BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034G15

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    355   2e-117   Populus euphratica
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    355   4e-117   Populus euphratica
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             352   2e-116   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    353   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             353   3e-116   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    352   4e-116   
gb|KJB14201.1|  hypothetical protein B456_002G114000                    350   2e-115   Gossypium raimondii
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    350   3e-115   Gossypium arboreum [tree cotton]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    350   3e-115   Tarenaya hassleriana [spider flower]
gb|KJB57938.1|  hypothetical protein B456_009G186400                    347   4e-115   Gossypium raimondii
emb|CDP07271.1|  unnamed protein product                                349   6e-115   Coffea canephora [robusta coffee]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    348   1e-114   Gossypium arboreum [tree cotton]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    348   1e-114   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    348   2e-114   
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    348   2e-114   
gb|ACU20783.1|  unknown                                                 347   2e-114   Glycine max [soybeans]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    347   3e-114   Glycine soja [wild soybean]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    347   3e-114   Malus domestica [apple tree]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    347   3e-114   Gossypium raimondii
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    346   7e-114   Pyrus x bretschneideri [bai li]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    346   7e-114   Populus euphratica
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    346   8e-114   
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    346   1e-113   Camelina sativa [gold-of-pleasure]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              346   1e-113   Pyrus x bretschneideri [bai li]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         346   1e-113   Jatropha curcas
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   1e-113   Nelumbo nucifera [Indian lotus]
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   1e-113   Nicotiana tomentosiformis
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   1e-113   Nicotiana sylvestris
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   2e-113   Sesamum indicum [beniseed]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   3e-113   Prunus mume [ume]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    345   3e-113   Glycine max [soybeans]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               345   3e-113   Glycine max [soybeans]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    344   4e-113   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    344   4e-113   Pyrus x bretschneideri [bai li]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    344   5e-113   Citrus sinensis [apfelsine]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    344   6e-113   Elaeis guineensis
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      342   7e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   7e-113   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   7e-113   Nicotiana tomentosiformis
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             343   8e-113   Capsella rubella
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    344   8e-113   Ricinus communis
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            343   9e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             343   1e-112   Citrus clementina [clementine]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   1e-112   Fragaria vesca subsp. vesca
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              343   2e-112   Scoparia dulcis [escobilla]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             342   2e-112   Phaseolus vulgaris [French bean]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     342   3e-112   Vitis vinifera
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              337   3e-112   Medicago truncatula
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    340   3e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    342   3e-112   Vitis vinifera
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    342   3e-112   Camelina sativa [gold-of-pleasure]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             342   3e-112   Prunus persica
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    341   6e-112   Arabis alpina [alpine rockcress]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    341   9e-112   Brassica rapa
emb|CDY69523.1|  BnaC08g46180D                                          339   1e-111   Brassica napus [oilseed rape]
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    340   2e-111   Phoenix dactylifera
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           340   2e-111   Medicago truncatula
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               339   4e-111   Solanum tuberosum [potatoes]
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              336   4e-111   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             338   6e-111   Eutrema salsugineum [saltwater cress]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    338   6e-111   Solanum tuberosum [potatoes]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    338   8e-111   Pisum sativum [garden pea]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    338   1e-110   Solanum lycopersicum
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    337   2e-110   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    340   2e-110   Cicer arietinum [garbanzo]
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    337   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84309.1|  unknown                                                 337   3e-110   Medicago truncatula
gb|EPS70760.1|  hypothetical protein M569_03997                         336   4e-110   Genlisea aurea
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    331   7e-110   Oryza sativa Japonica Group [Japonica rice]
emb|CAA33262.1|  unnamed protein product                                334   2e-109   Pisum sativum [garden pea]
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    335   3e-109   Cucumis sativus [cucumbers]
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    334   4e-109   
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             333   4e-109   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    334   4e-109   Cucumis melo [Oriental melon]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    334   4e-109   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             333   6e-109   Selaginella moellendorffii
ref|NP_001048847.1|  Os03g0129300                                       333   7e-109   
dbj|BAJ86633.1|  predicted protein                                      333   8e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87214.1|  predicted protein                                      332   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    332   2e-108   Triticum urartu
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    331   6e-108   Eucalyptus grandis [rose gum]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          328   3e-107   
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    329   4e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    328   8e-107   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         344   1e-105   
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    316   4e-103   Spinacia oleracea
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    318   8e-103   Spinacia oleracea
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           319   1e-102   
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               313   2e-100   Chara vulgaris
gb|ACN40006.1|  unknown                                                 311   3e-100   Picea sitchensis
gb|ABK24645.1|  unknown                                                 311   4e-100   Picea sitchensis
gb|ACN40526.1|  unknown                                                 311   5e-100   Picea sitchensis
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    309   2e-99    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   2e-99    
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      307   2e-98    Chlorokybus atmophyticus
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               300   6e-96    Marchantia polymorpha
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      298   2e-95    Mesostigma viride
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    296   2e-95    Spinacia oleracea
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    296   2e-94    Nicotiana tabacum [American tobacco]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    292   1e-93    Mesostigma viride
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    287   6e-91    Setaria italica
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       278   7e-91    Cucumis sativus [cucumbers]
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           282   1e-89    Bathycoccus prasinos
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    273   6e-89    Ricinus communis
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             280   1e-88    Micromonas pusilla CCMP1545
ref|XP_001415434.1|  predicted protein                                  279   3e-88    Ostreococcus lucimarinus CCE9901
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         279   3e-88    Micromonas commoda
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    266   3e-86    Agave tequilana
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    273   4e-86    Ostreococcus tauri
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    271   5e-85    
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    271   6e-85    Ostreococcus tauri
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    267   1e-84    Chlorokybus atmophyticus
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    268   3e-84    Marchantia polymorpha
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    263   4e-84    Sinapis alba [bai jie]
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    265   5e-84    
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               268   6e-84    Marchantia polymorpha
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      266   9e-84    Chlorokybus atmophyticus
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     265   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    264   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    264   2e-83    Camelina sativa [gold-of-pleasure]
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                262   2e-83    Mesostigma viride
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    263   4e-83 
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    263   4e-83    Mesostigma viride
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   5e-83    Brassica rapa
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   7e-83    Camelina sativa [gold-of-pleasure]
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              265   7e-83    Medicago truncatula
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                261   8e-83    Mesostigma viride
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    263   8e-83    Spinacia oleracea
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   9e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             265   1e-82    Selaginella moellendorffii
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      261   2e-82    Mesostigma viride
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             264   3e-82    Selaginella moellendorffii
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    261   3e-82    Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    261   4e-82    Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    261   4e-82    Spinacia oleracea
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             263   5e-82    Nicotiana benthamiana
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     261   5e-82    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02737.1|  predicted protein                                      259   5e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   5e-82    
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   6e-82    Nicotiana sylvestris
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             261   6e-82    
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   6e-82    Camelina sativa [gold-of-pleasure]
gb|EPS59235.1|  hypothetical protein M569_15573                         262   7e-82    Genlisea aurea
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   7e-82    Nicotiana tomentosiformis
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   7e-82    Camelina sativa [gold-of-pleasure]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             262   7e-82    Eutrema salsugineum [saltwater cress]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             262   7e-82    
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        262   8e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892719.1|  GAPA-2                                             262   8e-82    Arabidopsis lyrata subsp. lyrata
gb|KJB11770.1|  hypothetical protein B456_001G276400                    259   8e-82    Gossypium raimondii
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              260   8e-82    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   9e-82    Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                          262   9e-82    Brassica napus [oilseed rape]
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   262   1e-81    Citrus sinensis [apfelsine]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    262   1e-81    Spinacia oleracea
emb|CDX83635.1|  BnaC07g23750D                                          261   2e-81    
emb|CDY16038.1|  BnaC08g40850D                                          261   2e-81    Brassica napus [oilseed rape]
emb|CDY26599.1|  BnaA09g46780D                                          261   2e-81    Brassica napus [oilseed rape]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    261   2e-81    Arabis alpina [alpine rockcress]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    261   2e-81    Arabis alpina [alpine rockcress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             261   3e-81    Eutrema salsugineum [saltwater cress]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    261   3e-81    
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    261   3e-81    Eucalyptus grandis [rose gum]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    261   3e-81    Glycine soja [wild soybean]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    261   3e-81    Brachypodium distachyon [annual false brome]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    261   3e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    261   4e-81    Glycine soja [wild soybean]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    261   4e-81    Brassica rapa
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   4e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   4e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   6e-81    Brassica rapa
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   6e-81    Solanum tuberosum [potatoes]
emb|CDY13649.1|  BnaA06g32740D                                          259   6e-81    Brassica napus [oilseed rape]
emb|CDY28536.1|  BnaC02g36240D                                          259   8e-81    Brassica napus [oilseed rape]
gb|ACU21011.1|  unknown                                                 260   8e-81    Glycine max [soybeans]
dbj|BAH57068.1|  AT1G12900                                              258   9e-81    Arabidopsis thaliana [mouse-ear cress]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    258   9e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             259   1e-80    Phaseolus vulgaris [French bean]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   1e-80    
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    259   1e-80    Ricinus communis
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      258   1e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                258   1e-80    Syntrichia caninervis
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   1e-80    
dbj|BAJ90530.1|  predicted protein                                      259   2e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                259   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   2e-80    Nelumbo nucifera [Indian lotus]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              258   2e-80    Volvox carteri f. nagariensis
dbj|BAJ90885.1|  predicted protein                                      259   2e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002875330.1|  gapa                                               259   2e-80    Arabidopsis lyrata subsp. lyrata
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               256   2e-80    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   2e-80    Solanum lycopersicum
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    259   2e-80    
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         259   2e-80    Jatropha curcas
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    258   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      256   3e-80    Spirogyra sp. SAG 170.80
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          257   3e-80    Chlamydomonas sp. W80
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               258   3e-80    Brassica rapa subsp. chinensis [bok-choy]
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    250   4e-80    Cucurbita pepo
ref|XP_001771209.1|  predicted protein                                  258   4e-80    
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   4e-80    
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   5e-80    Oryza brachyantha
ref|XP_001771246.1|  predicted protein                                  258   5e-80    
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           256   6e-80    Chlamydomonas reinhardtii
gb|KJB70724.1|  hypothetical protein B456_011G088800                    254   7e-80    Gossypium raimondii
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             257   7e-80    Capsella rubella
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               254   8e-80    Capsicum annuum
gb|KJB11771.1|  hypothetical protein B456_001G276400                    257   9e-80    Gossypium raimondii
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    256   9e-80    Micromonas commoda
dbj|BAJ34149.1|  unnamed protein product                                257   1e-79    Eutrema halophilum
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    256   1e-79    Chlamydomonas incerta
ref|XP_001779769.1|  predicted protein                                  256   1e-79    
emb|CDY48981.1|  BnaA02g28150D                                          255   2e-79    Brassica napus [oilseed rape]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   2e-79    Fragaria vesca subsp. vesca
ref|XP_001779753.1|  predicted protein                                  256   3e-79    
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     255   3e-79    Physcomitrella patens
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    253   3e-79    Miscanthus sinensis
ref|XP_001753934.1|  predicted protein                                  256   3e-79    
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   4e-79    Setaria italica
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                256   4e-79    Arachis hypogaea [goober]
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    255   4e-79    Marchantia polymorpha
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    257   4e-79    
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             255   4e-79    Micromonas pusilla CCMP1545
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     253   4e-79    Physcomitrella patens
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      251   5e-79    Spermatozopsis similis
ref|XP_001766703.1|  predicted protein                                  254   6e-79    
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         254   1e-78    
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   1e-78    Pyrus x bretschneideri [bai li]
emb|CAA30152.1|  GADPH (383 AA)                                         254   1e-78    Zea mays [maize]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    254   1e-78    Zea mays [maize]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    254   1e-78    Theobroma cacao [chocolate]
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...    245   2e-78    Olea europaea
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             254   2e-78    Prunus persica
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   2e-78    Malus domestica [apple tree]
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    254   2e-78    Botryococcus braunii
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   2e-78    Pyrus x bretschneideri [bai li]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   2e-78    Prunus mume [ume]
ref|NP_001052984.1|  Os04g0459500                                       253   2e-78    
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   2e-78    Malus domestica [apple tree]
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    253   5e-78    Auxenochlorella protothecoides
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      252   5e-78    Cladophora rupestris
gb|KJB70723.1|  hypothetical protein B456_011G088800                    253   6e-78    Gossypium raimondii
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      249   6e-78    Chlorella sp. JP-2005
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         252   9e-78    Morus notabilis
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                251   2e-77    Bruguiera gymnorhiza [Burma mangrove]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       251   2e-77    Medicago sativa [alfalfa]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         251   2e-77    Medicago truncatula
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   3e-77    Cicer arietinum [garbanzo]
emb|CAA33264.1|  unnamed protein product                                251   3e-77    Pisum sativum [garden pea]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    250   4e-77    Pisum sativum [garden pea]
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    249   4e-77    Ostreococcus tauri
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    250   4e-77    Pyrus x bretschneideri [bai li]
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           249   4e-77    Bathycoccus prasinos
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    249   4e-77    
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                249   6e-77    Vicia sativa [spring vetch]
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      248   2e-76    Scherffelia dubia
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              248   2e-76    Phaseolus vulgaris [French bean]
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   2e-76    Tarenaya hassleriana [spider flower]
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                241   3e-76    Helianthus annuus
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                241   4e-76    Helianthus annuus
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               244   7e-76    Coleochaete scutata
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                241   7e-76    Helianthus annuus
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                241   1e-75    Helianthus annuus
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          245   4e-75    Amborella trichopoda
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    244   6e-75    Ostreococcus sp. 'lucimarinus'
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                239   6e-75    Helianthus annuus
ref|XP_001420043.1|  predicted protein                                  243   6e-75    Ostreococcus lucimarinus CCE9901
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   241   7e-75    Citrus sinensis [apfelsine]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               241   1e-74    Sphagnum cuspidatum
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    242   1e-74    Chamaesiphon minutus
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              243   2e-74    Scoparia dulcis [escobilla]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   2e-74    Tarenaya hassleriana [spider flower]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   2e-74    Sesamum indicum [beniseed]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                241   3e-74    Lilium regale
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                244   7e-74    Erythranthe guttata [common monkey flower]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    242   9e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      242   9e-74    Cyanophora paradoxa
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           241   1e-73    Coccomyxa subellipsoidea C-169
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                240   1e-73    
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                241   2e-73    
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   2e-73    
gb|ACN39951.1|  unknown                                                 238   2e-73    
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   3e-73    
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             240   3e-73    
gb|ACN40537.1|  unknown                                                 240   3e-73    
gb|ABK96233.1|  unknown                                                 240   3e-73    
gb|ABK25233.1|  unknown                                                 240   3e-73    
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  240   3e-73    
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   4e-73    
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    239   4e-73    
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             240   4e-73    
gb|ABK96725.1|  unknown                                                 240   5e-73    
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   5e-73    
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        236   5e-73    
gb|ABK94956.1|  unknown                                                 239   6e-73    
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               236   1e-72    
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    234   2e-72    
gb|ACN40000.1|  unknown                                                 239   2e-72    
gb|ABK24313.1|  unknown                                                 239   2e-72    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           236   2e-72    
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             238   2e-72    
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   2e-72    
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    239   3e-72    
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             238   4e-72    
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      235   4e-72    
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   4e-72    
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   5e-72    
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   6e-72    
emb|CAN78872.1|  hypothetical protein VITISV_021726                     237   6e-72    
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   6e-72    
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   7e-72    
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   9e-72    
gb|AGJ50596.1|  GAPDH                                                   236   1e-71    
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   1e-71    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           234   1e-71    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           234   1e-71    
gb|KIY93372.1|  NADP-dependent glyceraldehydephosphatedehydrogena...    229   1e-71    
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    235   1e-71    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         234   2e-71    
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                233   2e-71    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           232   1e-70    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           231   3e-70    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    231   3e-70    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         230   3e-70    
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    230   4e-70    
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              228   6e-70    
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase                224   6e-70    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    229   8e-70    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                229   9e-70    
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               228   1e-69    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    229   1e-69    
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   2e-69    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    229   2e-69    
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           229   2e-69    
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   231   2e-69    
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           228   2e-69    
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           228   2e-69    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           228   2e-69    
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    225   2e-69    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           228   3e-69    
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    229   3e-69    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    228   3e-69    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           228   3e-69    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           228   4e-69    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    228   4e-69    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           228   4e-69    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         228   4e-69    
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   5e-69    
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase                222   5e-69    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           227   5e-69    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    227   5e-69    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             228   5e-69    
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    227   5e-69    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    227   6e-69    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           227   6e-69    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             228   6e-69    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             228   6e-69    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           227   7e-69    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    229   8e-69    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           227   8e-69    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           227   9e-69    
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    228   1e-68    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    226   1e-68    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           226   1e-68    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           226   1e-68    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        227   2e-68    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    226   2e-68    
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             226   2e-68    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           226   2e-68    
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   2e-68    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    225   3e-68    
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    226   3e-68    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           225   3e-68    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           225   4e-68    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    225   4e-68    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    225   4e-68    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           225   4e-68    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           225   4e-68    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           225   4e-68    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           225   5e-68    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           225   5e-68    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    224   5e-68    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           225   6e-68    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        224   6e-68    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           224   7e-68    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           224   7e-68    
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                224   8e-68    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           224   9e-68    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    226   1e-67    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    224   1e-67    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           226   1e-67    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           224   1e-67    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                224   1e-67    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    224   1e-67    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    224   1e-67    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    224   2e-67    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    223   2e-67    
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    223   2e-67    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               222   2e-67    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    223   2e-67    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    223   2e-67    
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    223   3e-67    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    223   3e-67    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           223   4e-67    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           222   4e-67    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        222   5e-67    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    224   5e-67    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           222   6e-67    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    222   6e-67    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           222   6e-67    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           222   6e-67    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           223   7e-67    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    221   9e-67    
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           221   9e-67    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    221   1e-66    
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        221   1e-66    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           221   1e-66    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    221   1e-66    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               221   1e-66    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    221   1e-66    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           221   1e-66    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    221   1e-66    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           221   2e-66    
ref|WP_007133015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    221   2e-66    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           221   2e-66    
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        221   3e-66    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               218   3e-66    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           220   3e-66    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           220   4e-66    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    220   4e-66    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    220   4e-66    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           219   5e-66    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           219   5e-66    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           219   6e-66    
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               216   8e-66    
gb|ADB81480.1|  glyceraldehyde-3-phosphate dehydrogenase                213   8e-66    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           219   8e-66    
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   221   2e-65    
dbj|GAK42869.1|  glyceraldehyde-3-phosphate dehydrogenase               218   2e-65    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           218   3e-65    
emb|CDP18560.1|  unnamed protein product                                219   3e-65    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    218   3e-65    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           217   4e-65    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           217   5e-65    
ref|WP_009593640.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    217   5e-65    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           217   7e-65    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                217   7e-65    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    217   7e-65    
gb|ADB81495.1|  glyceraldehyde-3-phosphate dehydrogenase                211   8e-65    
ref|WP_016423763.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    216   8e-65    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    216   8e-65    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    216   1e-64    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                216   1e-64    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           216   1e-64    
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           216   2e-64    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    216   2e-64    
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           214   4e-64    
ref|WP_036655810.1|  glyceraldehyde-3-phosphate dehydrogenase           214   5e-64    
ref|WP_006207583.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    214   6e-64    
ref|WP_012818436.1|  glyceraldehyde-3-phosphate dehydrogenase           214   7e-64    
ref|WP_010272964.1|  glyceraldehyde-3-phosphate dehydrogenase           214   8e-64    
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                214   8e-64    
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                213   1e-63    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           213   1e-63    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    213   2e-63    
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     207   2e-63    
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    207   2e-63    
ref|WP_042118357.1|  glyceraldehyde-3-phosphate dehydrogenase           213   2e-63    
gb|AHD04124.1|  glyceraldehyde-3-phosphate dehydrogenase Gap            213   3e-63    
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    213   3e-63    
gb|ADB81481.1|  glyceraldehyde-3-phosphate dehydrogenase                207   3e-63    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    212   4e-63    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           212   4e-63    
ref|WP_019422012.1|  glyceraldehyde-3-phosphate dehydrogenase           212   5e-63    
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    212   5e-63    
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           212   6e-63    
ref|WP_028609183.1|  glyceraldehyde-3-phosphate dehydrogenase           211   6e-63    
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    212   8e-63    
dbj|BAK05515.1|  predicted protein                                      205   1e-62    
ref|WP_038262010.1|  glyceraldehyde-3-phosphate dehydrogenase [         211   1e-62    
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    211   1e-62    
ref|WP_019533316.1|  glyceraldehyde-3-phosphate dehydrogenase           211   2e-62    
ref|WP_013914025.1|  glyceraldehyde-3-phosphate dehydrogenase           210   2e-62    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           210   2e-62    
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    210   3e-62    



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 208/220 (95%), Positives = 216/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 206/220 (94%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 205/220 (93%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  202  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  261

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA
Sbjct  262  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKA  321

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  322  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVV  381

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  382  DLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  421



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 205/220 (93%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 207/220 (94%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  255  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  314

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  315  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  374

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  375  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVV  434

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DL HLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  435  DLGHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  474



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   352 bits (903),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 207/220 (94%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPGV  AGS DPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGVPAAGSADPLEDFCKTNPADEECKVYEA  452



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 205/220 (93%), Positives = 216/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  235  IISNASCTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  294

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRK+
Sbjct  295  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKS  354

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVL+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  355  AEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  414

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+ VAGSGDPLEDYCKTNP D+ECKV+EA
Sbjct  415  DLAHLVASKWPGMPVAGSGDPLEDYCKTNPADEECKVYEA  454



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 205/220 (93%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  235  IISNASCTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  294

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  295  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  354

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVL+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  355  AEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  414

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+ VAGSGDPLEDYCK NP D+ECKV+EA
Sbjct  415  DLAHLVASKWPGMPVAGSGDPLEDYCKANPADEECKVYEA  454



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 206/220 (94%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPL G+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  ASGPLNGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG A   SGDPLED+C+TNP DKECKVFEA
Sbjct  414  DLAHLVASKWPGAAAGSSGDPLEDFCETNPADKECKVFEA  453



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   347 bits (891),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 204/220 (93%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  180  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  239

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  240  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  299

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  300  AKGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  359

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+   GS DPLED+CKTNP D+ECKV+EA
Sbjct  360  DLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEECKVYEA  399



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 204/220 (93%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  239  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  298

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+K+GLTAEDVNAAFRKA
Sbjct  299  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFRKA  358

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCDAPLVSVDF+C+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  359  ADGPLKGILDVCDAPLVSVDFKCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  418

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+ + GSGDPLEDYCKTN  D+ECKV+EA
Sbjct  419  DLAHLVASKWPGLFIDGSGDPLEDYCKTNAADEECKVYEA  458



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 204/220 (93%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  236  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  295

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  296  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  355

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  356  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  415

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+   GS DPLED+CKTNP D+ECKV+EA
Sbjct  416  DLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  235  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  294

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  295  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  354

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  355  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  414

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  415  DLAHLVASKWPGAAKAGSGDPLEEFCETNPADEECKVYE  453



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  413  DLAHLVASKWPGAAKAGSGDPLEEFCETNPADEECKVYE  451



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  352  ADGPLKGILDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPGVA  GSGDPL+++C+TNP D+ECKV+E
Sbjct  412  DLAHLVASKWPGVAAPGSGDPLDEFCETNPSDEECKVYE  450



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  414  DLAHLVASKWPGTAKAGSGDPLEEFCETNPADEECKVYE  452



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  414  DLAHLVASKWPGAAKAGSGDPLEEFCETNPADEECKVYE  452



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 202/220 (92%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG AVAGSGDPLED+C+TNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGAAVAGSGDPLEDFCQTNPADEECKVYEA  452



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 204/220 (93%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  236  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  295

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  296  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  355

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  356  AKGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  415

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+   GS DPLED+CKTNP D+ECKV+EA
Sbjct  416  DLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   346 bits (888),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 203/220 (92%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGTAQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   346 bits (888),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 206/220 (94%), Positives = 214/220 (97%), Gaps = 2/220 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGY  RVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGY--RVV  410

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  DLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   346 bits (888),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  352  ADGPLKGILDVCDAPLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPGVA  GSGDPL+++C+TNP D+ECKV+E
Sbjct  412  DLAHLVASKWPGVAAPGSGDPLDEFCETNPSDEECKVYE  450



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    G+GDPLED+C+TNPGD+ECKVFE
Sbjct  409  DLAHLVASKWPGEKAVGTGDPLEDFCQTNPGDEECKVFE  447



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG AV GSGDPLED+C+TNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGAAVVGSGDPLEDFCQTNPADEECKVYEA  452



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA++WPGVA  GSGDPLE++C+ NP D+ECKV+EA
Sbjct  413  DLAHLVANEWPGVAATGSGDPLEEFCEKNPADEECKVYEA  452



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG A +GSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGAAASGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  231  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  290

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFRKA
Sbjct  291  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKA  350

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPL G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  351  ADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  410

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG +V GSGD LEDYCKTNP DKECKV+E
Sbjct  411  DLAHLVASKWPGSSVEGSGDSLEDYCKTNPADKECKVYE  449



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  231  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  290

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++AEDVNAAFRKA
Sbjct  291  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKA  350

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPL G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  351  ADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  410

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG +V GSGD LEDYCKTNP DKECKV+E
Sbjct  411  DLAHLVASKWPGSSVEGSGDALEDYCKTNPADKECKVYE  449



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 202/220 (92%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPL GVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLAGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA KWPG    GSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVADKWPGATAEGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPL+G+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLQGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG + AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGTSQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IISNASCTTNCLAPFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG   AGSGDPLED+C+TNP D+ECKV+E
Sbjct  414  DLAHLVASKWPGAPKAGSGDPLEDFCETNPADEECKVYE  452



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG   AGSGDPLED+C+TNP D+ECKV+E
Sbjct  413  DLAHLVASKWPGAPKAGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    GSGDPLED+CKTNP D+ECKV+E
Sbjct  409  DLAHLVASKWPGEEAVGSGDPLEDFCKTNPADEECKVYE  447



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGAAEVGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   344 bits (883),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  AEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPGVA  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  414  DLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA  453



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+LDVCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ANGPLKGILDVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+ V GSGDPLED+CKT+P  +ECKV+EA
Sbjct  413  DLAHLVASKWPGMPVQGSGDPLEDFCKTSPATEECKVYEA  452



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   342 bits (877),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  184  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  243

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  244  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  303

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  304  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  363

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    GSGDPLED+CKTNP D+ECKV++
Sbjct  364  DLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD  402



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  231  IISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  290

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA
Sbjct  291  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKA  350

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  351  ADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  410

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPGVAV GSGDPL+++CKTNP D+ECKV+E
Sbjct  411  DLAHLVANKWPGVAVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  231  IISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  290

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA
Sbjct  291  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKA  350

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  351  ADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  410

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPGVAV GSGDPL+++CKTNP D+ECKV+E
Sbjct  411  DLAHLVANKWPGVAVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   343 bits (881),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAE+VN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEEVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    GSGDPLED+C+TNPG++ECKVFE
Sbjct  409  DLAHLVASKWPGEKAVGSGDPLEDFCQTNPGEEECKVFE  447



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   344 bits (882),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 205/226 (91%), Positives = 214/226 (95%), Gaps = 6/226 (3%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGD------Qrlldashrdlrrar  590
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGD      QRLLDASHRDLRRAR
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDXSYTGDQRLLDASHRDLRRAR  292

Query  589  aaaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVN  410
            AAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN
Sbjct  293  AAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVN  352

Query  409  AAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  230
            AAFRKA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG
Sbjct  353  AAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  412

Query  229  YSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            YSQRVVDLAHLVA+KWPG + AGSGD LED+C+TNP DKECKVFE+
Sbjct  413  YSQRVVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKECKVFES  458



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   343 bits (880),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    GSGDPLED+CKTNP D+ECKV++
Sbjct  409  DLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD  447



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEE GIVKG +TTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IVSNASCTTNCLAPFVKVMDEELGIVKGAITTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  AEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPGVA  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  414  DLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA  453



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 210/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG+TAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG  V GSGDPLED+CK NP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGTPVEGSGDPLEDFCKDNPADEECKVYEA  452



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 203/220 (92%), Positives = 209/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  228  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  287

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFRKA
Sbjct  288  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKA  347

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  348  AQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  407

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPGV   GSGDPLED+C+TNP  KECKV+EA
Sbjct  408  DLAHLVASKWPGVPAQGSGDPLEDFCQTNPETKECKVYEA  447



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 203/220 (92%), Positives = 209/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  230  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  289

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFRKA
Sbjct  290  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKA  349

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  350  AQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  409

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPGV   GSGDPLED+C+TNP  KECKV+EA
Sbjct  410  DLAHLVASKWPGVPAQGSGDPLEDFCQTNPETKECKVYEA  449



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN+AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNSAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPL GVLDVCD PLVSVDFRCSDVSSTIDSSLTMV+GDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ANGPLAGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVLGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA KWPG  V+GSGDPLED+CKTNP D+ECKV+E
Sbjct  413  DLAHLVAYKWPGATVSGSGDPLEDFCKTNPADEECKVYE  451



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNGAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG   AGSGDPLE++C+TNP D+ECKV+E
Sbjct  413  DLAHLVASKWPGTPKAGSGDPLEEFCETNPADEECKVYE  451



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IVSNASCTTNCLAPFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  ADGPLKGILAVCDVPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  414  DLAHLVAAKWPGFAAEGSGDPLEDFCKTNPADEECKVYEA  453



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  99   IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  158

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  159  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  218

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  219  AEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  278

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  279  DLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  317



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   340 bits (873),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  184  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  243

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  244  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  303

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  304  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  363

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    GSGDPLED+C+TNP ++ECKV+E
Sbjct  364  DLAHLVASKWPGEKAVGSGDPLEDFCQTNPANEECKVYE  402



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IVSNASCTTNCLAPFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  ADGPLKGILAVCDVPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  414  DLAHLVAAKWPGFAAEGSGDPLEDFCKTNPADEECKVYEA  453



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  227  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  286

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  287  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  346

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  347  ANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  406

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG    GSGDPLED+C+TNP ++ECKV+E
Sbjct  407  DLAHLVASKWPGEKAVGSGDPLEDFCQTNPANEECKVYE  445



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPL+G+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLQGILAVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG   AGSGDPLE++CKTNP D+ECKV+EA
Sbjct  413  DLAHLVASKWPGTPQAGSGDPLEEFCKTNPADEECKVYEA  452



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 198/220 (90%), Positives = 210/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GP+KG+LDVCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  AAGPMKGILDVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  409  DLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYEA  448



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   341 bits (874),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 210/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  AAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  409  DLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYEA  448



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 210/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  183  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  242

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  243  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  302

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  303  AAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  362

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  363  DLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYEA  402



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG+ V GSGDPLED+C+T+P  +ECKV+EA
Sbjct  413  DLAHLVASKWPGMPVQGSGDPLEDFCQTSPDTEECKVYEA  452



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  413  DLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  451



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGL+AEDVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVV
Sbjct  352  ADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG A  GSGD LEDYCKTNP DKECKV+E
Sbjct  412  DLAHLVANKWPGSAAEGSGDALEDYCKTNPADKECKVYE  450



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   336 bits (862),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  149  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  208

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA
Sbjct  209  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKA  268

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  269  AAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  328

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+E
Sbjct  329  DLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYE  367



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKGLTAEDVN AFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGLTAEDVNEAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  ADGPLKGVLAVCDIPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+E
Sbjct  409  DLAHLVANKWPGEVAAGSGDPLEDFCKTNPADEECKVYE  447



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVV
Sbjct  352  ADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG A  GSGD LEDYCKTNP DKECKV+E
Sbjct  412  DLAHLVASKWPGSAAEGSGDALEDYCKTNPADKECKVYE  450



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   338 bits (868),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  AEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    GSGDPLED+C+TNP D+ECKV+E
Sbjct  413  DLAHLVANKWPGTPKVGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVV
Sbjct  352  ADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA KWPG A  GSGD LEDYCKTNP DKECKV+E
Sbjct  412  DLAHLVADKWPGSAAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 211/220 (96%), Gaps = 2/220 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  RVV
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY--RVV  410

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKWPG A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  DLAHLVASKWPGTAQAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  307  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  366

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  367  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  426

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  427  AEGPLKGVLDVCDLPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  486

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    GSGDPLED+C+TNP D ECKV+E
Sbjct  487  DLAHLVANKWPGTPQKGSGDPLEDFCETNPADDECKVYE  525



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGMTAEDVNDAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP  GVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  353  ANGPSNGVLAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG+   GSGDPLED+C+TNP  KECKV+E
Sbjct  413  DLAHLVASKWPGIPAQGSGDPLEDFCQTNPETKECKVYE  451



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEW YSQRVV
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  413  DLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  451



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 212/220 (96%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGI KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  221  IISNASCTTNCLAPFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  280

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+ AED+N+AFRKA
Sbjct  281  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKA  340

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVLDVCDAPLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  341  AEGPLKGVLDVCDAPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  400

Query  211  DLAHLVASKWPGVAVA-GSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   A GSGDPLEDYCKT+P D+ECKV+E
Sbjct  401  DLAHLVANKWPGATPAEGSGDPLEDYCKTSPADEECKVYE  440



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   331 bits (849),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  99   IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  158

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  159  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  218

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  219  AAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  278

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG AV GSGDPLED+CK NP   ECKV+E
Sbjct  279  DLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDECKVYE  317



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  229  IISNASCTTNCLAPFAKVLDEESGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  288

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  289  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  348

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  349  AEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  408

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    GSGDPLED+C+TNP D+ECKV+E
Sbjct  409  DLAHLVANKWPGTPKVGSGDPLEDFCETNPADEECKVYE  447



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 195/220 (89%), Positives = 210/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IVSNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  352  ADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  412  DLAHLVADKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  225  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  ASGPLNGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPGVA  GSGDPLED+CK NP   ECKV+E
Sbjct  405  DLAHLVASKWPGVAAQGSGDPLEDFCKDNPETDECKVYE  443



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 209/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA
Sbjct  272  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKA  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  332  ADGPLKGILAVCDIPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA KWPG A A SGDPL+++CKTNP   ECKV++A
Sbjct  392  DLAHLVAEKWPGGAPAPSGDPLDEFCKTNPDTDECKVYDA  431



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IISNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  352  ADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  412  DLAHLVATKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  353  ADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVV  412

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  413  DLAHLVATKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 198/220 (90%), Positives = 209/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA
Sbjct  272  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKA  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  332  ADGPLKGILAVCDIPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA KWPG A A SGDPL+++CKTNP   EC+V++A
Sbjct  392  DLAHLVADKWPGGAAAPSGDPLDEFCKTNPDTDECRVYDA  431



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  225  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  AAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG AV GSGDPLED+CK NP   ECKV+E
Sbjct  405  DLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDECKVYE  443



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   333 bits (854),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  225  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAELNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  ADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    GSGDPLEDYCKT+P   ECKVF+
Sbjct  405  DLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  225  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  ADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    GSGDPLEDYCKT+P   ECKVF+
Sbjct  405  DLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  225  IVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  ADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    GSGDPLEDYCKT+P   ECKVF+
Sbjct  405  DLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   331 bits (849),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 197/220 (90%), Positives = 210/220 (95%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR A
Sbjct  294  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSL+MVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  354  AEGPLKGILAVCDDPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVV  413

Query  211  DLAHLVASKWPGVAVAGS-GDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA KWPG+ + GS GDPLED+CK NP D+ECKV+E
Sbjct  414  DLAHLVAVKWPGIEIPGSTGDPLEDFCKKNPADEECKVYE  453



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 198/220 (90%), Positives = 210/220 (95%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  195  IVSNASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  254

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRK+
Sbjct  255  VPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKS  314

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  315  AEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  374

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVASKW G A +G GDPLE++C+T+P   ECKV+EA
Sbjct  375  DLAHLVASKWSGAAKSG-GDPLEEFCQTSPETVECKVYEA  413



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 196/220 (89%), Positives = 209/220 (95%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK+MDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IISNASCTTNCLAPFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVN AFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GP KGVL+VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  352  AAGPSKGVLEVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGVAVA-GSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG+  A  SGDPLED+CK NP D+ECKV+E
Sbjct  412  DLAHLVANKWPGMEGAISSGDPLEDFCKDNPADEECKVYE  451



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   328 bits (841),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS AS TTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  228  IVSNASWTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  287

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  288  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFRKA  347

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  348  AAGPLNGILDVCDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  407

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVASKWPG  V G+GDPLEDYCKTNP   ECKV++
Sbjct  408  DLAHLVASKWPGSEVKGTGDPLEDYCKTNPETDECKVYD  446



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   344 bits (883),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 202/226 (89%), Positives = 212/226 (94%), Gaps = 0/226 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  236  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  295

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK 
Sbjct  296  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKE  355

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  356  AEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  415

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA*FTTNF  74
            DLAHLVASKWPG    GSGDPLED+CKTNP D+ECK+  A F   F
Sbjct  416  DLAHLVASKWPGSGTGGSGDPLEDFCKTNPADEECKIVIASFIGCF  461



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 204/220 (93%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  149  IISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  208

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA
Sbjct  209  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKA  268

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVLDVCD PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVV
Sbjct  269  AAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVV  328

Query  211  DLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLA LVA+KWPG+     SGDPLED+CK NP D+ECK++E
Sbjct  329  DLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE  368



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 204/220 (93%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  232  IISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  291

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA
Sbjct  292  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKA  351

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVLDVCD PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVV
Sbjct  352  AAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVV  411

Query  211  DLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLA LVA+KWPG+     SGDPLED+CK NP D+ECK++E
Sbjct  412  DLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE  451



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 197/258 (76%), Positives = 210/258 (81%), Gaps = 39/258 (15%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG------  230
            ++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWG      
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGAHFVWA  412

Query  229  ---------------------------------YSQRVVDLAHLVASKWPGVAVAGSGDP  149
                                             ++QRVVDLAHLVA+KWPG   AGSGDP
Sbjct  413  FSLMFLFSGRGYWQELIESIVWAHNKLKYKVCFHNQRVVDLAHLVANKWPGTPQAGSGDP  472

Query  148  LEDYCKTNPGDKECKVFE  95
            LED+C+TNP   ECKVFE
Sbjct  473  LEDFCETNPSTDECKVFE  490



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 204/222 (92%), Gaps = 3/222 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  259  IISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  318

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+ KG TAEDVN AFRKA
Sbjct  319  VPTTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVNVENKGCTAEDVNDAFRKA  378

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  379  ANGPLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  438

Query  211  DLAHLVASKWPGVAVAGSG---DPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG   A  G   DPL  YC++NP D EC+VFE
Sbjct  439  DLAHLVAAKWPGAKPAPDGKDADPLGTYCESNPDDAECRVFE  480



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 208/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  241  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  300

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A
Sbjct  301  VPTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSA  360

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  361  ADGPLKGILAVCDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  420

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG    GS DPL+++CKTNP   EC+V+EA
Sbjct  421  DLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 208/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  241  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  300

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A
Sbjct  301  VPTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSA  360

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  361  ADGPLKGILAVCDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  420

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG    GS DPL+++CKTNP   EC+V+EA
Sbjct  421  DLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 208/220 (95%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  241  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  300

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A
Sbjct  301  VPTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSA  360

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  361  ADGPLKGILAVCDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  420

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG    GS DPL+++CKTNP   EC+V+EA
Sbjct  421  DLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  225  IISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  ADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA+KWPG    G G   EDYCKT+P   ECKVF+
Sbjct  405  DLAHLVAAKWPGAGTGGGG--GEDYCKTDPNAVECKVFD  441



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 191/220 (87%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  230  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  289

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA
Sbjct  290  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKA  349

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPL+G+L+VCD PLVSVDFRCSDVS TID+SL+MVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  350  AAGPLQGILEVCDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVVAWYDNEWGYSQRVV  409

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLVA+KWPG A AGSGDPLED+CK NP   ECKV+EA
Sbjct  410  DLAHLVAAKWPGAAAAGSGDPLEDFCKDNPETDECKVYEA  449



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/222 (82%), Positives = 201/222 (91%), Gaps = 3/222 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  236  IISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  295

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+ VNAAFRKA
Sbjct  296  VPTTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFRKA  355

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPL GVL V D PLVS+DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVV
Sbjct  356  AEGPLNGVLAVSDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVV  415

Query  211  DLAHLVASKWPGVAVAG---SGDPLEDYCKTNPGDKECKVFE  95
            DLAH+VA+ WPG        SGDPL+ YC TNP   EC+V++
Sbjct  416  DLAHIVANNWPGQKADSEEESGDPLDKYCATNPEADECRVYD  457



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 1/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  239  IISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  298

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR+A
Sbjct  299  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREA  358

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVS+DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  359  ANGPLKGILAVCDIPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  418

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLAHLVA++WPGVA   SGDPLE++C TNP   EC++ +
Sbjct  419  DLAHLVAAQWPGVAKP-SGDPLEEFCVTNPDTDECRLHD  456



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 194/219 (89%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  196  IISNASCTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  255

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK 
Sbjct  256  VPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKE  315

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++G +KG+L V D PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  316  ANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  375

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLA +VA+ WPG+      DPLE +C TNP   EC+V+ 
Sbjct  376  DLADIVANNWPGMVQETGSDPLETFCNTNPDADECRVYN  414



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 199/220 (90%), Gaps = 2/220 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  147  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  207  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  265

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  266  ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  325

Query  211  DLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKECKVFE  95
            DLA +VA+KW G+     SGDPLED+CK NP D+ECK++E
Sbjct  326  DLADIVANKWQGLEGSVASGDPLEDFCKDNPADEECKLYE  365



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  202  IISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  261

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA
Sbjct  262  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKA  321

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  322  ADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  381

Query  211  DLAHLVASKWPG  176
            DLAHLVA+ WPG
Sbjct  382  DLAHLVANNWPG  393



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPF KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAA NI
Sbjct  168  IISNASCTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAAFNI  227

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK 
Sbjct  228  VPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKE  287

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++G +KG+L V D PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWY NEWGYSQRVV
Sbjct  288  ANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYGNEWGYSQRVV  347

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKV  101
            DLA +VA+ WPG+      DPLE +C TNP   EC+V
Sbjct  348  DLADIVANNWPGMVQETGSDPLETFCNTNPDADECRV  384



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 203/221 (92%), Gaps = 1/221 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  225  IISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  284

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+DVNAAFRKA
Sbjct  285  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTADDVNAAFRKA  344

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVL VCD PLVSVDFRCSDVSS+IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  345  AAGPLKGVLQVCDEPLVSVDFRCSDVSSSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  404

Query  211  DLAHLV-ASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DLAHLV A      A  GSGDPLED+CK NP   ECKV+EA
Sbjct  405  DLAHLVAAKWPGAAAAGGSGDPLEDFCKDNPETDECKVYEA  445



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -1

Query  664  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRv  485
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV
Sbjct  1    MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV  60

Query  484  ptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSST  305
            PTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSST
Sbjct  61   PTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSST  120

Query  304  IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTN  125
            IDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG     SGDPLED+C+TN
Sbjct  121  IDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAGSGKSGDPLEDFCQTN  180

Query  124  PGDKECKVFEA  92
            P D+ECKV+EA
Sbjct  181  PADEECKVYEA  191



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 196/219 (89%), Gaps = 1/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+DE FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  188  IVSNASCTTNCLAPFAKVLDESFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNI  247

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAFR+A
Sbjct  248  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGITAEEVNAAFREA  307

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
             +GP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVV
Sbjct  308  QNGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVV  367

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DL  L+ +K     V    DP++  C ++PG +ECKVF+
Sbjct  368  DLT-LIVAKALVTGVENFSDPMDALCASDPGAEECKVFD  405



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score =   273 bits (699),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -1

Query  577  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  398
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  32   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  91

Query  397  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  218
            KA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  92   KAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  151

Query  217  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            VVDLAHLVA+KWPG + AGSGD LED+C+TNP DKECKVFE+
Sbjct  152  VVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKECKVFES  193



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+D++FGIVKGTMTT HSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  188  IVSNASCTTNCLAPFAKVLDDKFGIVKGTMTTCHSYTGDQRILDASHRDLRRARAAALNI  247

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++A
Sbjct  248  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEA  307

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            S+GP+KG+L + + PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVV
Sbjct  308  SEGPMKGILAITETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVV  367

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DL H+VA+          GDP++ +C  +P  +ECKVF+
Sbjct  368  DLTHIVAAGLIEGGEVTVGDPMDAFCADDPSAEECKVFD  406



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 197/219 (90%), Gaps = 1/219 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  189  IVSNASCTTNCLAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNI  248

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAE+VNAAF++A
Sbjct  249  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGVTAEEVNAAFKEA  308

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
             DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVV
Sbjct  309  QDGPMKGVLAITDVPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVV  368

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  95
            DL+ +VA+      VA S DP++  C  +P   ECKVF+
Sbjct  369  DLSLIVANGLINEGVA-SADPMDQLCADDPSADECKVFD  406



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 197/221 (89%), Gaps = 5/221 (2%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+DE+FGI+KGTMTT HSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  188  IVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTCHSYTGDQRILDASHRDLRRARAAALNI  247

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV NV+KKG+TAE+VNAAF++A
Sbjct  248  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKGVTAEEVNAAFKEA  307

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGP+KGVL + + PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVV
Sbjct  308  ADGPMKGVLAITETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVV  367

Query  211  DLAHLVASKWPGVAVAG--SGDPLEDYCKTNPGDKECKVFE  95
            DL H+VA    G+   G  S DP++  C  +P  +ECKVF+
Sbjct  368  DLTHIVAK---GLIEGGDVSADPMDALCADDPSAEECKVFD  405



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score =   266 bits (679),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  577  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  398
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  11   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  70

Query  397  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  218
            KA++GPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  71   KAANGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  130

Query  217  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA*F  86
            VVDLAHLVASKWPG+   GS DPLED+CKTNP  +ECKV+EA F
Sbjct  131  VVDLAHLVASKWPGMPAQGSSDPLEDFCKTNPETEECKVYEAGF  174



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  189  IVSNASCTTNCLAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNI  248

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ 
Sbjct  249  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEY  308

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVV
Sbjct  309  ADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVV  368

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DL  +VA+       + + DPL+  C  +P   ECKVF++
Sbjct  369  DLTLIVANSLINEG-SVTLDPLDQLCSDDPSADECKVFDS  407



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  216  IVSNASCTTNCLAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ 
Sbjct  276  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEY  335

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QRVV
Sbjct  336  ADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQRVV  395

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DL  +VA+       + + DPL+  C  +P   ECKVF++
Sbjct  396  DLTLIVANSLINEG-SVTLDPLDQLCSDDPSADECKVFDS  434



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  221  IVSNASCTTNCLAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNI  280

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ 
Sbjct  281  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEY  340

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QRVV
Sbjct  341  ADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQRVV  400

Query  211  DLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            DL  +VA+       + + DPL+  C  +P   ECKVF++
Sbjct  401  DLTLIVANSLINEG-SVTLDPLDQLCSDDPSADECKVFDS  439



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++ ++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  124  IISNASCTTNCLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  183

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR+A
Sbjct  184  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFREA  242

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  243  ANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  302

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  303  DLADIVANNW  312



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 181/192 (94%), Gaps = 1/192 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  168  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  227

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A
Sbjct  228  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREA  286

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++G +KG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  287  ANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  346

Query  211  DLAHLVASKWPG  176
            DLA+LVA KW G
Sbjct  347  DLANLVAEKWTG  358



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  44   IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  103

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  104  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  162

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  163  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  222

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  223  DLADIVANNW  232



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  307  DLADIVANNW  316



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 181/192 (94%), Gaps = 1/192 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  209  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  268

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A
Sbjct  269  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREA  327

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++G +KG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  328  ANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  387

Query  211  DLAHLVASKWPG  176
            DLA+LVA KW G
Sbjct  388  DLANLVAEKWTG  399



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   266 bits (679),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++ ++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  146  IISNASCTTNCLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  205

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR+A
Sbjct  206  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFREA  264

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  265  ANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  324

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  325  DLADIVANNW  334



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  307  DLADIVANNW  316



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  307  DLADIVANNW  316



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  307  DLADIVANNW  316



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  97   IVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  156

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A
Sbjct  157  VPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREA  215

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  216  ANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  275

Query  211  DLAHLVASK  185
            DLAH++A +
Sbjct  276  DLAHIMAKE  284



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  147  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  207  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  265

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  266  ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  325

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  326  DLADIVANKW  335



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  123  IVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  182

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A
Sbjct  183  VPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREA  241

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  242  ANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  301

Query  211  DLAHLVASK  185
            DLAH++A +
Sbjct  302  DLAHIMAKE  310



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DL+ +VA+ W
Sbjct  307  DLSDIVANNW  316



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  307  DLADIVANKW  316



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  227
            ++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  353  AEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 180/189 (95%), Gaps = 1/189 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  97   IVSNASCTTNCLAPFAKVLDDKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  156

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A
Sbjct  157  VPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREA  215

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  216  ANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  275

Query  211  DLAHLVASK  185
            DLAH++A++
Sbjct  276  DLAHIMANQ  284



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  145  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNI  204

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  205  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  263

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  264  ADQELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  323

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  324  DLADIVANKW  333



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   262 bits (669),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  128  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  187

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  188  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  246

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  247  AEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  306

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  307  DLADIVANKW  316



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  213  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  272

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A
Sbjct  273  VPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREA  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  332  ADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKW  182
            DLA++VA +W
Sbjct  392  DLANIVAEQW  401



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  144  IVSNASCTTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  203

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A
Sbjct  204  VPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREA  262

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  263  ANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  322

Query  211  DLAHLVASK  185
            DLAH++A +
Sbjct  323  DLAHIMAKE  331



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  213  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  272

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++
Sbjct  273  VPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRES  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  332  ADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKW  182
            DLA++VA +W
Sbjct  392  DLANIVAEQW  401



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDA+HRDLRRARAA LNI
Sbjct  147  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  207  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  265

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  266  ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  325

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  326  DLADIVANKW  335



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  147  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  207  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  265

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  266  ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  325

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  326  DLADIVANKW  335



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  147  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  207  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  265

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  266  ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  325

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  326  DLADIVANKW  335



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A
Sbjct  272  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREA  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  ADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  391  DLADIVANQW  400



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  161  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  220

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  221  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  279

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  280  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  339

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  340  DLADIVANNW  349



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  117  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  176

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  177  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  235

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  236  AANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVV  295

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  296  DLADIVANQW  305



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  233  IVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  292

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA
Sbjct  293  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKA  352

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  227
            +DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  353  ADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A
Sbjct  272  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREA  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  ADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  391  DLADIVANQW  400



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  161  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  220

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  221  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  279

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  280  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  339

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  340  DLADIVANNW  349



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  206  IISNASCTTNCLAPFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  265

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++
Sbjct  266  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRES  324

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  325  ADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  384

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  385  DLADIVANKW  394



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   263 bits (671),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 179/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A
Sbjct  272  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREA  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  ADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  391  DLADIVANQW  400



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   259 bits (662),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  116  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  175

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  176  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  234

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  235  AEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  294

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  295  DLADIVANNW  304



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  147  IVSNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  207  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  265

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  266  AANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  325

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  326  DLADIVANNW  335



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPFVKVMDEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  234  IVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNI  293

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA
Sbjct  294  VPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKA  353

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  227
            ++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  354  AEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  408



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  272  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  391  DLADIVANKW  400



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  191  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  250

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  251  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRES  309

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  310  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  369

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  370  DLADIVANNW  379



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   +KG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AANEMKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  390  DLADIVANNW  399



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  390  DLADIVANNW  399



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  ADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  393  DLADIVANKW  402



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  213  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  272

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR++
Sbjct  273  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFRES  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  332  ADNELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKW  182
            DLAH+VA  W
Sbjct  392  DLAHIVADNW  401



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  ADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  393  DLADIVANKW  402



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR A
Sbjct  274  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDA  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  393  DLADIVANQW  402



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  272  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRES  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  ADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA KW
Sbjct  391  DLADIVADKW  400



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  ADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  393  DLADIVANKW  402



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRES  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  390  DLADIVANNW  399



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  390  DLADIVANKW  399



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  390  DLADIVANKW  399



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DL+ +VA+ W
Sbjct  389  DLSDIVANNW  398



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A
Sbjct  270  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  ADKELNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  389  DLADIVANQW  398



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   259 bits (663),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  191  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  250

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  251  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  309

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  310  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  369

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  370  DLADIVANNW  379



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   259 bits (662),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  191  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  250

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE++NAAFR +
Sbjct  251  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEINAAFRDS  309

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  310  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  369

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  370  DLADIVANNW  379



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   260 bits (664),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR V
Sbjct  333  ADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAV  392

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  393  DLADIVANKW  402



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  161  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  220

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  221  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  279

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR V
Sbjct  280  AEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDV  339

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  340  DLADIVANNW  349



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  148  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  207

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  208  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  266

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  267  AEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  326

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  327  DLADIVANNW  336



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  393  DLADIVANKW  402



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  L+G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  ADNELQGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  393  DLADIVANKW  402



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  215  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  274

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++
Sbjct  275  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRES  333

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  334  ADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  393

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  394  DLADIVANNW  403



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  161  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  220

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  221  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  279

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  280  AEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  339

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  340  DLADIVANNW  349



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 178/191 (93%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  187  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  246

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP+LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  247  VPTSTGAAKAVALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  305

Query  391  SDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             + P LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  306  CETPQLKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  365

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  366  VDLANLVAEKW  376



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILEVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+KW
Sbjct  390  DLADIVANKW  399



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  272  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  AANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  391  DLADIVANQW  400



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  207  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  266

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  267  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  325

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  326  AEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  385

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  386  DLADIVANNW  395



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  213  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  272

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  273  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  332  ADKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  392  DLADIVANNW  401



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+ E+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  184  IISNASCTTNCLAPFVKVLQEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  243

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLPQLKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A
Sbjct  244  VPTTTGAAKAVALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREA  302

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GP+KGVL V DAPLVS+DF+C+D S++IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  303  AAGPMKGVLHVEDAPLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  362

Query  211  DLAHLVASKW  182
            DLA + A KW
Sbjct  363  DLAEVTAQKW  372



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  272  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  AANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  391  DLADIVANQW  400



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  207  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  266

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  267  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  325

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  326  AEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  385

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  386  DLADIVANNW  395



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  139  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  198

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  199  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGA  257

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  258  AANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  317

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  318  DLADIVANNW  327



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  220  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  279

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  280  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  338

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  339  ADNELAGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  398

Query  211  DLAHLVASKW  182
            DLA++VA++W
Sbjct  399  DLANIVANQW  408



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  213  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  272

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  273  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  332  AANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  392  DLADIVANQW  401



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  222  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  281

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  282  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  340

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  341  ADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  400

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  401  DLADIVANNW  410



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  207  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  266

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  267  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  325

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  326  AEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  385

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  386  DLADIVANNW  395



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  147  IISNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  206

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+N +KKG+TAE+VNAAFRKA
Sbjct  207  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTAEEVNAAFRKA  266

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  227
            +DGP+KG+L VCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNE GY
Sbjct  267  ADGPMKGILGVCDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNELGY  321



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNC+APFVKV++E+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NI
Sbjct  180  IISNASCTTNCMAPFVKVLEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNI  239

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP +KGKLNGIALRVPTPNVS+VDLVV V+KK   AE+VNAAFR+A
Sbjct  240  VPTSTGAAKAVALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTF-AEEVNAAFREA  298

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++G  KGVL V D PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  299  ANGAQKGVLAVSDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  358

Query  211  DLAHLVASKW  182
            DLA + A KW
Sbjct  359  DLAEITAQKW  368



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGA  328

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+LDVCD PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  329  AANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  388

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  389  DLADIVANNW  398



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -1

Query  739  ASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTS  560
            ASCTTNCLAPFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTS
Sbjct  2    ASCTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTS  61

Query  559  TGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP  380
            TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGP
Sbjct  62   TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGP  121

Query  379  LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  230
            LKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDN+WG
Sbjct  122  LKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNDWG  171



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  209  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  268

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  269  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  327

Query  391  -SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  328  CATEELKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  387

Query  214  VDLAHLVASKW  182
            VDLAH+VA KW
Sbjct  388  VDLAHIVAEKW  398



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR +
Sbjct  274  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDS  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L+G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  393  DLADIVANQW  402



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR +
Sbjct  272  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDS  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L+G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  AANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  391  DLADIVANQW  400



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  276  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  334

Query  391  -SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  335  CATEELKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  394

Query  214  VDLAHLVASKW  182
            VDLAH+VA KW
Sbjct  395  VDLAHIVAEKW  405



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV++++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  184  IISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  243

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAVSLVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A
Sbjct  244  VPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREA  302

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  303  ANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  362

Query  211  DLAHLVASKW  182
            DLA + A KW
Sbjct  363  DLAEVTAKKW  372



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   254 bits (649),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  114  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  173

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+++
Sbjct  174  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFKES  232

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L+G+L VC+ PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  233  AEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  292

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  293  DLADIVANSW  302



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   257 bits (657),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILEVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  390  DLADIVANNW  399



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   254 bits (650),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNCLAPF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  144  IVSNASCTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  203

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK+
Sbjct  204  VPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKS  263

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEW  233
            +DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEW
Sbjct  264  ADGPLNGILAVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEW  316



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  274  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  393  DLADIVANNW  402



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   256 bits (655),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTN LAPF KV+D++FGIVKG MTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  187  IISNASCTTNGLAPFAKVLDDKFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNI  246

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVD+ +  +KK  TAE++NAAFR+A
Sbjct  247  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKK-CTAEEINAAFREA  305

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+L V D PLVS+DFRCSDVS+TID++LTMVMGDD++KVVAWYDNEWGYSQRVV
Sbjct  306  AEGPMKGILAVADEPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAWYDNEWGYSQRVV  365

Query  211  DLAHLVASKW  182
            DLA L A+KW
Sbjct  366  DLAELTATKW  375



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTT SYTGDQRLLDASHRDLRRARAAALNI
Sbjct  211  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASHRDLRRARAAALNI  270

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A
Sbjct  271  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDA  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  330  AEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  389

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  390  DLADIVANNW  399



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV++++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  179  IISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  238

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A
Sbjct  239  VPTTTGAAKAVALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREA  297

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  298  ANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVV  357

Query  211  DLAHLVASKW  182
            DLA + A KW
Sbjct  358  DLAEITAKKW  367



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  270  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  328

Query  391  SDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  329  CETEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  388

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  389  VDLANLVAEKW  399



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  179  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  238

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK NGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  239  VPTSTGAAKAVALVLPNLKGKHNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRNS  297

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L VCD PLVSVDF+CSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  298  AEKELKGILKVCDEPLVSVDFKCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  357

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  358  DLADIVANNW  367



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  215  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  274

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  275  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRES  333

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  334  ADKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  393

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  394  DLADIVANNW  403



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  276  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  334

Query  391  SDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  335  CETEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  394

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  395  VDLANLVAEKW  405



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 175/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  188  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  247

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  248  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  306

Query  391  SDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
                 LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  307  CQTEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  366

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  367  VDLANLVAEKW  377



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  127  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  186

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  187  VPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  245

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVV
Sbjct  246  AANELIGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVV  305

Query  211  DLAHLVASKW  182
            DLA + A KW
Sbjct  306  DLADICAIKW  315



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 175/191 (92%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A
Sbjct  276  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDA  334

Query  391  SDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
                 LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRV
Sbjct  335  CQTEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  394

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  395  VDLANLVAEKW  405



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  212  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  271

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR +
Sbjct  272  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDS  330

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L+VCDAPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  331  AANELAGILEVCDAPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  390

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  391  DLADIVANNW  400



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  276  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  334

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  335  AEKELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  394

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  395  DLADIVANSW  404



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  210  IISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  269

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTG AKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR+A
Sbjct  270  VPTSTGVAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREA  329

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L VCD PLVS+DF CSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  330  ANGPLKGILAVCDIPLVSIDFHCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  389

Query  211  DLAH  200
            DLAH
Sbjct  390  DLAH  393



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  256  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  315

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR  
Sbjct  316  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDT  374

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  375  AEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  434

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  435  DLADIVANNW  444



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTN LAPF KV+D+ FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNI
Sbjct  189  IISNASCTTNGLAPFAKVLDDSFGIIKGLMTTTHSYTGDQRILDASHRDLRRARAAALNI  248

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVD+V+ V+KK  TAEDVNAAFR+A
Sbjct  249  VPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKK-CTAEDVNAAFREA  307

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GP+KG+L V D PLVS+DFRC+DVS++IDS+LTMVMG+D+VK+VAWYDNEWGYSQRVV
Sbjct  308  AAGPMKGILQVVDEPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAWYDNEWGYSQRVV  367

Query  211  DLAHLVASKW  182
            DLA L ASKW
Sbjct  368  DLAELTASKW  377



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  133  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  192

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A
Sbjct  193  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDA  251

Query  391  SD-GPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRV
Sbjct  252  CNTDQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRV  311

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  312  VDLANLVAEKW  322



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            IVS ASCTTNC+APF KV+D +FGIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  74   IVSNASCTTNCMAPFCKVLDAKFGIVKGVMTTTHSYTGDQRLLDASHRDLRRARAAALNI  133

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLP LKGKLNG ALRVPTPNVS+VDLV+ V+KK   AE+VN AFR+A
Sbjct  134  VPTTTGAAKAVALVLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKTF-AEEVNNAFREA  192

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + G +KGVL VCD PLVSVDFRC+DVS +IDSSLTMVMGDDMVK+VAWYDNEWGYSQRVV
Sbjct  193  AAGEMKGVLAVCDEPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVV  252

Query  211  DLAHLVASKW  182
            DLA L ASKW
Sbjct  253  DLAELAASKW  262



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  186  IISNASCTTNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  245

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A
Sbjct  246  VPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDA  304

Query  391  SD-GPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRV  215
             +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRV
Sbjct  305  CNTDQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRV  364

Query  214  VDLAHLVASKW  182
            VDLA+LVA KW
Sbjct  365  VDLANLVAEKW  375



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  274  VPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVV
Sbjct  333  AANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA + A++W
Sbjct  393  DLADICANQW  402



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  166  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  225

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  226  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  284

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  285  AEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  344

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  345  DLADIVANNW  354



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  194  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  253

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  254  VPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  312

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVV
Sbjct  313  AANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVV  372

Query  211  DLAHLVASKW  182
            DLA + A++W
Sbjct  373  DLADICANQW  382



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A
Sbjct  274  VPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDA  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVV
Sbjct  333  AANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA + A++W
Sbjct  393  DLADICANQW  402



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  215  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  274

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  275  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDS  333

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  334  AEKELNGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  393

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  394  DLADIVANNW  403



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -1

Query  538  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  359
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  1    SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNAAFRKAADGPLKGVLAV  60

Query  358  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  179
            CD PLVSVDFRC+DVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  61   CDVPLVSVDFRCTDVSATIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWP  120

Query  178  GVAVAGSGDPLEDYCKTNPGDKECKVFEA  92
            G+A   SGDPLED+CKTNP D+ECKV+EA
Sbjct  121  GMAAQESGDPLEDFCKTNPADEECKVYEA  149



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  274  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            S   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  SAKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  393  DLADIVANNW  402



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  274  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  393  DLADIVANNW  402



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+ GIVKGT+TTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  222  IISNASCTTNCLAPFVKVLDEKLGIVKGTVTTTHSYTGDQRLLDASHRDLRRARAAALNI  281

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VN AFR+A
Sbjct  282  VPTTTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNEAFREA  340

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GP+KG+L V D PLVS DF CSD SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  341  ANGPMKGILVVSDEPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  400

Query  211  DLAHLVASKW  182
            DLA +VA KW
Sbjct  401  DLAEIVAKKW  410



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  274  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  393  DLADIVANNW  402



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  274  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            S   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  SAKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  393  DLADIVANNW  402



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  213  IISNASCTTNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  272

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR +
Sbjct  273  VPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDS  331

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   LKG+L+VCD PLVSVDFRCSDVS TID+SL+MVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  332  AANELKGILEVCDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVV  391

Query  211  DLAHLVASKW  182
            DLA +VA++W
Sbjct  392  DLADIVANQW  401



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  214  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  273

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +
Sbjct  274  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDS  332

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  333  AEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  392

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  393  DLADIVANNW  402



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+++ FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  223  IISNASCTTNCLAPFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  282

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLPQLKGKLNG+ALRVPTP VSVVDLV+  +KK  T E+VN+AFR+A
Sbjct  283  VPTTTGAAKAVALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFT-EEVNSAFREA  341

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            S+G LKG+L V D PLVS D+R +DVSSTID++LTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  342  SEGYLKGILAVSDEPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQRVV  401

Query  211  DLAHLVASKW  182
            DLA LVA KW
Sbjct  402  DLAELVAQKW  411



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+ E+FG+VKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  187  IISNASCTTNCLAPFVKVIVEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  246

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK L AE+VN AFR A
Sbjct  247  VPTTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTL-AEEVNQAFRDA  305

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            + GPLKGVL V D PLVS+DF+ SDVS+TIDS+LTMVMGDDMVKVVAWYDNEWGYSQRV+
Sbjct  306  AAGPLKGVLGVADIPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAWYDNEWGYSQRVL  365

Query  211  DLAHLVASKW  182
            DLA L A KW
Sbjct  366  DLAELCAEKW  375



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  219  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  278

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+++
Sbjct  279  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFKES  337

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L+G+L VC+ PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  338  AEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  397

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  398  DLADIVANSW  407



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  127  IISNASCTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  186

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPT+TGAAKAV+LVLP+LKGKLNG+ALRVPTP VSVVDLVV V+KK   AE+VN AFR+A
Sbjct  187  VPTTTGAAKAVALVLPKLKGKLNGVALRVPTPTVSVVDLVVQVEKKTF-AEEVNEAFREA  245

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++GPLKG+L V D PLVS DF+ ++VSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV
Sbjct  246  ANGPLKGILGVSDEPLVSCDFKMTNVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  305

Query  211  DLAHLVASKW  182
            DLA   A  W
Sbjct  306  DLAAYTAKHW  315



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  215  IISNASCTTNCLAPFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  274

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  275  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  333

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            ++  L G+L VCD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  334  AEKELNGILSVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVV  393

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  394  DLADIVANNW  403



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDQKSGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAK V+LVLP L+GKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++
Sbjct  276  VPTSTGAAKPVALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRES  334

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +D  LKG+L VCD PLVSVDFRC DVSST+DSSLTMVMGDDMVKV+AWYDNEWGY QRVV
Sbjct  335  ADKELKGILSVCDEPLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYFQRVV  394

Query  211  DLAHLVASKW  182
            DLA +VA KW
Sbjct  395  DLADVVAEKW  404



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  215  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  274

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR +
Sbjct  275  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRDS  333

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  334  AAKELSGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  393

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  394  DLADIVANNW  403



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  215  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  274

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR +
Sbjct  275  VPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRDS  333

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVV
Sbjct  334  AAKELSGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVV  393

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  394  DLADIVANNW  403



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR++
Sbjct  276  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNEAFRES  334

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVV
Sbjct  335  AANELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVV  394

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  395  DLADIVANNW  404



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -1

Query  751  IVSXASCTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNI  572
            I+S ASCTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI
Sbjct  216  IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNI  275

Query  571  VPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA  392
            VPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR++
Sbjct  276  VPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRES  334

Query  391  SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVV  212
            +   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDD+VKV+AWYDNEWGYSQRVV
Sbjct  335  AAKELTGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVV  394

Query  211  DLAHLVASKW  182
            DLA +VA+ W
Sbjct  395  DLADIVANNW  404



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840