbjct  646  GASVVLVSLLEGAAEVVKNSNDGLWRASFDEFFTLLTKYCRSKYETI-HGQKQESAAADV  704

Query  472  ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFG-QGSIPLAGFNSRGGSSRKINAE  296
            +  EVA  I  EMP ELLRASL HT+E QR  L+NFG +GS P       G    ++++E
Sbjct  705  L--EVA--IKREMPAELLRASLRHTSEDQRNFLLNFGRKGSSPPVSELKTGARGGQVSSE  760

Query  295  SV  290
            SV
Sbjct  761  SV  762


 Score = 33.9 bits (76),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  631  SEQPPLRPIGSPSGDGA  647



>gb|KFK39518.1| hypothetical protein AALP_AA3G254500 [Arabis alpina]
Length=781

 Score = 86.7 bits (213),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 67/104 (64%), Gaps = 12/104 (12%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVAR-AINSEMPVELLR  416
            N  LW+ASFD FF LLTKYC  K++ I    +Q + S    +P+V   AI  EMP ELLR
Sbjct  685  NDGLWRASFDEFFNLLTKYCRSKYETIR---SQNQGS----APDVLELAIKREMPAELLR  737

Query  415  ASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            ASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  738  ASLRHTNDDQRNYLLNFGRKPSAISESASHARGGG--QINSESV  779


 Score = 32.7 bits (73),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  643  SEQPPLRPIGSSAGDGA  659



>ref|XP_006300753.1| hypothetical protein CARUB_v10019819mg [Capsella rubella]
 gb|EOA33651.1| hypothetical protein CARUB_v10019819mg [Capsella rubella]
Length=799

 Score = 83.2 bits (204),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            AN+F+    ALW+ASF+ FF LL KYCV K+D+IMQ++        +T+ IS   A+AI 
Sbjct  699  ANNFNNAGMALWRASFNEFFNLLMKYCVSKYDSIMQSLNSQLPPHFATE-ISEAAAQAIV  757

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH +E Q+++LM F
Sbjct  758  REMPIELLRSSFPHIDEQQKRILMEF  783


 Score = 35.8 bits (81),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  666  SEQPPLRPLGSPVGDGASTILK  687



>ref|XP_006297023.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 ref|XP_006297024.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29921.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29922.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
Length=784

 Score = 85.5 bits (210),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLR  416
            N  LW+ASFD FF LLTKYC  K++ I     Q + S  DV+      AI  EMP ELLR
Sbjct  689  NDGLWRASFDEFFNLLTKYCRSKYETIR---GQNQGSAADVLE----LAIKREMPAELLR  741

Query  415  ASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            ASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  742  ASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  782


 Score = 32.7 bits (73),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  647  SEQPPLRPIGSSAGDGA  663


 Score = 20.8 bits (42),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  660  GDGASVVLISLLER  673



>ref|XP_006283147.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16045.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=792

 Score = 83.2 bits (204),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       E + DV+      AI  EMP ELLRA
Sbjct  694  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NLENTADVLE----LAIKREMPAELLRA  747

Query  412  SLPHTNELQRKMLMNFGQGSIP  347
            SL HTNE QR  L+NFG+ + P
Sbjct  748  SLRHTNEDQRNFLLNFGRRASP  769


 Score = 33.9 bits (76),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  650  SEQPPLRPIGSPSGDGA  666


 Score = 20.8 bits (42),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  663  GDGASVVLVSLLER  676



>ref|XP_006283146.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16044.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=781

 Score = 83.2 bits (204),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       E + DV+      AI  EMP ELLRA
Sbjct  683  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NLENTADVLE----LAIKREMPAELLRA  736

Query  412  SLPHTNELQRKMLMNFGQGSIP  347
            SL HTNE QR  L+NFG+ + P
Sbjct  737  SLRHTNEDQRNFLLNFGRRASP  758


 Score = 33.9 bits (76),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  639  SEQPPLRPIGSPSGDGA  655


 Score = 20.8 bits (42),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  652  GDGASVVLVSLLER  665



>emb|CDY50269.1| BnaAnng10330D [Brassica napus]
Length=768

 Score = 84.3 bits (207),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 73/126 (58%), Gaps = 17/126 (13%)
 Frame = -3

Query  646  GASYLLTD--PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDV  473
            GAS +L     +AA      N  LW+ASFD FF LLTKYC  K++ I     Q   + DV
Sbjct  651  GASVVLVSLLERAAQVVKNSNDGLWRASFDEFFSLLTKYCRSKYETIH---GQENAAADV  707

Query  472  ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFG-QGSIP----LAGFNSRGGSSRK  308
            +  EVA  I  EMP ELLRASL HT+E QR  L+NFG +GS P         +RGG   +
Sbjct  708  L--EVA--IKREMPAELLRASLRHTSEDQRNFLLNFGRKGSSPPPVSELKTGARGG---Q  760

Query  307  INAESV  290
            +++ESV
Sbjct  761  VSSESV  766


 Score = 33.9 bits (76),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  636  SEQPPLRPIGSPSGDGA  652



>emb|CDX79293.1| BnaC06g20100D [Brassica napus]
Length=787

 Score = 82.4 bits (202),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            AN+F+    ALW+ASF+ FF LL +YC+ K+D IMQ++      E +++ IS   A+AI 
Sbjct  687  ANNFNNAGMALWRASFNEFFNLLMRYCISKYDGIMQSLNSQLPPEFASE-ISDAAAQAIV  745

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH +E Q+++LM F
Sbjct  746  REMPIELLRSSFPHIDEQQKRLLMEF  771


 Score = 35.8 bits (81),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  654  SEQPPLRPLGSPVGDGASTVLK  675



>ref|XP_006406189.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
 gb|ESQ47642.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
Length=784

 Score = 84.7 bits (208),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 13/105 (12%)
 Frame = -3

Query  595  PNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETS-TDVISPEVARAINSEMPVELL  419
            PN  LW+ASFD FF LLTKYC  K++ I    +Q + S  DV+      AI  EMP ELL
Sbjct  688  PNDGLWRASFDEFFNLLTKYCRSKYETIR---SQNQGSAADVLE----LAIKREMPAELL  740

Query  418  RASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            RASL HT++ QR  L+NFG+   ++  +  ++RGG   +IN+ESV
Sbjct  741  RASLCHTSDDQRNYLLNFGRKPSAVSESASHARGG---QINSESV  782


 Score = 32.7 bits (73),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  645  SEQPPLRPIGSSAGDGA  661



>ref|XP_009104546.1| PREDICTED: protein PAT1 homolog 1-like [Brassica rapa]
Length=781

 Score = 82.0 bits (201),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            AN+F+    ALW+ASF+ FF LL +YC+ K+D IMQ +      E +++ IS   A+AI 
Sbjct  681  ANNFNNAGMALWRASFNEFFNLLMRYCISKYDGIMQTLNSQLPPEFASE-ISDAAAQAIV  739

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH +E Q+++LM F
Sbjct  740  REMPIELLRSSFPHIDEQQKRLLMEF  765


 Score = 35.8 bits (81),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  648  SEQPPLRPLGSPVGDGASTVLK  669



>emb|CDX68009.1| BnaA07g20490D [Brassica napus]
Length=781

 Score = 82.0 bits (201),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            AN+F+    ALW+ASF+ FF LL +YC+ K+D IMQ +      E +++ IS   A+AI 
Sbjct  681  ANNFNNAGMALWRASFNEFFNLLMRYCISKYDGIMQTLNSQLPPEFASE-ISDAAAQAIV  739

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH +E Q+++LM F
Sbjct  740  REMPIELLRSSFPHIDEQQKRLLMEF  765


 Score = 35.8 bits (81),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  648  SEQPPLRPLGSPVGDGASTVLK  669



>ref|XP_006416798.1| hypothetical protein EUTSA_v10006845mg [Eutrema salsugineum]
 gb|ESQ35151.1| hypothetical protein EUTSA_v10006845mg [Eutrema salsugineum]
Length=788

 Score = 83.2 bits (204),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDV---ISPEVARAIN  443
            AN+++     LW+ASFD FFKLL K+C+ K+DNIMQ +  ++ S      IS   A+AI 
Sbjct  691  ANNYNNAGMNLWRASFDEFFKLLMKHCISKYDNIMQNL-NSQLSPHFGTEISEAAAQAIV  749

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLRAS PH ++ Q+++LM F
Sbjct  750  REMPIELLRASFPHISDEQKRILMEF  775


 Score = 33.5 bits (75),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GD     LK
Sbjct  658  SEQPPLRPLGSPVGDEATIILK  679



>gb|KJB82134.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=562

 Score = 77.8 bits (190),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = -3

Query  643  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISP  464
            A+ L+TD +A   +++ N +LW+ASFD FF LLTKYCV K+D +MQ++   +    VI  
Sbjct  474  ATKLVTDFKAGGDYNISNQSLWKASFDEFFNLLTKYCVNKYDTVMQSLRMQDKPNMVIDE  533

Query  463  -EVARAINSEMPVELLRASLPHTNELQRKM  377
             +  +AI  EMPV+LL AS P     Q K+
Sbjct  534  ADATKAIKREMPVDLLHAS-PKMGSFQVKL  562


 Score = 35.0 bits (79),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  447  SEQPPLRPLGSPTGDGASFILK  468


 Score = 23.5 bits (49),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS ILK VL+R
Sbjct  460  GDGASFILKCVLDR  473



>ref|XP_006389922.1| hypothetical protein EUTSA_v10018148mg [Eutrema salsugineum]
 gb|ESQ27208.1| hypothetical protein EUTSA_v10018148mg [Eutrema salsugineum]
Length=782

 Score = 81.3 bits (199),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -3

Query  586  ALWQASFDAFFKLLTKYCVCKFDNIMQAVA---QTETSTDVISPEVARAINSEMPVELLR  416
            ALW+ASF  FF LL KYC+ K+D+IMQ++    Q   +T+ IS   A+AI  EMP+ELLR
Sbjct  693  ALWRASFTEFFNLLMKYCISKYDSIMQSLNSQLQPHLATE-ISDAAAQAIVREMPIELLR  751

Query  415  ASLPHTNELQRKMLMNF  365
            +S PH +E Q+++LM F
Sbjct  752  SSFPHIDEQQKRILMEF  768


 Score = 35.4 bits (80),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRP+GSP GDG    LK
Sbjct  651  SEQPPLRPIGSPVGDGASTVLK  672



>ref|XP_009145394.1| PREDICTED: uncharacterized protein LOC103869095 [Brassica rapa]
Length=791

 Score = 85.1 bits (209),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 15/114 (13%)
 Frame = -3

Query  622  PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAI  446
            P+AA+  S  N  LW+ASF+ FF LLTKYC  K++ I    +Q + S  DV+      AI
Sbjct  688  PRAAHGSS--NDGLWRASFNEFFNLLTKYCRSKYETIR---SQNQGSAADVLE----LAI  738

Query  445  NSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
              EMP ELLRASL HTN+ QR  L+NFG+   ++  +  ++RGG   +IN+ESV
Sbjct  739  KREMPAELLRASLRHTNDDQRNYLLNFGRKPSAVSESASHARGG---QINSESV  789


 Score = 31.6 bits (70),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS +GDG 
Sbjct  648  SEQPPLRPIGSSSGDGA  664



>gb|KDO64328.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
Length=622

 Score = 82.8 bits (203),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -3

Query  601  SMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVEL  422
            SM N  LW ASFD FF LLTKYC+ K++ I Q+   TE +        + AI  EMP EL
Sbjct  524  SMRNLDLWHASFDNFFDLLTKYCMSKYETIKQSQPSTEVNN-------SEAIKREMPREL  576

Query  421  LRASLPHTNELQRKMLMNFGQG------SIPLAGFNSR  326
            LRASLPHTN+ Q   L NF         SIP AG  ++
Sbjct  577  LRASLPHTNDEQLNSLRNFASQCESNAESIPCAGHGNQ  614


 Score = 33.9 bits (76),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGD  
Sbjct  487  SEQPPLRPLGSPAGDSA  503



>emb|CAB10277.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78541.1| hypothetical protein [Arabidopsis thaliana]
Length=679

 Score = 83.2 bits (204),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -3

Query  622  PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAIN  443
            P   ++   PN  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI 
Sbjct  571  PPRVSNHGNPNDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NHDNAADVLE----LAIK  624

Query  442  SEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSR--KINAESV  290
             EMP ELLRASL HTNE QR  L+N G+ + P++   +   S+   +IN+E V
Sbjct  625  REMPAELLRASLRHTNEDQRNFLLNVGRSASPVSESTTTRASASGGQINSEFV  677


 Score = 31.6 bits (70),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS +GDG 
Sbjct  535  SEQPPLRPIGSSSGDGA  551


 Score = 20.8 bits (42),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  548  GDGASVVLVSLLER  561



>ref|NP_567452.2| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AAK59544.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83534.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=787

 Score = 83.6 bits (205),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = -3

Query  622  PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAIN  443
            P   ++   PN  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI 
Sbjct  679  PPRVSNHGNPNDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NHDNAADVLE----LAIK  732

Query  442  SEMPVELLRASLPHTNELQRKMLMNFGQGSIPLA  341
             EMP ELLRASL HTNE QR  L+N G+ + P++
Sbjct  733  REMPAELLRASLRHTNEDQRNFLLNVGRSASPVS  766


 Score = 31.6 bits (70),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS +GDG 
Sbjct  643  SEQPPLRPIGSSSGDGA  659


 Score = 20.8 bits (42),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  656  GDGASVVLVSLLER  669



>ref|XP_006429752.1| hypothetical protein CICLE_v10013436mg, partial [Citrus clementina]
 gb|ESR42992.1| hypothetical protein CICLE_v10013436mg, partial [Citrus clementina]
Length=695

 Score = 82.4 bits (202),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -3

Query  601  SMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVEL  422
            SM N  LW ASFD FF LLTKYC+ K++ I Q+   TE +        + AI  EMP EL
Sbjct  597  SMRNLDLWHASFDNFFDLLTKYCMSKYETIKQSQPSTEVNN-------SEAIKREMPREL  649

Query  421  LRASLPHTNELQRKMLMNFGQG------SIPLAGFNSR  326
            LRASLPHTN+ Q   L NF         SIP AG  ++
Sbjct  650  LRASLPHTNDEQLNSLRNFASQCESNAESIPCAGHGNQ  687


 Score = 33.9 bits (76),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGD  
Sbjct  560  SEQPPLRPLGSPAGDSA  576



>gb|KDO64329.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
Length=655

 Score = 82.4 bits (202),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -3

Query  601  SMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVEL  422
            SM N  LW ASFD FF LLTKYC+ K++ I Q+   TE +        + AI  EMP EL
Sbjct  557  SMRNLDLWHASFDNFFDLLTKYCMSKYETIKQSQPSTEVNN-------SEAIKREMPREL  609

Query  421  LRASLPHTNELQRKMLMNFGQG------SIPLAGFNSR  326
            LRASLPHTN+ Q   L NF         SIP AG  ++
Sbjct  610  LRASLPHTNDEQLNSLRNFASQCESNAESIPCAGHGNQ  647


 Score = 33.9 bits (76),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGD  
Sbjct  520  SEQPPLRPLGSPAGDSA  536



>ref|XP_006481341.1| PREDICTED: uncharacterized protein LOC102618153 isoform X2 [Citrus 
sinensis]
Length=768

 Score = 82.8 bits (203),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -3

Query  601  SMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVEL  422
            SM N  LW ASFD FF LLTKYC+ K++ I Q+   TE +        + AI  EMP EL
Sbjct  670  SMRNLDLWHASFDNFFDLLTKYCMSKYETIKQSQPSTEVNN-------SEAIKREMPREL  722

Query  421  LRASLPHTNELQRKMLMNFGQG------SIPLAGFNSR  326
            LRASLPHTN+ Q   L NF         SIP AG  ++
Sbjct  723  LRASLPHTNDEQLNSLRNFASQCESNAESIPCAGHGNQ  760


 Score = 33.5 bits (75),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGD  
Sbjct  633  SEQPPLRPLGSPAGDSA  649



>ref|XP_006481340.1| PREDICTED: uncharacterized protein LOC102618153 isoform X1 [Citrus 
sinensis]
Length=793

 Score = 82.4 bits (202),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -3

Query  601  SMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVEL  422
            SM N  LW ASFD FF LLTKYC+ K++ I Q+   TE +        + AI  EMP EL
Sbjct  695  SMRNLDLWHASFDNFFDLLTKYCMSKYETIKQSQPSTEVNN-------SEAIKREMPREL  747

Query  421  LRASLPHTNELQRKMLMNFGQG------SIPLAGFNSR  326
            LRASLPHTN+ Q   L NF         SIP AG  ++
Sbjct  748  LRASLPHTNDEQLNSLRNFASQCESNAESIPCAGHGNQ  785


 Score = 33.5 bits (75),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGD  
Sbjct  658  SEQPPLRPLGSPAGDSA  674



>gb|KDO64330.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
 gb|KDO64331.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
Length=680

 Score = 82.4 bits (202),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -3

Query  601  SMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVEL  422
            SM N  LW ASFD FF LLTKYC+ K++ I Q+   TE +        + AI  EMP EL
Sbjct  582  SMRNLDLWHASFDNFFDLLTKYCMSKYETIKQSQPSTEVNN-------SEAIKREMPREL  634

Query  421  LRASLPHTNELQRKMLMNFGQG------SIPLAGFNSR  326
            LRASLPHTN+ Q   L NF         SIP AG  ++
Sbjct  635  LRASLPHTNDEQLNSLRNFASQCESNAESIPCAGHGNQ  672


 Score = 33.9 bits (76),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRPLGSPAGD  
Sbjct  545  SEQPPLRPLGSPAGDSA  561



>emb|CDX88505.1| BnaC06g39490D [Brassica napus]
Length=761

 Score = 80.1 bits (196),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
             N+F+    ALW+ASF+ F+ LL +YC+ K+D IMQ++      E +++ IS   A+AI 
Sbjct  660  GNNFNNAGMALWRASFNEFYNLLMRYCISKYDGIMQSLNSQLPPEFASE-ISDAAAQAIV  718

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH +E Q+++LM F
Sbjct  719  REMPIELLRSSFPHIDEQQKRLLMEF  744


 Score = 35.8 bits (81),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  627  SEQPPLRPLGSPVGDGASTVLK  648



>ref|XP_010429781.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=800

 Score = 79.7 bits (195),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT--ETSTDVISPEVARAINS  440
            AN+F+    ALW+ASF+ FF L+ KYC+ K+++IMQ++           IS    +AI+ 
Sbjct  699  ANNFNNAVMALWRASFNEFFNLVMKYCISKYESIMQSLNSQLPPHFAAEISDAATQAISR  758

Query  439  EMPVELLRASLPHTNELQRKMLMNFGQGSI  350
            EMP+ELLRAS PH +E Q+++L+ F +GS+
Sbjct  759  EMPIELLRASFPHIDEQQKRILLEFIKGSM  788


 Score = 35.8 bits (81),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  666  SEQPPLRPLGSPVGDGASTVLK  687



>ref|XP_009147964.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=768

 Score = 81.6 bits (200),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 17/126 (13%)
 Frame = -3

Query  646  GASYLLTD--PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDV  473
            GAS +L     +AA      N  LW+ASFD FF LLTKYC  K++ I     Q   +  V
Sbjct  651  GASVVLVSLLERAAQVVKNSNDGLWRASFDEFFSLLTKYCRSKYETIH---GQENAAAHV  707

Query  472  ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFG-QGSIPLA----GFNSRGGSSRK  308
            +  EVA  I  EMP ELLRASL HT+E QR  L+NFG +GS P         +RGG   +
Sbjct  708  L--EVA--IKREMPAELLRASLRHTSEDQRNFLLNFGRKGSSPPPVSELKTGARGG---Q  760

Query  307  INAESV  290
            +++ESV
Sbjct  761  VSSESV  766


 Score = 33.9 bits (76),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  636  SEQPPLRPIGSPSGDGA  652



>ref|NP_188866.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AEE76616.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=782

 Score = 82.0 bits (201),  Expect(3) = 4e-17, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 13/104 (13%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTE-TSTDVISPEVARAINSEMPVELLR  416
            N  LW+ASFD FF LLTKYC  K+D I     Q + ++ DV+      AI  EMP ELLR
Sbjct  687  NDGLWRASFDEFFNLLTKYCRSKYDTIR---GQNQGSAADVLE----LAIKREMPAELLR  739

Query  415  ASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            ASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  740  ASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  780


 Score = 32.7 bits (73),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  645  SEQPPLRPIGSSAGDGA  661


 Score = 20.8 bits (42),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  658  GDGASVVLISLLER  671



>emb|CDX87408.1| BnaA07g34650D [Brassica napus]
Length=754

 Score = 80.5 bits (197),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT--ETSTDVISPEVARAINS  440
             N+F+    ALW+ASF+ F+ LL +YC+ K+D IMQ++           IS   A+AI  
Sbjct  653  GNNFNTAGMALWRASFNEFYNLLMRYCISKYDGIMQSLNSQLPPEFAGEISDAAAQAIVR  712

Query  439  EMPVELLRASLPHTNELQRKMLMNF  365
            EMP+ELLR+S PH +E Q+++LM F
Sbjct  713  EMPIELLRSSFPHIDEQQKRLLMEF  737


 Score = 35.0 bits (79),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLG+P GDG    LK
Sbjct  620  SEQPPLRPLGTPVGDGASTVLK  641



>dbj|BAF00849.1| hypothetical protein [Arabidopsis thaliana]
Length=782

 Score = 82.0 bits (201),  Expect(3) = 4e-17, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 13/104 (13%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTE-TSTDVISPEVARAINSEMPVELLR  416
            N  LW+ASFD FF LLTKYC  K+D I     Q + ++ DV+      AI  EMP ELLR
Sbjct  687  NDGLWRASFDEFFNLLTKYCRSKYDTIR---GQNQGSAADVLE----LAIKREMPAELLR  739

Query  415  ASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            ASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  740  ASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  780


 Score = 32.7 bits (73),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  645  SEQPPLRPIGSSAGDGA  661


 Score = 20.8 bits (42),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  658  GDGASVVLISLLER  671



>dbj|BAF01932.1| hypothetical protein [Arabidopsis thaliana]
Length=332

 Score = 82.4 bits (202),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -3

Query  622  PQAANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAIN  443
            P   ++   PN  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI 
Sbjct  224  PPRVSNHGNPNDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NHDNAADVLE----LAIK  277

Query  442  SEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSR--KINAESV  290
             EMP ELLRASL HTNE QR  L+N G+ + P++   +   S+   +IN+E V
Sbjct  278  REMPAELLRASLRHTNEDQRNFLLNVGRSASPVSESTTTRASASGGQINSEFV  330


 Score = 32.0 bits (71),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS +GDG 
Sbjct  188  SEQPPLRPIGSSSGDGA  204


 Score = 20.8 bits (42),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -2

Query  686  GMGASLILKSVLERG  642
            G GAS++L S+LER 
Sbjct  201  GDGASVVLVSLLERA  215



>ref|XP_009106629.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=754

 Score = 79.7 bits (195),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT--ETSTDVISPEVARAINS  440
             N+F+    ALW+ASF+ F+ LL +YC+ K+D IMQ++           IS   A+AI  
Sbjct  653  GNNFNTAGMALWRASFNEFYNLLMRYCISKYDGIMQSLNSQLPPEFAGEISDAAAQAIVR  712

Query  439  EMPVELLRASLPHTNELQRKMLMNF  365
            EMP+ELLR+S PH  E Q+++LM F
Sbjct  713  EMPIELLRSSFPHIGEQQKRLLMEF  737


 Score = 35.0 bits (79),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLG+P GDG    LK
Sbjct  620  SEQPPLRPLGTPVGDGASTVLK  641



>emb|CDY39512.1| BnaA01g24760D [Brassica napus]
Length=774

 Score = 80.5 bits (197),  Expect(3) = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 14/103 (14%)
 Frame = -3

Query  586  ALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLRAS  410
             LW+ASFD FF LLTKYC  K++ I    +Q + S  DV+  EVA  I  EMP ELLRAS
Sbjct  667  GLWRASFDEFFNLLTKYCRSKYETIR---SQNQGSAADVL--EVA--IKREMPAELLRAS  719

Query  409  LPHTNELQRKMLMNFGQ---GSIPLAGFNSRGGSSRKINAESV  290
            + HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  720  IRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  759


 Score = 32.7 bits (73),  Expect(3) = 9e-17, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  625  SEQPPLRPIGSSAGDGA  641


 Score = 20.8 bits (42),  Expect(3) = 9e-17, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  638  GDGASVVLISLLER  651



>ref|XP_002868239.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44498.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score = 80.1 bits (196),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI  EMP ELLRA
Sbjct  690  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NQDNAADVLE----LAIKREMPAELLRA  743

Query  412  SLPHTNELQRKMLMNFGQGSIPLA  341
            SL HTNE QR  L+N G+ + P++
Sbjct  744  SLRHTNENQRNFLLNVGRSASPVS  767


 Score = 33.9 bits (76),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  646  SEQPPLRPIGSPSGDGA  662



>ref|XP_010419368.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=833

 Score = 78.2 bits (191),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 4/82 (5%)
 Frame = -3

Query  586  ALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAINSEMPVELLR  416
            ALW+ASF+ FF L+ KYC+ K+++IMQ++        +T+ IS    +AI  EMP+ELLR
Sbjct  708  ALWRASFNEFFNLVMKYCISKYESIMQSLNSQLPPHFATE-ISDAATQAIAREMPIELLR  766

Query  415  ASLPHTNELQRKMLMNFGQGSI  350
            AS PH +E Q+++L+ F +GS+
Sbjct  767  ASFPHIDEQQKRILLEFIKGSM  788


 Score = 35.8 bits (81),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  666  SEQPPLRPLGSPVGDGASTVLK  687



>ref|XP_009108983.1| PREDICTED: uncharacterized protein LOC103834665 isoform X1 [Brassica 
rapa]
Length=774

 Score = 80.1 bits (196),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 14/103 (14%)
 Frame = -3

Query  586  ALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLRAS  410
             LW+ASFD FF LLTKYC  K++ I    +Q + S  DV+  EVA  I  EMP ELLRAS
Sbjct  667  GLWRASFDEFFNLLTKYCRSKYETIR---SQNQGSAADVL--EVA--IKREMPAELLRAS  719

Query  409  LPHTNELQRKMLMNFGQGS---IPLAGFNSRGGSSRKINAESV  290
            + HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  720  IRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  759


 Score = 32.7 bits (73),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  625  SEQPPLRPIGSSAGDGA  641


 Score = 20.8 bits (42),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  638  GDGASVVLISLLER  651



>ref|XP_009108988.1| PREDICTED: uncharacterized protein LOC103834665 isoform X2 [Brassica 
rapa]
Length=773

 Score = 80.1 bits (196),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 14/103 (14%)
 Frame = -3

Query  586  ALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLRAS  410
             LW+ASFD FF LLTKYC  K++ I    +Q + S  DV+  EVA  I  EMP ELLRAS
Sbjct  666  GLWRASFDEFFNLLTKYCRSKYETIR---SQNQGSAADVL--EVA--IKREMPAELLRAS  718

Query  409  LPHTNELQRKMLMNFGQGS---IPLAGFNSRGGSSRKINAESV  290
            + HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  719  IRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  758


 Score = 32.7 bits (73),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  624  SEQPPLRPIGSSAGDGA  640


 Score = 20.8 bits (42),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  637  GDGASVVLISLLER  650



>ref|XP_002889231.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65490.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score = 80.9 bits (198),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            AN+F+    ALW+ASF+ FF +L +YC+ K+D+IMQ++      + +T+ IS   A+AI 
Sbjct  688  ANNFNNTGMALWRASFNEFFNMLMRYCISKYDSIMQSLNSQLPPQFATE-ISDAAAQAIV  746

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH +E Q+++LM F
Sbjct  747  REMPIELLRSSFPHIDEQQKRILMEF  772


 Score = 32.7 bits (73),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQ PLRPLGSP GDG    LK
Sbjct  655  SEQAPLRPLGSPVGDGASMVLK  676



>ref|XP_002883351.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59610.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score = 80.1 bits (196),  Expect(3) = 1e-16, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTE-TSTDVISPEVARAINSEMPVELLR  416
            N  LW+ASFD FF LLTKYC  K++ I     Q + ++ DV+      AI  EMP ELLR
Sbjct  687  NDGLWRASFDEFFNLLTKYCRSKYETIR---GQNQGSAADVLE----LAIKREMPAELLR  739

Query  415  ASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  290
            ASL HTN+ QR  L+NFG    +I  +  ++RGG   +IN+ESV
Sbjct  740  ASLRHTNDDQRNYLLNFGHKPSAISESASHARGG---QINSESV  780


 Score = 32.7 bits (73),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  645  SEQPPLRPIGSSAGDGA  661


 Score = 20.8 bits (42),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  686  GMGASLILKSVLER  645
            G GAS++L S+LER
Sbjct  658  GDGASVVLISLLER  671



>gb|KFK42288.1| hypothetical protein AALP_AA2G236100 [Arabis alpina]
Length=798

 Score = 77.8 bits (190),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            ANSF+    ALW+ASF+ FF LL KYC+ K+D+IM  +        +T+ IS   A+AI 
Sbjct  703  ANSFNNAGMALWRASFNEFFNLLMKYCISKYDSIMTNLNSQLPPHFATE-ISDAAAQAIV  761

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLR+S PH ++ Q+ +LM F
Sbjct  762  REMPIELLRSSFPHIDDQQKNLLMEF  787


 Score = 35.8 bits (81),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GDG    LK
Sbjct  670  SEQPPLRPLGSPVGDGASTVLK  691



>ref|XP_010496132.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=796

 Score = 77.8 bits (190),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI  EMP ELLRA
Sbjct  699  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NHDNAADVLE----LAIKREMPAELLRA  752

Query  412  SLPHTNELQRKMLMNFGQGSIPL  344
            SL HTNE QR  L+NFG+ + P+
Sbjct  753  SLRHTNEDQRNFLLNFGRRASPV  775


 Score = 35.0 bits (79),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSPAGDG 
Sbjct  654  SEQPPLRPIGSPAGDGA  670



>emb|CDY46332.1| BnaC01g31660D [Brassica napus]
Length=774

 Score = 80.1 bits (196),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 14/103 (14%)
 Frame = -3

Query  586  ALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLRAS  410
             LW+ASFD FF LLTKYC  K++ I    +Q + S  DV+  EVA  I  EMP ELLRAS
Sbjct  667  GLWRASFDEFFNLLTKYCRSKYETIR---SQNQGSAADVL--EVA--IKREMPAELLRAS  719

Query  409  LPHTNELQRKMLMNFGQ---GSIPLAGFNSRGGSSRKINAESV  290
            + HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  720  IRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  759


 Score = 32.7 bits (73),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GS AGDG 
Sbjct  625  SEQPPLRPIGSSAGDGA  641



>ref|XP_010435003.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 77.4 bits (189),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       + ++DV+      AI  EMP ELLRA
Sbjct  698  NDGLWRASFDEFFSLLTKYCRSKYEMIHGQ--NQDNASDVLE----LAIKREMPAELLRA  751

Query  412  SLPHTNELQRKMLMNFGQGSIPL  344
            SL HTNE QR  L+NFG+ + P+
Sbjct  752  SLRHTNEDQRNFLLNFGRRASPV  774


 Score = 33.9 bits (76),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  653  SEQPPLRPIGSPSGDGA  669



>ref|XP_010440363.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 76.3 bits (186),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -3

Query  592  NPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRA  413
            N  LW+ASFD FF LLTKYC  K++ I       + + DV+      AI  EMP ELLRA
Sbjct  698  NDGLWRASFDEFFSLLTKYCRSKYETIHGQ--NHDNAADVLE----LAIKREMPAELLRA  751

Query  412  SLPHTNELQRKMLMNFGQGSIPL  344
            SL HTNE QR  L+NFG+ + P+
Sbjct  752  SLRHTNEDQRNFLLNFGRRASPV  774


 Score = 33.9 bits (76),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGG  676
            SEQPPLRP+GSP+GDG 
Sbjct  653  SEQPPLRPIGSPSGDGA  669



>ref|XP_002890176.1| hypothetical protein ARALYDRAFT_889054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66435.1| hypothetical protein ARALYDRAFT_889054 [Arabidopsis lyrata subsp. 
lyrata]
Length=770

 Score = 75.5 bits (184),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAIN  443
            AN+++     LW+ASFD FF LL K+C+ K+D+IMQ +        +T+ +S   A+AI 
Sbjct  673  ANNYNNAGMNLWRASFDEFFNLLMKHCISKYDSIMQNLNSQLPPHFATE-MSEAAAQAIV  731

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  732  REMPIELLRASFPHISDEQKRILVEF  757


 Score = 33.5 bits (75),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GD     LK
Sbjct  640  SEQPPLRPLGSPVGDEATIILK  661



>ref|XP_010480501.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=760

 Score = 77.4 bits (189),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 4/87 (5%)
 Frame = -3

Query  616  AANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAI  446
            +AN+++     LW+ASFD FF LL K+C+ K+D+IMQ +        +T+ +S   A+AI
Sbjct  662  SANNYNNAGMNLWRASFDEFFNLLMKHCISKYDSIMQNLNSQFLPHFATE-MSDAAAQAI  720

Query  445  NSEMPVELLRASLPHTNELQRKMLMNF  365
              EMP+ELLRAS PH ++ Q+++LM F
Sbjct  721  VREMPIELLRASFPHISDEQKRILMEF  747


 Score = 32.0 bits (71),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SE PPLRPLGSP GD     LK
Sbjct  630  SEHPPLRPLGSPVGDESTIILK  651



>ref|XP_010497980.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=573

 Score = 77.4 bits (189),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 4/87 (5%)
 Frame = -3

Query  616  AANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQT---ETSTDVISPEVARAI  446
            +AN+++     LW+ASFD FF LL K+C+ K+D+IMQ +        +T+ +S   A+AI
Sbjct  475  SANNYNNAGMNLWRASFDEFFNLLMKHCISKYDSIMQNLNSQLLPHFATE-MSDAAAQAI  533

Query  445  NSEMPVELLRASLPHTNELQRKMLMNF  365
              EMP+ELLRAS PH ++ Q+++LM F
Sbjct  534  VREMPIELLRASFPHISDEQKRILMEF  560


 Score = 31.6 bits (70),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SE PPLRPLGSP GD     LK
Sbjct  443  SEHPPLRPLGSPVGDESTIILK  464



>ref|XP_002980379.1| hypothetical protein SELMODRAFT_112306 [Selaginella moellendorffii]
 gb|EFJ18639.1| hypothetical protein SELMODRAFT_112306 [Selaginella moellendorffii]
Length=472

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 6/126 (5%)
 Frame = -3

Query  715  TSPPTWKPCW---GWGPRSS*NLFWKGASYLLTDPQAANSFSMPNPALWQASFDAFFKLL  545
            + PP  +P     G G   +       A+ +LTD      + + N ++WQASFDAFF LL
Sbjct  330  SEPPPLRPVGSPSGDGATVALQAVLDRATSILTDRNV--QYPLQNTSVWQASFDAFFGLL  387

Query  544  TKYCVCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMN  368
            +KYC  K+++IM ++   +  S+  I+   A A+  EMP+ELLR+SLPHTNE QRK L+ 
Sbjct  388  SKYCTNKYESIMHSLLMASAGSSAAINAAAAAAMTREMPIELLRSSLPHTNENQRKRLLE  447

Query  367  FGQGSI  350
              Q S+
Sbjct  448  LAQRSL  453



>ref|XP_002962712.1| hypothetical protein SELMODRAFT_165728 [Selaginella moellendorffii]
 gb|EFJ36175.1| hypothetical protein SELMODRAFT_165728 [Selaginella moellendorffii]
Length=474

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 6/126 (5%)
 Frame = -3

Query  715  TSPPTWKPCW---GWGPRSS*NLFWKGASYLLTDPQAANSFSMPNPALWQASFDAFFKLL  545
            + PP  +P     G G   +       A+ +LTD      + + N ++WQASFDAFF LL
Sbjct  332  SEPPPLRPVGSPSGDGATVALQAVLDRATSILTDRNV--QYPLQNTSVWQASFDAFFGLL  389

Query  544  TKYCVCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMN  368
            +KYC  K+++IM ++   +  S+  I+   A A+  EMP+ELLR+SLPHTNE QRK L+ 
Sbjct  390  SKYCTNKYESIMHSLLMASAGSSAAINAAAAAAMTREMPIELLRSSLPHTNENQRKRLLE  449

Query  367  FGQGSI  350
              Q S+
Sbjct  450  LAQRSL  455



>emb|CDY35105.1| BnaA06g11150D [Brassica napus]
Length=551

 Score = 73.6 bits (179),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -3

Query  613  ANSFSMPNPALWQASFDAFFKLLTKYCVCKFDNIMQAVAQTETSTDV---ISPEVARAIN  443
            AN ++     LW+ASFD FF LL K+C+ K+D+IMQ +  ++ S      ++   A+AI 
Sbjct  453  ANHYNNAGMNLWRASFDEFFNLLMKHCISKYDSIMQNL-NSQLSPHFGAEMTEAAAQAIV  511

Query  442  SEMPVELLRASLPHTNELQRKMLMNF  365
             EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  512  REMPIELLRASFPHISDEQKRILVEF  537


 Score = 34.3 bits (77),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  726  SEQPPLRPLGSPAGDGGLAHLK  661
            SEQPPLRPLGSP GD     LK
Sbjct  420  SEQPPLRPLGSPVGDEATVILK  441



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455