BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034G13

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     241   6e-76   Pisum sativum [garden pea]
gb|AID55380.1|  glycoside hydrolase family 9 A2                         252   1e-75   Gossypium hirsutum [American cotton]
gb|KJB70736.1|  hypothetical protein B456_011G089500                    252   1e-75   Gossypium raimondii
gb|ADB82903.1|  membrane-bound endo-beta-1,4-glucanase                  250   8e-75   Populus alba x Populus grandidentata
gb|AAZ08322.1|  endo-1,4-beta-glucanase                                 246   8e-75   Eucalyptus globulus [blue gum]
gb|AHA41508.1|  endo-1,4 -beta-glucanase                                250   9e-75   Populus deltoides
ref|XP_006385837.1|  endo-1 family protein                              250   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             249   1e-74   Phaseolus vulgaris [French bean]
gb|AAT75041.1|  Cel9A                                                   249   1e-74   Populus tremula x Populus tremuloides
gb|AAS45400.1|  endo-1,4-beta-glucanase                                 249   2e-74   Populus tremuloides
gb|KDP32467.1|  hypothetical protein JCGZ_13392                         249   2e-74   Jatropha curcas
emb|CBI29606.3|  unnamed protein product                                246   3e-74   Vitis vinifera
ref|XP_011022354.1|  PREDICTED: endoglucanase 25-like                   248   4e-74   Populus euphratica
ref|XP_002299405.1|  endo-1 family protein                              248   5e-74   
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   248   6e-74   
ref|XP_003546229.1|  PREDICTED: endoglucanase 25-like                   247   1e-73   Glycine max [soybeans]
gb|KHN14382.1|  Endoglucanase 25                                        247   2e-73   Glycine soja [wild soybean]
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               246   4e-73   Gossypium hirsutum [American cotton]
ref|XP_010065200.1|  PREDICTED: endoglucanase 25-like                   246   4e-73   Eucalyptus grandis [rose gum]
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               246   4e-73   Gossypium hirsutum [American cotton]
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               246   4e-73   Gossypium herbaceum subsp. africanum
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 246   4e-73   Gossypium gossypioides
gb|AEN70798.1|  endo-1,4-beta-glucanase                                 246   4e-73   Gossypium turneri
gb|KJB66548.1|  hypothetical protein B456_010G143300                    246   4e-73   Gossypium raimondii
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 245   5e-73   Gossypium hirsutum [American cotton]
gb|AEN70810.1|  endo-1,4-beta-glucanase                                 245   9e-73   Gossypium hirsutum subsp. latifolium
gb|AEN70809.1|  endo-1,4-beta-glucanase                                 245   9e-73   Gossypium hirsutum subsp. latifolium
ref|XP_009600540.1|  PREDICTED: endoglucanase 25-like                   244   1e-72   Nicotiana tomentosiformis
gb|AAP83128.1|  endo-1,4-beta-glucanase                                 244   1e-72   Gossypium hirsutum [American cotton]
ref|XP_002519394.1|  endo-1,4-beta-glucanase, putative                  244   1e-72   Ricinus communis
gb|ADY68791.1|  membrane-anchored endo-1,4-beta-glucanase               244   1e-72   Gossypium barbadense [Egyptian cotton]
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   244   2e-72   Solanum tuberosum [potatoes]
gb|ABD62083.1|  endo-1,4-beta-glucancase precursor                      244   2e-72   Glycine max [soybeans]
gb|AFY03622.1|  endo-1,4-beta-glucanase                                 244   2e-72   Eucalyptus globulus [blue gum]
ref|XP_003535026.1|  PREDICTED: endoglucanase 25                        244   2e-72   
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 244   2e-72   Gossypium schwendimanii
gb|KDO53876.1|  hypothetical protein CISIN_1g007014mg                   239   3e-72   Citrus sinensis [apfelsine]
gb|AGV22123.1|  endo-1,4-beta-glucanase 1                               243   3e-72   Betula luminifera [liang ye hua]
ref|XP_003529689.1|  PREDICTED: endoglucanase 25-like                   243   4e-72   Glycine max [soybeans]
emb|CDP17765.1|  unnamed protein product                                243   4e-72   Coffea canephora [robusta coffee]
gb|AIE16186.1|  endo-1,4-beta-glucanase                                 243   5e-72   Nicotiana tabacum [American tobacco]
ref|XP_003550680.1|  PREDICTED: endoglucanase 25-like                   243   6e-72   Glycine max [soybeans]
ref|XP_004171003.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    242   8e-72   
ref|XP_004133745.1|  PREDICTED: endoglucanase 25-like                   242   9e-72   Cucumis sativus [cucumbers]
ref|XP_010088712.1|  Endoglucanase 25                                   242   9e-72   Morus notabilis
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        247   1e-71   
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        242   1e-71   Tarenaya hassleriana [spider flower]
gb|AFD33696.1|  korrigan                                                242   1e-71   Eucalyptus camaldulensis
ref|XP_007154086.1|  hypothetical protein PHAVU_003G089600g             242   1e-71   Phaseolus vulgaris [French bean]
ref|NP_001284449.1|  endoglucanase 25-like                              241   1e-71   Cucumis melo [Oriental melon]
ref|XP_009770880.1|  PREDICTED: endoglucanase 25-like                   241   2e-71   Nicotiana sylvestris
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        247   2e-71   Populus euphratica
ref|XP_006358489.1|  PREDICTED: endoglucanase 25-like                   241   2e-71   Solanum tuberosum [potatoes]
ref|XP_011088109.1|  PREDICTED: endoglucanase 25-like                   241   2e-71   
ref|NP_001233943.1|  endo-1,4-beta-glucanase                            241   2e-71   Solanum lycopersicum
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   240   7e-71   Cicer arietinum [garbanzo]
ref|XP_006431347.1|  hypothetical protein CICLE_v10000600mg             239   9e-71   Citrus clementina [clementine]
gb|KDO53875.1|  hypothetical protein CISIN_1g007014mg                   239   1e-70   Citrus sinensis [apfelsine]
ref|XP_011092233.1|  PREDICTED: endoglucanase 25-like                   239   1e-70   Sesamum indicum [beniseed]
ref|XP_003594425.1|  Endoglucanase                                      239   1e-70   Medicago truncatula
ref|XP_009765308.1|  PREDICTED: endoglucanase 25-like                   239   1e-70   Nicotiana sylvestris
ref|XP_009595607.1|  PREDICTED: endoglucanase 25-like                   239   2e-70   Nicotiana tomentosiformis
ref|XP_008339246.1|  PREDICTED: endoglucanase 25-like                   238   3e-70   Malus domestica [apple tree]
ref|XP_008347974.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    238   3e-70   
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   238   5e-70   Tarenaya hassleriana [spider flower]
dbj|BAC22690.1|  endo-1,4-beta-D-glucanase                              237   1e-69   Pyrus communis
dbj|BAD95336.1|  cellulase homolog OR16pep precursor                    226   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009340771.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    236   1e-69   
dbj|BAF42036.1|  cellulase1                                             236   1e-69   Pyrus communis
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        235   3e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             240   3e-69   
ref|XP_007222007.1|  hypothetical protein PRUPE_ppa002911mg             234   1e-68   Prunus persica
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    238   2e-68   
ref|XP_010909007.1|  PREDICTED: endoglucanase 10-like                   232   5e-68   Elaeis guineensis
ref|XP_008803421.1|  PREDICTED: endoglucanase 10-like                   232   6e-68   Phoenix dactylifera
ref|XP_010266669.1|  PREDICTED: endoglucanase 9-like                    232   7e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   231   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_006281810.1|  hypothetical protein CARUB_v10027986mg             230   3e-67   Capsella rubella
ref|XP_010482263.1|  PREDICTED: endoglucanase 25-like                   230   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        234   6e-67   
emb|CAB51903.1|  cellulase                                              229   7e-67   Brassica napus [oilseed rape]
emb|CDX83181.1|  BnaA03g23250D                                          229   8e-67   
gb|AEO97184.1|  endo-1,4-beta-glucanase                                 229   8e-67   Populus trichocarpa [western balsam poplar]
gb|AEO97239.1|  endo-1,4-beta-glucanase                                 229   8e-67   Populus tomentosa [Chinese white poplar]
ref|XP_010442441.1|  PREDICTED: endoglucanase 25                        229   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010441020.1|  PREDICTED: endoglucanase 25                        229   8e-67   Camelina sativa [gold-of-pleasure]
gb|AEO97252.1|  endo-1,4-beta-glucanase                                 229   8e-67   Populus tomentosa [Chinese white poplar]
gb|AEO97238.1|  endo-1,4-beta-glucanase                                 229   9e-67   Populus tomentosa [Chinese white poplar]
ref|XP_009355455.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    233   1e-66   
gb|AEO97265.1|  endo-1,4-beta-glucanase                                 229   1e-66   Populus tomentosa [Chinese white poplar]
gb|AEO97182.1|  endo-1,4-beta-glucanase                                 228   1e-66   Populus tomentosa [Chinese white poplar]
ref|XP_009399913.1|  PREDICTED: endoglucanase 9-like                    230   1e-66   
ref|XP_009134026.1|  PREDICTED: endoglucanase 25                        229   1e-66   Brassica rapa
ref|XP_010938102.1|  PREDICTED: endoglucanase 9-like                    228   1e-66   Elaeis guineensis
ref|XP_002865753.1|  hypothetical protein ARALYDRAFT_495032             228   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_010921267.1|  PREDICTED: endoglucanase 9-like                    228   2e-66   Elaeis guineensis
ref|XP_009123553.1|  PREDICTED: endoglucanase 25                        228   2e-66   Brassica rapa
gb|AEO97283.1|  endo-1,4-beta-glucanase                                 228   2e-66   Populus tomentosa [Chinese white poplar]
gb|AAM63370.1|  cellulase homolog OR16pep precursor                     228   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AEO97183.1|  endo-1,4-beta-glucanase                                 228   3e-66   Populus tomentosa [Chinese white poplar]
emb|CDY37768.1|  BnaA10g05530D                                          228   3e-66   Brassica napus [oilseed rape]
emb|CDX71601.1|  BnaC09g26420D                                          228   3e-66   
ref|XP_006858422.1|  hypothetical protein AMTR_s00071p00064260          228   3e-66   Amborella trichopoda
gb|AEO97185.1|  endo-1,4-beta-glucanase                                 227   3e-66   Populus trichocarpa [western balsam poplar]
gb|AAN72232.1|  At5g49720/K2I5_8                                        227   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199783.1|  endo-1,4-beta-D-glucanase                             227   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59818.1|  AT5g49720/K2I5_8                                        227   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        231   9e-66   Fragaria vesca subsp. vesca
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   226   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782747.1|  PREDICTED: endoglucanase 9-like                    226   1e-65   Phoenix dactylifera
emb|CDY21449.1|  BnaC03g27480D                                          226   1e-65   Brassica napus [oilseed rape]
ref|XP_009406859.1|  PREDICTED: endoglucanase 9-like                    226   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26611.1|  hypothetical protein AALP_AA8G271400                    224   7e-65   Arabis alpina [alpine rockcress]
gb|AFL65037.1|  endoglucanase                                           220   8e-65   Pinus pinaster [cluster pine]
emb|CDX92628.1|  BnaC07g38860D                                          223   2e-64   
ref|XP_008793381.1|  PREDICTED: endoglucanase 9-like                    223   2e-64   Phoenix dactylifera
ref|NP_001183308.1|  hypothetical protein                               222   3e-64   Zea mays [maize]
ref|XP_009137436.1|  PREDICTED: endoglucanase 21-like                   222   4e-64   Brassica rapa
ref|NP_001142480.1|  uncharacterized protein LOC100274698               209   7e-64   
ref|XP_004984503.1|  PREDICTED: endoglucanase 9-like                    220   2e-63   Setaria italica
gb|ABR16291.1|  unknown                                                 219   3e-63   Picea sitchensis
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  219   4e-63   Picea glauca
gb|ABR15471.1|  endoglucanase                                           219   4e-63   Pinus taeda
ref|XP_009417855.1|  PREDICTED: endoglucanase 9-like                    219   5e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006402246.1|  hypothetical protein EUTSA_v10012932mg             219   5e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006402245.1|  hypothetical protein EUTSA_v10012932mg             219   1e-62   
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   218   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                217   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_007216021.1|  hypothetical protein PRUPE_ppa014845mg             215   5e-62   
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 209   6e-62   Avena strigosa
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          216   8e-62   Sorghum bicolor [broomcorn]
ref|XP_008243721.1|  PREDICTED: endoglucanase 9-like                    214   1e-61   Prunus mume [ume]
ref|NP_001147537.1|  endo-1,4-beta-glucanase                            215   2e-61   Zea mays [maize]
ref|XP_010529892.1|  PREDICTED: endoglucanase 25-like                   214   3e-61   Tarenaya hassleriana [spider flower]
gb|EMT00674.1|  Endoglucanase 10                                        213   4e-61   
emb|CDY34271.1|  BnaA01g13740D                                          213   4e-61   Brassica napus [oilseed rape]
gb|EMS52550.1|  Endoglucanase 10                                        213   4e-61   Triticum urartu
ref|XP_009137865.1|  PREDICTED: endoglucanase 21                        213   6e-61   Brassica rapa
dbj|BAJ94336.1|  predicted protein                                      213   9e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           213   1e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001050004.1|  Os03g0329500                                       213   1e-60   
gb|EEE58992.1|  hypothetical protein OsJ_10702                          213   1e-60   Oryza sativa Japonica Group [Japonica rice]
emb|CDI66528.1|  Endoglucanase 10                                       212   1e-60   Saccharum hybrid cultivar R570
emb|CBB36505.1|  Hordeum vulgare protein similar to endo-1,4-b-gl...    212   2e-60   Saccharum hybrid cultivar R570
emb|CDI66602.1|  Endoglucanase 10                                       212   2e-60   Saccharum hybrid cultivar R570
gb|ABP96983.1|  cellulase                                               211   3e-60   Colocasia esculenta [cocoyam]
ref|XP_006650027.1|  PREDICTED: endoglucanase 9-like                    211   3e-60   Oryza brachyantha
emb|CDI66566.1|  Endoglucanase 10                                       211   4e-60   Saccharum hybrid cultivar R570
ref|XP_006413454.1|  hypothetical protein EUTSA_v10024681mg             211   4e-60   
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          211   4e-60   Sorghum bicolor [broomcorn]
emb|CDY03467.1|  BnaC01g16150D                                          209   6e-60   
ref|NP_001151770.1|  endo-1,4-beta-glucanase Cel1                       211   7e-60   
tpg|DAA51201.1|  TPA: endo-1,4-beta-glucanase Cel1                      210   8e-60   
ref|XP_003557996.1|  PREDICTED: endoglucanase 9                         210   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   210   1e-59   Oryza brachyantha
gb|ACZ82300.1|  beta-1,4 glycosidase                                    210   1e-59   Phyllostachys edulis [kikko-chiku]
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       207   1e-59   Oryza sativa Japonica Group [Japonica rice]
gb|ACN28577.1|  unknown                                                 209   2e-59   Zea mays [maize]
gb|EPS69180.1|  hypothetical protein M569_05586                         209   2e-59   Genlisea aurea
ref|NP_001051192.1|  Os03g0736300                                       208   5e-59   
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        207   1e-58   Brachypodium distachyon [annual false brome]
ref|NP_194157.1|  endoglucanase 21                                      207   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   207   2e-58   Setaria italica
ref|XP_010433798.1|  PREDICTED: endoglucanase 21-like                   206   2e-58   Camelina sativa [gold-of-pleasure]
gb|AFR40585.1|  cellulase                                               192   3e-58   Populus nigra [black poplar]
gb|AFR40584.1|  cellulase                                               192   4e-58   Populus nigra [black poplar]
ref|XP_006431346.1|  hypothetical protein CICLE_v10003884mg             202   5e-58   
gb|KFK22234.1|  hypothetical protein AALP_AAs42893U000400               206   5e-58   Arabis alpina [alpine rockcress]
gb|AFR40563.1|  cellulase                                               192   8e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002867672.1|  predicted protein                                  205   9e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_006283336.1|  hypothetical protein CARUB_v10004382mg             204   1e-57   Capsella rubella
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 204   2e-57   Triticum aestivum [Canadian hard winter wheat]
gb|AFR40589.1|  cellulase                                               191   2e-57   Populus nigra [black poplar]
gb|AFR40578.1|  cellulase                                               190   4e-57   Populus fremontii
gb|AFR40581.1|  cellulase                                               189   6e-57   Populus fremontii
gb|AFR40588.1|  cellulase                                               189   8e-57   Populus nigra [black poplar]
ref|XP_010448587.1|  PREDICTED: endoglucanase 21-like                   201   2e-56   Camelina sativa [gold-of-pleasure]
gb|EMS51342.1|  Endoglucanase 9                                         202   2e-56   Triticum urartu
ref|XP_010277803.1|  PREDICTED: endoglucanase 12-like                   201   3e-56   Nelumbo nucifera [Indian lotus]
gb|EMT18790.1|  Endoglucanase 9                                         201   3e-56   
gb|AGK26801.1|  endo-beta-1,4-glucanase                                 201   4e-56   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26803.1|  endo-beta-1,4-glucanase                                 201   4e-56   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26798.1|  endo-beta-1,4-glucanase                                 201   4e-56   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26802.1|  endo-beta-1,4-glucanase                                 200   4e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010439066.1|  PREDICTED: endoglucanase 21                        200   5e-56   Camelina sativa [gold-of-pleasure]
emb|CDY45056.1|  BnaA08g02190D                                          198   6e-56   Brassica napus [oilseed rape]
dbj|BAK04500.1|  predicted protein                                      200   7e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN68337.1|  hypothetical protein VITISV_025978                     199   1e-55   Vitis vinifera
gb|EPS66085.1|  hypothetical protein M569_08689                         199   2e-55   Genlisea aurea
ref|XP_008342152.1|  PREDICTED: endoglucanase 9-like                    196   4e-55   
gb|AFR40591.1|  cellulase                                               185   4e-55   Populus nigra [black poplar]
ref|XP_006403190.1|  hypothetical protein EUTSA_v10003366mg             195   9e-55   
ref|XP_009339798.1|  PREDICTED: endoglucanase 9-like                    197   9e-55   Pyrus x bretschneideri [bai li]
ref|XP_002960146.1|  hypothetical protein SELMODRAFT_266522             196   1e-54   
gb|AFR40586.1|  cellulase                                               183   2e-54   Populus nigra [black poplar]
gb|AFR40583.1|  cellulase                                               181   7e-54   Populus nigra [black poplar]
ref|XP_006444448.1|  hypothetical protein CICLE_v10024241mg             194   7e-54   Citrus clementina [clementine]
ref|XP_002983992.1|  hypothetical protein SELMODRAFT_268803             194   9e-54   
gb|KDO87072.1|  hypothetical protein CISIN_1g046335mg                   193   2e-53   Citrus sinensis [apfelsine]
gb|EYU33245.1|  hypothetical protein MIMGU_mgv1a022358mg                189   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_006480121.1|  PREDICTED: endoglucanase 25-like                   193   2e-53   Citrus sinensis [apfelsine]
ref|XP_002515321.1|  endo-1,4-beta-glucanase, putative                  192   4e-53   Ricinus communis
ref|XP_008235173.1|  PREDICTED: endoglucanase 9-like                    191   6e-53   Prunus mume [ume]
emb|CBI18623.3|  unnamed protein product                                187   1e-52   Vitis vinifera
ref|XP_007199407.1|  hypothetical protein PRUPE_ppa026228mg             190   2e-52   Prunus persica
ref|XP_010646848.1|  PREDICTED: endoglucanase 12                        187   7e-52   
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   184   3e-50   Phoenix dactylifera
gb|AFZ78629.1|  korrigan                                                184   4e-50   Populus tomentosa [Chinese white poplar]
ref|XP_010065082.1|  PREDICTED: endoglucanase 12                        184   5e-50   Eucalyptus grandis [rose gum]
gb|AFR40582.1|  cellulase                                               172   5e-50   Populus fremontii
ref|XP_010088713.1|  Endoglucanase 25                                   174   5e-50   
ref|XP_009141938.1|  PREDICTED: endoglucanase 21-like                   182   7e-50   Brassica rapa
gb|KHN40215.1|  Endoglucanase 25                                        170   1e-49   Glycine soja [wild soybean]
ref|XP_002514768.1|  endo-1,4-beta-glucanase, putative                  182   2e-49   Ricinus communis
ref|XP_002312211.1|  endo-1 family protein                              182   3e-49   Populus trichocarpa [western balsam poplar]
gb|KDP28223.1|  hypothetical protein JCGZ_13994                         181   4e-49   Jatropha curcas
ref|XP_006448516.1|  hypothetical protein CICLE_v10014583mg             181   5e-49   Citrus clementina [clementine]
gb|KDO77086.1|  hypothetical protein CISIN_1g013288mg                   178   5e-49   Citrus sinensis [apfelsine]
gb|KDP32490.1|  hypothetical protein JCGZ_13415                         181   6e-49   Jatropha curcas
ref|XP_006858738.1|  hypothetical protein AMTR_s00066p00128970          181   7e-49   Amborella trichopoda
ref|XP_011010912.1|  PREDICTED: endoglucanase 12                        181   8e-49   Populus euphratica
gb|ACF87544.1|  unknown                                                 178   8e-49   Zea mays [maize]
ref|XP_004250089.1|  PREDICTED: endoglucanase 12                        180   9e-49   Solanum lycopersicum
ref|XP_006468640.1|  PREDICTED: endoglucanase 12-like                   180   1e-48   Citrus sinensis [apfelsine]
ref|XP_004502103.1|  PREDICTED: endoglucanase 12-like                   179   2e-48   Cicer arietinum [garbanzo]
tpg|DAA36812.1|  TPA: hypothetical protein ZEAMMB73_340402              177   2e-48   
ref|XP_011077092.1|  PREDICTED: endoglucanase 12                        179   3e-48   Sesamum indicum [beniseed]
ref|XP_004976098.1|  PREDICTED: endoglucanase 12-like                   178   4e-48   Setaria italica
ref|XP_007146006.1|  hypothetical protein PHAVU_006G0049001g            177   4e-48   Phaseolus vulgaris [French bean]
ref|XP_007028162.1|  Six-hairpin glycosidases superfamily protein       178   7e-48   
emb|CDP21162.1|  unnamed protein product                                177   8e-48   Coffea canephora [robusta coffee]
ref|XP_010930303.1|  PREDICTED: endoglucanase 12-like                   177   9e-48   Elaeis guineensis
ref|NP_001147970.1|  glycoside transferase, six-hairpin, subgroup       177   9e-48   Zea mays [maize]
ref|XP_010912745.1|  PREDICTED: endoglucanase 12-like                   175   9e-48   
ref|XP_009602898.1|  PREDICTED: endoglucanase 12                        177   9e-48   Nicotiana tomentosiformis
ref|XP_009385674.1|  PREDICTED: endoglucanase 12-like                   177   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009782313.1|  PREDICTED: endoglucanase 12                        177   1e-47   Nicotiana sylvestris
ref|XP_010528623.1|  PREDICTED: endoglucanase 7                         177   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_011014628.1|  PREDICTED: endoglucanase 12-like isoform X3        176   2e-47   Populus euphratica
ref|XP_010929679.1|  PREDICTED: endoglucanase 12-like                   176   2e-47   Elaeis guineensis
ref|XP_003601506.1|  Endoglucanase                                      176   3e-47   Medicago truncatula
ref|XP_006353239.1|  PREDICTED: endoglucanase 12-like                   176   3e-47   Solanum tuberosum [potatoes]
ref|XP_011014603.1|  PREDICTED: endoglucanase 12-like isoform X1        176   4e-47   Populus euphratica
ref|XP_002315101.2|  hypothetical protein POPTR_0010s18480g             174   5e-47   
gb|AFZ78628.1|  korrigan                                                175   1e-46   Populus tomentosa [Chinese white poplar]
gb|KHN09941.1|  Endoglucanase 7                                         174   1e-46   Glycine soja [wild soybean]
ref|XP_003556773.1|  PREDICTED: endoglucanase 12-like                   174   1e-46   Glycine max [soybeans]
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   174   1e-46   Phoenix dactylifera
gb|AEO97186.1|  endo-1,4-beta-glucanase                                 174   1e-46   Populus trichocarpa [western balsam poplar]
emb|CDY39820.1|  BnaC02g42980D                                          173   2e-46   Brassica napus [oilseed rape]
gb|ACT54547.1|  endo-1,4-beta-glucanase                                 173   3e-46   Dimocarpus longan [longan]
ref|NP_001288466.1|  endoglucanase 12-like                              173   4e-46   Zea mays [maize]
ref|NP_001288520.1|  uncharacterized protein LOC103641803               172   9e-46   Zea mays [maize]
emb|CDP09829.1|  unnamed protein product                                171   1e-45   Coffea canephora [robusta coffee]
ref|XP_010673848.1|  PREDICTED: endoglucanase 12-like                   170   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004976099.1|  PREDICTED: endoglucanase 12-like                   171   2e-45   Setaria italica
ref|XP_002446733.1|  hypothetical protein SORBIDRAFT_06g021440          171   2e-45   Sorghum bicolor [broomcorn]
ref|XP_010673846.1|  PREDICTED: endoglucanase 12-like                   171   3e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009403795.1|  PREDICTED: endoglucanase 12-like                   171   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002961082.1|  hypothetical protein SELMODRAFT_75214              170   3e-45   
dbj|BAH57006.1|  AT5G49720                                              169   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966925.1|  hypothetical protein SELMODRAFT_408186             170   4e-45   
gb|AID55392.1|  glycoside hydrolase family 9 A6                         169   8e-45   Gossypium hirsutum [American cotton]
ref|XP_006391540.1|  hypothetical protein EUTSA_v10018270mg             169   1e-44   Eutrema salsugineum [saltwater cress]
gb|KDO53877.1|  hypothetical protein CISIN_1g041590mg                   167   1e-44   Citrus sinensis [apfelsine]
gb|EAY94707.1|  hypothetical protein OsI_16485                          169   1e-44   Oryza sativa Indica Group [Indian rice]
sp|Q7XUK4.2|GUN12_ORYSJ  RecName: Full=Endoglucanase 12; AltName:...    169   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791029.1|  PREDICTED: endoglucanase 12-like                   168   2e-44   Phoenix dactylifera
ref|XP_009127411.1|  PREDICTED: endoglucanase 7                         168   3e-44   Brassica rapa
ref|XP_006300882.1|  hypothetical protein CARUB_v10019972mg             167   3e-44   Capsella rubella
gb|EMT22659.1|  Endoglucanase 12                                        167   3e-44   
ref|XP_010496067.1|  PREDICTED: endoglucanase 7                         167   4e-44   Camelina sativa [gold-of-pleasure]
emb|CDY29138.1|  BnaA09g53910D                                          167   4e-44   Brassica napus [oilseed rape]
gb|KJB49856.1|  hypothetical protein B456_008G141900                    167   4e-44   Gossypium raimondii
ref|XP_008441913.1|  PREDICTED: endoglucanase 7                         167   5e-44   Cucumis melo [Oriental melon]
ref|NP_176738.1|  glycosyl hydrolase 9A2                                166   7e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EYU39502.1|  hypothetical protein MIMGU_mgv1a002977mg                166   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_002888427.1|  hypothetical protein ARALYDRAFT_894138             166   1e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_003580066.1|  PREDICTED: endoglucanase 12                        166   1e-43   Brachypodium distachyon [annual false brome]
gb|AGG19084.1|  cellulase                                               165   3e-43   
gb|EPS58029.1|  endo-1,4-beta-glucanase                                 163   1e-42   
ref|XP_006652472.1|  PREDICTED: endoglucanase 12-like                   163   1e-42   
gb|KFK41003.1|  hypothetical protein AALP_AA2G072700                    161   8e-42   
ref|XP_004169320.1|  PREDICTED: endoglucanase 7-like                    160   9e-42   
ref|XP_004152840.1|  PREDICTED: endoglucanase 7-like                    160   1e-41   
gb|EMT15171.1|  Endoglucanase 12                                        159   4e-41   
ref|XP_003610176.1|  Endo-1 4-beta-glucanase                            153   3e-40   
ref|XP_001759056.1|  predicted protein                                  152   1e-38   
ref|XP_001772986.1|  predicted protein                                  150   3e-38   
emb|CDY16412.1|  BnaA02g12160D                                          150   3e-38   
gb|AFR40587.1|  cellulase                                               139   1e-37   
ref|XP_010415102.1|  PREDICTED: endoglucanase 7-like                    149   1e-37   
ref|XP_009407065.1|  PREDICTED: endoglucanase 25-like                   145   3e-36   
ref|XP_001754846.1|  predicted protein                                  143   2e-35   
ref|XP_001775325.1|  predicted protein                                  142   2e-35   
ref|XP_001763929.1|  predicted protein                                  141   7e-35   
ref|XP_006858456.1|  hypothetical protein AMTR_s00071p00095020          138   1e-33   
ref|XP_007137548.1|  hypothetical protein PHAVU_009G135900g             137   2e-33   
ref|XP_011465378.1|  PREDICTED: endoglucanase 9-like isoform X2         135   3e-33   
ref|XP_004301819.1|  PREDICTED: endoglucanase 25-like isoform X1        135   8e-33   
ref|XP_004502591.1|  PREDICTED: endoglucanase 25-like                   135   9e-33   
ref|XP_002526151.1|  endo-1,4-beta-glucanase, putative                  134   3e-32   
gb|AAQ63883.1|  cellulase                                               133   4e-32   
gb|AES72416.2|  glycosyl hydrolase family 9 protein                     133   4e-32   
ref|XP_003527970.1|  PREDICTED: endoglucanase 25-like                   133   5e-32   
ref|XP_003602165.1|  Endoglucanase                                      133   5e-32   
ref|XP_010999860.1|  PREDICTED: endoglucanase 9-like                    132   9e-32   
gb|KHN23415.1|  Endoglucanase 25                                        132   1e-31   
ref|XP_009360182.1|  PREDICTED: endoglucanase 25-like                   132   2e-31   
ref|XP_008240312.1|  PREDICTED: endoglucanase 25-like                   131   2e-31   
gb|AID55391.1|  glycoside hydrolase family 9 A3                         130   5e-31   
emb|CDP18285.1|  unnamed protein product                                130   7e-31   
ref|XP_004298838.1|  PREDICTED: endoglucanase 20-like                   128   1e-30   
ref|XP_008786534.1|  PREDICTED: endoglucanase 10-like                   128   3e-30   
ref|XP_002278065.1|  PREDICTED: endoglucanase 25-like                   128   3e-30   
dbj|BAN10311.1|  membrane-bound endo-1,4-beta-D-glucanase               124   4e-30   
gb|KJB19224.1|  hypothetical protein B456_003G089600                    127   7e-30   
ref|XP_008238977.1|  PREDICTED: endoglucanase-like                      126   7e-30   
gb|KJB19223.1|  hypothetical protein B456_003G089600                    127   8e-30   
emb|CAN59981.1|  hypothetical protein VITISV_016152                     118   1e-29   
ref|XP_007209103.1|  hypothetical protein PRUPE_ppa005285mg             124   2e-29   
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    124   3e-29   
emb|CDY10895.1|  BnaC01g15100D                                          124   3e-29   
ref|XP_010112623.1|  hypothetical protein L484_006703                   123   6e-29   
ref|XP_009343864.1|  PREDICTED: endoglucanase 20-like                   123   8e-29   
sp|P23666.1|GUN2_PERAE  RecName: Full=Endoglucanase 2; AltName: F...    117   8e-29   
ref|XP_009137168.1|  PREDICTED: endoglucanase 20                        123   8e-29   
ref|XP_009363387.1|  PREDICTED: endoglucanase 20-like                   123   8e-29   
gb|KJB43353.1|  hypothetical protein B456_007G195700                    123   9e-29   
ref|XP_008375959.1|  PREDICTED: endoglucanase 20                        123   9e-29   
ref|XP_006413541.1|  hypothetical protein EUTSA_v10025071mg             122   1e-28   
gb|ABK24648.1|  unknown                                                 123   1e-28   
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    122   1e-28   
gb|KEH24407.1|  glycosyl hydrolase family 9 protein                     118   2e-28   
gb|AFK41115.1|  unknown                                                 116   3e-28   
ref|XP_002509863.1|  endo-1,4-beta-glucanase, putative                  122   3e-28   
ref|XP_008437724.1|  PREDICTED: endoglucanase-like                      121   3e-28   
ref|XP_004510305.1|  PREDICTED: endoglucanase 1-like                    116   4e-28   
ref|XP_007019419.1|  Endo-1,4-beta-glucanase, putative                  122   4e-28   
gb|KFK28905.1|  hypothetical protein AALP_AA7G063600                    120   5e-28   
gb|KDO83647.1|  hypothetical protein CISIN_1g043321mg                   122   5e-28   
emb|CDP12078.1|  unnamed protein product                                120   6e-28   
gb|KDP25211.1|  hypothetical protein JCGZ_20367                         120   6e-28   
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         120   7e-28   
ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    120   8e-28   
ref|XP_010658407.1|  PREDICTED: endoglucanase-like                      120   9e-28   
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         120   9e-28   
ref|XP_010676410.1|  PREDICTED: endoglucanase-like isoform X1           120   1e-27   
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                120   1e-27   
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         120   1e-27   
ref|XP_004170784.1|  PREDICTED: endoglucanase 25-like                   120   2e-27   
ref|XP_004147421.1|  PREDICTED: endoglucanase 25-like                   120   2e-27   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                         119   2e-27   
ref|XP_004511554.1|  PREDICTED: endoglucanase-like                      119   2e-27   
ref|XP_010064810.1|  PREDICTED: endoglucanase 25-like                   120   2e-27   
ref|XP_007158534.1|  hypothetical protein PHAVU_002G160200g             119   2e-27   
ref|XP_009592543.1|  PREDICTED: endoglucanase 17-like                   119   3e-27   
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    119   3e-27   
ref|XP_010676913.1|  PREDICTED: endoglucanase 1-like                    119   3e-27   
ref|XP_006836842.1|  hypothetical protein AMTR_s00099p00070580          118   3e-27   
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                    118   3e-27   
gb|KHG04285.1|  Endoglucanase 1                                         118   4e-27   
gb|AID55372.1|  glycoside hydrolase family 9 B13                        118   4e-27   
pir||JA0174  cellulase (EC 3.2.1.4) - kidney bean (fragment)            112   4e-27   
ref|XP_006285075.1|  hypothetical protein CARUB_v10006388mg             118   4e-27   
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                            118   4e-27   
gb|AGG19097.1|  cellulase                                               117   4e-27   
ref|XP_009788905.1|  PREDICTED: endoglucanase 17-like                   118   5e-27   
ref|NP_194087.1|  glycosyl hydrolase 9B15                               118   5e-27   
ref|XP_007017776.1|  EG isoform 2                                       118   5e-27   
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                   118   5e-27   
sp|P05522.1|GUN1_PERAE  RecName: Full=Endoglucanase 1; AltName: F...    118   6e-27   
emb|CAA52343.1|  cellulase                                              118   6e-27   
ref|XP_002874585.1|  glycosyl hydrolase family 9 protein                117   6e-27   
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             118   6e-27   
ref|XP_010100207.1|  Endoglucanase 1                                    117   6e-27   
gb|KEH27425.1|  endo-1,4-beta-glucanase                                 116   6e-27   
ref|XP_007017775.1|  EG isoform 1                                       118   7e-27   
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        118   7e-27   
ref|XP_010445170.1|  PREDICTED: endoglucanase 20-like                   117   7e-27   
ref|XP_011069683.1|  PREDICTED: endoglucanase 1-like                    117   8e-27   
ref|XP_011029362.1|  PREDICTED: endoglucanase-like                      117   9e-27   
ref|XP_011026977.1|  PREDICTED: endoglucanase                           117   9e-27   
ref|XP_006383615.1|  hypothetical protein POPTR_0005s21090g             118   9e-27   
gb|KHN45917.1|  Endoglucanase 2                                         118   9e-27   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                   117   1e-26   
ref|XP_006286136.1|  hypothetical protein CARUB_v10007690mg             117   1e-26   
ref|NP_849349.1|  glycosyl hydrolase 9B14                               117   1e-26   
emb|CAB39641.1|  cellulase-like protein                                 117   1e-26   
emb|CDP12234.1|  unnamed protein product                                117   1e-26   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    117   1e-26   
ref|XP_008784873.1|  PREDICTED: endoglucanase 1-like                    117   1e-26   
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 117   1e-26   
gb|AAC78504.1|  cellulase                                               117   1e-26   
gb|KJB18957.1|  hypothetical protein B456_003G077300                    117   1e-26   
ref|XP_003611058.1|  Endo-1 4-beta-glucanase                            116   1e-26   
ref|XP_010433888.1|  PREDICTED: endoglucanase 20-like                   116   1e-26   
ref|XP_010906451.1|  PREDICTED: endoglucanase 1-like                    116   2e-26   
gb|KDO76343.1|  hypothetical protein CISIN_1g042201mg                   117   2e-26   
emb|CDP04111.1|  unnamed protein product                                111   2e-26   
ref|XP_006439464.1|  hypothetical protein CICLE_v10023813mg             117   2e-26   
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1         116   2e-26   
ref|XP_010107239.1|  Endoglucanase 7                                    115   2e-26   
ref|XP_006477515.1|  PREDICTED: endoglucanase-like                      117   2e-26   
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2         115   2e-26   
gb|KJB14408.1|  hypothetical protein B456_002G123700                    117   2e-26   
ref|XP_002867700.1|  glycosyl hydrolase family 9 protein                116   2e-26   
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             117   2e-26   
ref|XP_006846589.1|  hypothetical protein AMTR_s00018p00255530          116   2e-26   
gb|EYU17421.1|  hypothetical protein MIMGU_mgv1a002960mg                117   2e-26   
gb|AID55379.1|  glycoside hydrolase family 9 B7                         116   2e-26   
ref|XP_010448686.1|  PREDICTED: endoglucanase 20                        116   2e-26   
gb|AEO97192.1|  endo-1,4-beta-glucanase                                 116   2e-26   
gb|KJB63540.1|  hypothetical protein B456_010G005200                    116   2e-26   
ref|XP_003629333.1|  Endoglucanase                                      116   2e-26   
gb|EYU23421.1|  hypothetical protein MIMGU_mgv1a004581mg                116   2e-26   
ref|XP_002298010.2|  hypothetical protein POPTR_0001s09910g             116   2e-26   
dbj|BAA06877.1|  cellulase precursor                                    116   2e-26   
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   116   3e-26   
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         116   3e-26   
gb|AFZ78635.1|  korrigan                                                115   3e-26   
gb|AFZ78642.1|  korrigan                                                116   3e-26   
ref|XP_003611057.1|  Endo-1 4-beta-glucanase                            115   3e-26   
gb|ABY58175.1|  endo-1,4-D-glucanase                                    113   3e-26   
gb|KEH27424.1|  endo-1,4-beta-glucanase                                 115   3e-26   
ref|XP_002975128.1|  hypothetical protein SELMODRAFT_415162             115   3e-26   
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    116   3e-26   
dbj|BAA77239.1|  endo-1,4-beta glucanase                                115   3e-26   
gb|KHN00484.1|  Endoglucanase 24                                        115   3e-26   
ref|XP_010113364.1|  Endoglucanase 24                                   116   3e-26   
ref|XP_002977531.1|  hypothetical protein SELMODRAFT_417347             115   3e-26   
ref|XP_009103215.1|  PREDICTED: endoglucanase 3                         115   4e-26   
emb|CDY25758.1|  BnaA07g10240D                                          115   4e-26   
ref|XP_011026779.1|  PREDICTED: endoglucanase CX-like                   115   4e-26   
emb|CDY29381.1|  BnaA06g14150D                                          116   4e-26   
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  115   4e-26   
gb|KHN07637.1|  Endoglucanase 1                                         115   4e-26   
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   116   4e-26   
ref|XP_004502058.1|  PREDICTED: endoglucanase 1-like                    115   4e-26   
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    115   4e-26   
ref|XP_003552557.1|  PREDICTED: endoglucanase 1                         115   5e-26   
gb|ABD62082.1|  endo-1,4-beta-glucancase precursor                      115   5e-26   
ref|XP_009101910.1|  PREDICTED: endoglucanase 23-like                   115   5e-26   
ref|XP_010457267.1|  PREDICTED: endoglucanase 1-like                    110   5e-26   
ref|XP_003521576.1|  PREDICTED: endoglucanase 17                        115   5e-26   
ref|XP_001763275.1|  predicted protein                                  115   5e-26   
gb|KHF97947.1|  hypothetical protein F383_10892                         115   5e-26   
ref|XP_004495939.1|  PREDICTED: endoglucanase 17-like                   115   6e-26   
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   115   6e-26   
ref|XP_007209935.1|  hypothetical protein PRUPE_ppa004653mg             115   6e-26   
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   115   6e-26   
gb|ABY58176.1|  endo-1,4-D-glucanase                                    112   6e-26   
ref|XP_009595307.1|  PREDICTED: endoglucanase 18-like                   115   6e-26   
ref|XP_010054772.1|  PREDICTED: endoglucanase-like                      115   6e-26   
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    115   6e-26   
gb|AID55377.1|  glycoside hydrolase family 9 B5                         115   6e-26   
gb|ADU15552.1|  EG                                                      115   6e-26   
ref|XP_007163509.1|  hypothetical protein PHAVU_001G239900g             115   6e-26   
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   115   7e-26   
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    115   7e-26   
gb|KJB58121.1|  hypothetical protein B456_009G195400                    114   7e-26   
ref|XP_003603741.1|  Endoglucanase                                      115   7e-26   
ref|XP_003538279.1|  PREDICTED: endoglucanase                           115   7e-26   
ref|XP_002299423.1|  hypothetical protein POPTR_0001s11430g             114   7e-26   
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    115   7e-26   
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    115   8e-26   
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     115   8e-26   
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     115   8e-26   
ref|XP_008239259.1|  PREDICTED: endoglucanase CX                        114   8e-26   
ref|XP_009393121.1|  PREDICTED: endoglucanase 1-like                    114   8e-26   
gb|ABY58190.1|  endo-1,4-D-glucanase                                    112   8e-26   
dbj|BAB39482.1|  endo-1,4-beta glucanase                                114   9e-26   
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   115   9e-26   
ref|XP_004292399.2|  PREDICTED: endoglucanase 9-like                    114   9e-26   
ref|XP_010541211.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    114   9e-26   
gb|ABY58189.1|  endo-1,4-D-glucanase                                    112   9e-26   
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                114   9e-26   
gb|ABY58177.1|  endo-1,4-D-glucanase                                    112   9e-26   
gb|AAA20082.1|  CMCase; cellulase; endo-1,4-beta-D-glucanase            112   9e-26   
ref|XP_009764272.1|  PREDICTED: endoglucanase 18-like                   114   9e-26   
dbj|BAF42037.1|  cellulase2                                             115   1e-25   
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         114   1e-25   
ref|XP_002523114.1|  endo-1,4-beta-glucanase, putative                  114   1e-25   
gb|KCW77471.1|  hypothetical protein EUGRSUZ_D01810                     114   1e-25   
ref|XP_007046716.1|  EG                                                 115   1e-25   
gb|KJB58119.1|  hypothetical protein B456_009G195400                    114   1e-25   
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        114   1e-25   
gb|AGC94751.1|  endoglucanase-1,4-beta glucanase 6                      114   1e-25   
gb|KDP28191.1|  hypothetical protein JCGZ_13962                         114   1e-25   
emb|CDY01915.1|  BnaC02g28120D                                          113   1e-25   
ref|XP_006385809.1|  hypothetical protein POPTR_0003s14740g             114   1e-25   
ref|XP_007039376.1|  Endoglucanase 1                                    114   1e-25   
emb|CDY44194.1|  BnaC05g15510D                                          117   1e-25   
ref|XP_006843371.1|  hypothetical protein AMTR_s00053p00085940          114   1e-25   
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             114   1e-25   
ref|XP_010112045.1|  Endoglucanase 9                                    114   1e-25   
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   114   1e-25   
gb|ABK96199.1|  unknown                                                 112   1e-25   
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             114   1e-25   
emb|CDP07412.1|  unnamed protein product                                114   1e-25   



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   241 bits (616),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D LR FA +QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  76   LDAADTPGWYCGPNFYSTDKLREFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  135

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPK KV+YNCKGGWKWRD+ KPNPNILVGAMVAGPD HDGFHDVR+NYNYTEPTLAGNAG
Sbjct  136  IPKTKVKYNCKGGWKWRDTSKPNPNILVGAMVAGPDRHDGFHDVRSNYNYTEPTLAGNAG  195

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNT+FSAV
Sbjct  196  LVAALVALSGDKSIPIDKNTLFSAV  220



>gb|AID55380.1| glycoside hydrolase family 9 A2 [Gossypium hirsutum]
Length=621

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++Q+DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  461  LDAADTPGWYCGPNFYSTDVLREFAKTQMDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRDSKKPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  521  IPKNKIRYNCKGGWKWRDSKKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ST IDKNTIFSAV
Sbjct  581  LVAALVALSGDKSTGIDKNTIFSAV  605



>gb|KJB70736.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=621

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++Q+DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  461  LDAADTPGWYCGPNFYSTDVLREFAKTQMDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRDSKKPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  521  IPKNKIRYNCKGGWKWRDSKKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ST IDKNTIFSAV
Sbjct  581  LVAALVALSGDKSTGIDKNTIFSAV  605



>gb|ADB82903.1| membrane-bound endo-beta-1,4-glucanase [Populus alba x Populus 
grandidentata]
Length=619

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LGAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  519  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDGHDGFHDVRTNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>gb|AAZ08322.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=456

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FYS D+LR+FA+ QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  296  LDAADTPGWYCGPTFYSTDVLRDFAKRQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  355

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  356  IPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  415

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ S +IDKNTIFSAV
Sbjct  416  LVAALVALSGDGSAKIDKNTIFSAV  440



>gb|AHA41508.1| endo-1,4 -beta-glucanase [Populus deltoides]
Length=619

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  519  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_006385837.1| endo-1 family protein [Populus trichocarpa]
 gb|ERP63634.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  519  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_007147545.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
 gb|ESW19539.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
Length=619

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LRNFA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFFSTDVLRNFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS KPNPN LVGAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSSKPNPNTLVGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ST IDKNTIFSAV
Sbjct  579  LVAALVALSGDKSTSIDKNTIFSAV  603



>gb|AAT75041.1| Cel9A [Populus tremula x Populus tremuloides]
Length=619

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  519  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>gb|AAS45400.1| endo-1,4-beta-glucanase [Populus tremuloides]
Length=619

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  519  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>gb|KDP32467.1| hypothetical protein JCGZ_13392 [Jatropha curcas]
Length=620

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S ++LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  460  LDAADTPGWYCGPNFFSTNVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRDSKKPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  520  IPKNKIKYNCKGGWKWRDSKKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++TRIDKNTIFSAV
Sbjct  580  LVAALVALSGDKTTRIDKNTIFSAV  604



>emb|CBI29606.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA++QIDYILGKNPRKMSY+ GFGNHYP+HVHHRGAS
Sbjct  341  LEAADTPGWYCGPNFYSTEVLREFAKTQIDYILGKNPRKMSYIAGFGNHYPRHVHHRGAS  400

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRDS KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  401  IPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  460

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  461  LVAALVALSGDKTTGIDKNTIFSAV  485



>ref|XP_011022354.1| PREDICTED: endoglucanase 25-like [Populus euphratica]
Length=619

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKVRYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVR+NYNYTEPT+AGNAG
Sbjct  519  IPKNKVRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRSNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_002299405.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE84210.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAG
Sbjct  519  IPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTIFSAV  603



>ref|XP_004238641.1| PREDICTED: endoglucanase 25-like [Solanum lycopersicum]
Length=616

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  456  LAAADTPGWYCGPNFYSTDVLREFAQTQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            +PKNKV+YNCKGGWKWRDS KPNPNILVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAG
Sbjct  516  VPKNKVKYNCKGGWKWRDSSKPNPNILVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAG  575

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNTIFSAV
Sbjct  576  LVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_003546229.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=618

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LRNFA++QIDYILG NPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPNFFSTDVLRNFAKTQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  IPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ST IDKNTIFSAV
Sbjct  578  LVAALVALSGDKSTSIDKNTIFSAV  602



>gb|KHN14382.1| Endoglucanase 25 [Glycine soja]
Length=652

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LRNFA++QIDYILG NPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  492  LDAADTPGWYCGPNFFSTDVLRNFAKTQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGAS  551

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  552  IPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  611

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ST IDKNTIFSAV
Sbjct  612  LVAALVALSGDKSTSIDKNTIFSAV  636



>gb|ADY68794.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATVIDKNTIFSAV  603



>ref|XP_010065200.1| PREDICTED: endoglucanase 25-like [Eucalyptus grandis]
 gb|KCW62542.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=623

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FYS D+LR+FA+ QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  463  LDAADTPGWYCGPTFYSTDVLRDFAKRQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ S +IDKNTIFSAV
Sbjct  583  LVAALVALSGDGSAKIDKNTIFSAV  607



>gb|AAS87601.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68790.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70799.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70801.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70805.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70807.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATVIDKNTIFSAV  603



>gb|ADY68792.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium herbaceum 
subsp. africanum]
Length=619

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATVIDKNTIFSAV  603



>gb|AEN70816.1| endo-1,4-beta-glucanase [Gossypium gossypioides]
Length=619

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATGIDKNTIFSAV  603



>gb|AEN70798.1| endo-1,4-beta-glucanase [Gossypium turneri]
 gb|AEN70811.1| endo-1,4-beta-glucanase [Gossypium armourianum]
 gb|AEN70812.1| endo-1,4-beta-glucanase [Gossypium harknessii]
Length=619

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATGIDKNTIFSAV  603



>gb|KJB66548.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=618

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  518  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  578  LVAALVALSGDKATGIDKNTIFSAV  602



>gb|AAQ08018.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68793.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium raimondii]
 gb|ADY68795.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|AEN70795.1| endo-1,4-beta-glucanase [Gossypium thurberi]
 gb|AEN70796.1| endo-1,4-beta-glucanase [Gossypium laxum]
 gb|AEN70800.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70813.1| endo-1,4-beta-glucanase [Gossypium davidsonii]
 gb|AEN70814.1| endo-1,4-beta-glucanase [Gossypium klotzschianum]
 gb|AEN70815.1| endo-1,4-beta-glucanase [Gossypium aridum]
 gb|AEN70817.1| endo-1,4-beta-glucanase [Gossypium lobatum]
 gb|AEN70818.1| endo-1,4-beta-glucanase [Gossypium trilobum]
 gb|AID55374.1| glycoside hydrolase family 9 A1 [Gossypium hirsutum]
 gb|KJB66547.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=619

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATGIDKNTIFSAV  603



>gb|AEN70810.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNKLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATVIDKNTIFSAV  603



>gb|AEN70809.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNKLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATVIDKNTIFSAV  603



>ref|XP_009600540.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=617

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FAE+QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  457  LEAADTPGWYCGPNFYSTDVLRRFAETQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS K NPNI+VGAMVAGPD HDGFHDVR+NYNYTEPTLAGNAG
Sbjct  517  IPKNKVKYNCKGGWKWRDSSKANPNIIVGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+R   +DKNTIFSAV
Sbjct  577  LVAALVALSGDRDVGVDKNTIFSAV  601



>gb|AAP83128.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDTADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATVIDKNTIFSAV  603



>ref|XP_002519394.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF43011.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=621

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS  +LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  461  LEAADTPGWYCGPDFYSTKVLRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  521  IPKNKIKYNCKGGWKWRDTSKPNPNTIVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ +T+IDKNTIFSAV
Sbjct  581  LVAALVALSGDGTTKIDKNTIFSAV  605



>gb|ADY68791.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70802.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70803.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70804.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70806.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70808.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRK+SYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKLSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATGIDKNTIFSAV  603



>ref|XP_006356407.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=616

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGP+FYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  456  LAAADTPGWYCGPHFYSTDVLREFAQTQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            +PKNKV+YNCKGGWKWRDS KPNPN LVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAG
Sbjct  516  VPKNKVKYNCKGGWKWRDSSKPNPNTLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAG  575

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNTIFSAV
Sbjct  576  LVAALVALSGDKSVGIDKNTIFSAV  600



>gb|ABD62083.1| endo-1,4-beta-glucancase precursor [Glycine max]
Length=604

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LR+FA+SQIDYILG NPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPNFFSTDVLRSFAKSQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            +PKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  VPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ T IDKNTIFSAV
Sbjct  578  LVAALVALSGDKGTSIDKNTIFSAV  602



>gb|AFY03622.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=623

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FYS D+LR+FA+ QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  463  LDAADTPGWYCGPTFYSTDVLRDFAKRQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+   +IDKNTIFSAV
Sbjct  583  LVAALVALSGDGXAKIDKNTIFSAV  607



>ref|XP_003535026.1| PREDICTED: endoglucanase 25 [Glycine max]
 gb|KHN40745.1| Endoglucanase 25 [Glycine soja]
Length=618

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LR+FA+SQIDYILG NPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPNFFSTDVLRSFAKSQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            +PKNK++Y+CKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  VPKNKIKYSCKGGWKWRDTSKPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++ T IDKNTIFSAV
Sbjct  578  LVAALVALSGDKGTSIDKNTIFSAV  602



>gb|AEN70797.1| endo-1,4-beta-glucanase [Gossypium schwendimanii]
Length=619

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HD F DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDAFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  579  LVAALVALSGDKATGIDKNTIFSAV  603



>gb|KDO53876.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=441

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D LR FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  280  LDAADTPGWYCGPNFFSTDTLREFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  339

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWK RDS KPNPN LVGA+VAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  340  IPKNKIRYNCKGGWKLRDSSKPNPNTLVGALVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  399

Query  394  lvaalvaLSGERS-TRIDKNTIFSAV  320
            LVAALVALSGE+S T IDKNTIFSAV
Sbjct  400  LVAALVALSGEKSRTTIDKNTIFSAV  425



>gb|AGV22123.1| endo-1,4-beta-glucanase 1 [Betula luminifera]
Length=618

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA +QIDYILGKNPRKMSYVVGFGNHYP+HVHHRGAS
Sbjct  458  LDAADTPGWYCGPNFYSTEVLREFARTQIDYILGKNPRKMSYVVGFGNHYPRHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRDS  PNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  IPKNKIKYNCKGGWKWRDSSNPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ +T IDKNTIFSAV
Sbjct  578  LVAALVALSGDSTTGIDKNTIFSAV  602



>ref|XP_003529689.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFFSTDVLRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGPD HD FHDVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGPDKHDHFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNT+FSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTLFSAV  603



>emb|CDP17765.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGPNFYS D+LR FAESQIDYILGKNPRKMSYVVGFGNHYP+ VHHRGAS
Sbjct  456  LAAADTPGWYCGPNFYSTDVLRQFAESQIDYILGKNPRKMSYVVGFGNHYPRRVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWK RDS+ PNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAG
Sbjct  516  IPKNKIKYNCKGGWKLRDSRNPNPNTLVGAMVAGPDKFDGFHDVRTNYNYTEPTLAGNAG  575

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  +DKNTIFSAV
Sbjct  576  LVAALVALSGEKSVGVDKNTIFSAV  600



>gb|AIE16186.1| endo-1,4-beta-glucanase [Nicotiana tabacum]
Length=617

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FAE+QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  457  LEAADTPGWYCGPNFYSTDVLRRFAETQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS K NPNI+VGAMVAGPD HDGFHD R+NYNYTEPTLAGNAG
Sbjct  517  IPKNKVKYNCKGGWKWRDSSKANPNIIVGAMVAGPDKHDGFHDARSNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+R   +DKNTIFSAV
Sbjct  577  LVAALVALSGDRDVGVDKNTIFSAV  601



>ref|XP_003550680.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFFSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGPD HD FHDVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGPDKHDHFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNT+FSAV
Sbjct  579  LVAALVALSGDKTTGIDKNTLFSAV  603



>ref|XP_004171003.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Cucumis 
sativus]
Length=622

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 137/148 (93%), Gaps = 3/148 (2%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTEVLRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDTTKPNPNTLVGAMVAGPDKRDGFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSG---ERSTRIDKNTIFSAV  320
            LVAALVALSG   E++T IDKNTIFSAV
Sbjct  579  LVAALVALSGENSEKATGIDKNTIFSAV  606



>ref|XP_004133745.1| PREDICTED: endoglucanase 25-like [Cucumis sativus]
 gb|KGN56301.1| hypothetical protein Csa_3G113920 [Cucumis sativus]
Length=622

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 137/148 (93%), Gaps = 3/148 (2%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTEVLRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDTTKPNPNTLVGAMVAGPDKRDGFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSG---ERSTRIDKNTIFSAV  320
            LVAALVALSG   E++T IDKNTIFSAV
Sbjct  579  LVAALVALSGENSEKATGIDKNTIFSAV  606



>ref|XP_010088712.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36893.1| Endoglucanase 25 [Morus notabilis]
Length=622

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QI+YILG NPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  462  LEAADTPGWYCGPNFYSTDVLRDFAKTQINYILGNNPRKMSYIVGFGNHYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGW WRD+K PNPN++VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYNCKGGWHWRDTKNPNPNVIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL+ALSGE++  IDKNTIFSAV
Sbjct  582  LVAALIALSGEKNAGIDKNTIFSAV  606



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA++QIDYILGKNPRKMSY+ GFGNHYP+HVHHRGAS
Sbjct  458  LEAADTPGWYCGPNFYSTEVLREFAKTQIDYILGKNPRKMSYIAGFGNHYPRHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRDS KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  IPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  578  LVAALVALSGDKTTGIDKNTIFSAV  602



>ref|XP_010533226.1| PREDICTED: endoglucanase 25 [Tarenaya hassleriana]
Length=622

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA SQIDY+LGKNPRKMSYVVGFG+ YPKHVHHRGAS
Sbjct  461  LDAADTPGWYCGPNFYSTDVLREFARSQIDYVLGKNPRKMSYVVGFGDRYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRDSKKPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  521  IPKNKIRYNCKGGWKWRDSKKPNPNTVVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGER-STRIDKNTIFSAV  320
            LVAALVALSG++ S  IDKNTIFSAV
Sbjct  581  LVAALVALSGDKDSGSIDKNTIFSAV  606



>gb|AFD33696.1| korrigan [Eucalyptus camaldulensis]
Length=623

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FYS D+LR+FA+ QIDYILGKNPRKMSY+VGFGNHYP+ VHHRGAS
Sbjct  463  LDAADTPGWYCGPTFYSTDVLRDFAKRQIDYILGKNPRKMSYIVGFGNHYPRRVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNKVKYNCKGGWKWRDTSKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ S +IDKNTIFSAV
Sbjct  583  LVAALVALSGDGSAKIDKNTIFSAV  607



>ref|XP_007154086.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
 gb|ESW26080.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
Length=620

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHR AS
Sbjct  460  LDAADTPGWYCGPNFFSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRAAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNP+ +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  520  IPKNKIKYNCKGGWKWRDTSKPNPHTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S+ IDKNT+FSAV
Sbjct  580  LVAALVALSGDKSSGIDKNTLFSAV  604



>ref|NP_001284449.1| endoglucanase 25-like [Cucumis melo]
 dbj|BAF30815.1| endoglucanase [Cucumis melo]
Length=622

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 137/148 (93%), Gaps = 3/148 (2%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTEVLRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYNCKGGWKWRDTTKPNPNTLVGAMVAGPDRRDGFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSG---ERSTRIDKNTIFSAV  320
            LVAALVALSG   E++T IDKNTIFSAV
Sbjct  579  LVAALVALSGENSEKATGIDKNTIFSAV  606



>ref|XP_009770880.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=619

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR FAE+QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTAVLRRFAETQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS K NPNI+VGAMVAGPD HDGFHDVR+NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSSKANPNIIVGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+R   +DKNTIFSAV
Sbjct  579  LVAALVALSGDRDIGVDKNTIFSAV  603



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  460  LEAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKVRYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAG
Sbjct  520  IPKNKVRYNCKGGWKWRDTTKPNPNSLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSA  323
            LVAALVA SG+++T IDKNTIFSA
Sbjct  580  LVAALVASSGDKTTGIDKNTIFSA  603



>ref|XP_006358489.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=617

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGPNFYS D+LR FAE+QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  457  LAAADTPGWYCGPNFYSTDVLRKFAETQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWK+RDS K NPN +VGAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  517  IPKNKVKYNCKGGWKYRDSSKANPNTIVGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+R   IDKNT+FSAV
Sbjct  577  LVAALVALSGDRDVGIDKNTLFSAV  601



>ref|XP_011088109.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=596

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AAD PGWYCGP+FYS D+LR FA++QI+YILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  436  MKAADTPGWYCGPHFYSADVLREFAQTQINYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  495

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  496  IPKNKVKYNCKGGWKWRDSSKPNPNTIVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAG  555

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ S  IDKNTIFSAV
Sbjct  556  LVAALVALSGDSSVGIDKNTIFSAV  580



>ref|NP_001233943.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
 gb|AAC49704.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
Length=617

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGPNFYS D+LR FAE+QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  457  LAAADTPGWYCGPNFYSTDVLRKFAETQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWK+RDS K NPN +VGAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  517  IPKNKVKYNCKGGWKYRDSSKANPNTIVGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+R   IDKNT+FSAV
Sbjct  577  LVAALVALSGDRDVGIDKNTLFSAV  601



>ref|XP_004486415.1| PREDICTED: endoglucanase 25-like [Cicer arietinum]
Length=620

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S ++LR FA++QIDYILGKNPRKMSY+VGFGN+YPKHVHHRGAS
Sbjct  460  LDAADTPGWYCGPNFFSTNVLREFAKTQIDYILGKNPRKMSYIVGFGNNYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVR NYNYTEPTLAGNAG
Sbjct  520  IPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPDRHDGFHDVRMNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+RS  IDKNT+FSAV
Sbjct  580  LVAALVALSGDRSIPIDKNTLFSAV  604



>ref|XP_006431347.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 ref|XP_006470776.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
 gb|ESR44587.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 gb|KDO53874.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=621

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D LR FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  460  LDAADTPGWYCGPNFFSTDTLREFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWK RDS KPNPN LVGA+VAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  520  IPKNKIRYNCKGGWKLRDSSKPNPNTLVGALVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERS-TRIDKNTIFSAV  320
            LVAALVALSGE+S T IDKNTIFSAV
Sbjct  580  LVAALVALSGEKSRTTIDKNTIFSAV  605



>gb|KDO53875.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=620

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D LR FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFFSTDTLREFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWK RDS KPNPN LVGA+VAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIRYNCKGGWKLRDSSKPNPNTLVGALVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERS-TRIDKNTIFSAV  320
            LVAALVALSGE+S T IDKNTIFSAV
Sbjct  579  LVAALVALSGEKSRTTIDKNTIFSAV  604



>ref|XP_011092233.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=617

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AAD PGWYCGP+FYS D+LR FA++Q++YILGKNPRKMSYVVGFGNHYPK VHHRGAS
Sbjct  457  MKAADTPGWYCGPHFYSADVLREFAQTQMNYILGKNPRKMSYVVGFGNHYPKRVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            +PKNKV+YNCKGGWKWRD+ KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  517  VPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+ S  IDKNTIFSAV
Sbjct  577  LVAALVALSGDTSMTIDKNTIFSAV  601



>ref|XP_003594425.1| Endoglucanase [Medicago truncatula]
 gb|ABD32918.1| Glycoside transferase, six-hairpin, subgroup [Medicago truncatula]
 gb|AES64676.1| membrane-anchored endo-1,4-beta-glucanase [Medicago truncatula]
Length=622

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S + LR FA +QIDYILGKNPRKMSYVVGFGNHYPKHVHHR AS
Sbjct  462  LDAADTPGWYCGPNFFSTEKLREFARTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRAAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWR+S KPNPNILVGAMVAGPD HDGFHDVR NYNYTEPTLAGNAG
Sbjct  522  IPKNKVKYNCKGGWKWRESSKPNPNILVGAMVAGPDRHDGFHDVRKNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNT+FSAV
Sbjct  582  LVAALVALSGDKSIPIDKNTLFSAV  606



>ref|XP_009765308.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=616

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGPNFYS D+LR FA++QI+YILGKNPRKMSYVVGFGN YPK VHHRGAS
Sbjct  456  LAAADTPGWYCGPNFYSTDVLREFAQTQINYILGKNPRKMSYVVGFGNRYPKRVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS K NPN LVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAG
Sbjct  516  IPKNKVKYNCKGGWKWRDSSKNNPNTLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAG  575

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNTIFSAV
Sbjct  576  LVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_009595607.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=616

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            LAAAD PGWYCGPNFYS D+LR FA++QI+YILGKNPRKMSYVVGFGN YPK VHHRGAS
Sbjct  456  LAAADTPGWYCGPNFYSTDVLREFAQTQINYILGKNPRKMSYVVGFGNRYPKRVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDS K NPN LVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAG
Sbjct  516  IPKNKVKYNCKGGWKWRDSSKNNPNTLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAG  575

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNTIFSAV
Sbjct  576  LVAALVALSGDKSVGIDKNTIFSAV  600



>ref|XP_008339246.1| PREDICTED: endoglucanase 25-like [Malus domestica]
Length=622

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  462  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYNCKGGWKWRDTPKANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSAV
Sbjct  582  LVAALVALSGEKSVGIDKNTIFSAV  606



>ref|XP_008347974.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 13, partial 
[Malus domestica]
Length=629

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  34   LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  93

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  94   IPKNKIKYSCKGGWKWRDTSKANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  153

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSAV
Sbjct  154  LVAALVALSGEKSVGIDKNTIFSAV  178



>ref|XP_010521418.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=620

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFG+ YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGDRYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKVRYNCKGGWKWRDSK PNPN +VGAMVAGPD  DGFHD+RTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVRYNCKGGWKWRDSKNPNPNTIVGAMVAGPDKRDGFHDIRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER-STRIDKNTIFSAV  320
            LVAALVALSG++ S  IDKNTIFSAV
Sbjct  579  LVAALVALSGDKDSGSIDKNTIFSAV  604



>dbj|BAC22690.1| endo-1,4-beta-D-glucanase [Pyrus communis]
Length=621

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  461  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  521  IPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSAV
Sbjct  581  LVAALVALSGEKSVGIDKNTIFSAV  605



>dbj|BAD95336.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=256

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGAS
Sbjct  94   LDAADTPGWYCGPNFYSTSVLRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGAS  153

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAG
Sbjct  154  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAG  213

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  214  LVAALVALSGEEEATGKIDKNTIFSAV  240



>ref|XP_009340771.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Pyrus 
x bretschneideri]
Length=619

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEKSVGIDKNTIFSAV  603



>dbj|BAF42036.1| cellulase1 [Pyrus communis]
Length=622

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  462  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSAV
Sbjct  582  LVAALVALSGEKSVGIDKNTIFSAV  606



>ref|XP_010682188.1| PREDICTED: endoglucanase 25 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+D PGW CGPNFY+ D+LR FA +QIDYILGKNPRKMSY+VGFG HYPKHVHHRGAS
Sbjct  459  LEASDTPGWTCGPNFYTTDVLRRFARTQIDYILGKNPRKMSYLVGFGKHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+KKPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYSCKGGWKWRDTKKPNPNTIVGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG++S  IDKNT+FSAV
Sbjct  579  LVAALVALSGDKSVGIDKNTMFSAV  603



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   240 bits (613),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILGKNPRKMSY+VGFGNHYP+HVHHRGAS
Sbjct  437  LDAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGKNPRKMSYIVGFGNHYPRHVHHRGAS  496

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPT  413
            IPKNK++YNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT
Sbjct  497  IPKNKIKYNCKGGWKWRDTTKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPT  550



>ref|XP_007222007.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
 gb|EMJ23206.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
Length=622

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNP+KMSYVVGFGN YPKHVHHRGAS
Sbjct  462  LEAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPQKMSYVVGFGNRYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ K NPN L GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYNCKGGWKWRDTSKANPNTLDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE++  IDKNTIFSAV
Sbjct  582  LVAALVALSGEKNIGIDKNTIFSAV  606



>ref|XP_008379019.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Malus domestica]
Length=1066

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  462  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYSCKGGWKWRDTSKANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSAV
Sbjct  582  LVAALVALSGEKSVGIDKNTIFSAV  606



>ref|XP_010909007.1| PREDICTED: endoglucanase 10-like [Elaeis guineensis]
Length=617

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DILRNFA++QIDYILG NP+KMSYVVG+G  YPKHVHHRGAS
Sbjct  458  LEAADTPGWYCGPNFYSTDILRNFAKTQIDYILGNNPQKMSYVVGYGKRYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN VRY+CKGGWKWRD+K+PNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  IPKNGVRYSCKGGWKWRDTKRPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LV ALV+LSG + T +DKNTIFSAV
Sbjct  578  LVFALVSLSGVK-TGVDKNTIFSAV  601



>ref|XP_008803421.1| PREDICTED: endoglucanase 10-like [Phoenix dactylifera]
Length=617

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DILRNFA++QIDYILG NP+KMSYVVG+G  YPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPNFYSTDILRNFAKTQIDYILGNNPQKMSYVVGYGKRYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN VRY+CKGGWKWRD+K+PNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  IPKNGVRYSCKGGWKWRDTKRPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LV ALV+LSG + T +DKNTIFSAV
Sbjct  578  LVFALVSLSGVK-TGVDKNTIFSAV  601



>ref|XP_010266669.1| PREDICTED: endoglucanase 9-like [Nelumbo nucifera]
Length=619

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S D+LR+FA +QI+YILGKNP+KMSYVVGFGN YPKHVHHRGAS
Sbjct  460  LDAADTPGWYCGPNFFSTDVLRDFARTQINYILGKNPQKMSYVVGFGNRYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN+++YNCKGGWKWRD+ KPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  520  IPKNRIKYNCKGGWKWRDTPKPNPNTIVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+ T IDKNTIFSAV
Sbjct  580  LVAALVALSGEK-TGIDKNTIFSAV  603



>ref|XP_010533225.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AA  PGW+CGPNFYS D+LR FA SQIDYILGKNPRKMSYVVGFG  YP+ VHHRGAS
Sbjct  462  LDAAGTPGWFCGPNFYSTDVLREFARSQIDYILGKNPRKMSYVVGFGERYPRRVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK RYNC+GGWKWRDSKKPNPN +VGAMVAGPD HDGFHDVRTNY+YTEPTLAGNAG
Sbjct  522  IPKNKTRYNCRGGWKWRDSKKPNPNTIVGAMVAGPDKHDGFHDVRTNYSYTEPTLAGNAG  581

Query  394  lvaalvaLSGER-STRIDKNTIFSAV  320
            LVAALVALSG+R S  IDKNTIFSA+
Sbjct  582  LVAALVALSGDRGSGSIDKNTIFSAL  607



>ref|XP_006281810.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
 gb|EOA14708.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
Length=621

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA SQIDYILGKNPRKMSY+VG+G  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLRDFARSQIDYILGKNPRKMSYLVGYGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD HDGF DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKHDGFRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAAL+ALSGE     +IDKNTIFSAV
Sbjct  579  LVAALIALSGEEEATGKIDKNTIFSAV  605



>ref|XP_010482263.1| PREDICTED: endoglucanase 25-like [Camelina sativa]
Length=621

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA SQIDYILGKNPRKMSYVVGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLRDFARSQIDYILGKNPRKMSYVVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_008218604.1| PREDICTED: endoglucanase 25 [Prunus mume]
Length=1109

 Score =   234 bits (598),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNP+KMSYVVGFGN YPKHVHHRGAS
Sbjct  462  LEAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPQKMSYVVGFGNRYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRD+ K NPN L GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYNCKGGWKWRDTSKANPNTLDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSA  323
            LVAALVALSGE++  IDKNTIFSA
Sbjct  582  LVAALVALSGEKNIGIDKNTIFSA  605



>emb|CAB51903.1| cellulase [Brassica napus]
Length=621

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA +QIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLREFARTQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>emb|CDX83181.1| BnaA03g23250D [Brassica napus]
Length=621

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA +QIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLREFARTQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>gb|AEO97184.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97211.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97239.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97240.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97241.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97243.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97244.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97245.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97247.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97248.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97250.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97251.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97254.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97256.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97258.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97259.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97263.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97266.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97269.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97270.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97272.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>ref|XP_010442441.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLRDFARSQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_010441020.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR+FA SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLRDFARSQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>gb|AEO97252.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97267.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97238.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>ref|XP_009355455.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Pyrus x bretschneideri]
Length=1064

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR FA++QIDYILGKNP+KMSY+VGFGN YPKHVHHRGAS
Sbjct  462  LDAADTPGWYCGPNFYSTDVLREFAKTQIDYILGKNPKKMSYIVGFGNQYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAG
Sbjct  522  IPKNKIKYSCKGGWKWRDTSKANPNTINGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  IDKNTIFSA+
Sbjct  582  LVAALVALSGEKSVGIDKNTIFSAI  606



>gb|AEO97265.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AEO97182.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97209.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97236.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97237.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97242.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97246.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97249.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97253.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97255.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97257.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97260.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97261.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97262.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97264.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97268.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97271.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97273.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97274.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78626.1| korrigan [Populus tomentosa]
Length=610

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSY+VGFGNHYPKH+HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYIVGFGNHYPKHLHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>ref|XP_009399913.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=691

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+    LR+FA +QIDYILGKNP+KMSYVVGFG  YPKHVHHRGAS
Sbjct  532  LEAADTPGWYCGPNFFPTGALRDFARTQIDYILGKNPKKMSYVVGFGQRYPKHVHHRGAS  591

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+YNCKGGWKWRD+KKPNPN ++GAMVAGPD HDGFHD+RTNYNYTEPTLAGNAG
Sbjct  592  IPKNGVKYNCKGGWKWRDTKKPNPNTIIGAMVAGPDKHDGFHDIRTNYNYTEPTLAGNAG  651

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE ST +DKNTIFSAV
Sbjct  652  LVAALVALSGE-STGVDKNTIFSAV  675



>ref|XP_009134026.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA +QIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLREFARTQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDRRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_010938102.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA +QIDYILGKNP KMSYVVGFGNHYPKHVHHRGAS
Sbjct  463  LDAADTPGWYCGPNFYSTGVLRDFARTQIDYILGKNPHKMSYVVGFGNHYPKHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN VRY+CKGGWKWRD+KKPNP+ + GAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNGVRYSCKGGWKWRDTKKPNPHTIAGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE++  +DKNTIFSAV
Sbjct  583  LVAALVALSGEKNG-VDKNTIFSAV  606



>ref|XP_002865753.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42012.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFARSQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEAEATGKIDKNTIFSAV  605



>ref|XP_010921267.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LRNFA++QIDY+LGKNPRKMSYVVGFGN YPKHVHHR AS
Sbjct  463  LDAADTPGWYCGPNFYSTGVLRNFAQTQIDYVLGKNPRKMSYVVGFGNRYPKHVHHRAAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+Y+CKGGWKWRD+KKPNP+ +VGAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNGVKYSCKGGWKWRDTKKPNPHTIVGAMVAGPDRRDGFRDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+S  +DKNTIFSAV
Sbjct  583  LVAALVALSGEKSG-VDKNTIFSAV  606



>ref|XP_009123553.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+F+ SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFSRSQIDYILGKNPRKMSYLVGFGPKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>gb|AEO97283.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97288.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97291.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97292.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97294.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97297.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97299.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97300.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97302.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97303.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97305.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97306.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97308.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97309.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97310.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 128/145 (88%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AAM63370.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=621

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>gb|AEO97183.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97210.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97275.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97276.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97277.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97278.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97279.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97280.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97281.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97282.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97284.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97285.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97286.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97287.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97289.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97290.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97293.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97295.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97296.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97298.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97301.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97304.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97307.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97311.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97312.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97313.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78627.1| korrigan [Populus tomentosa]
Length=610

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 128/145 (88%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>emb|CDY37768.1| BnaA10g05530D [Brassica napus]
Length=621

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+F+ SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFSRSQIDYILGKNPRKMSYLVGFGPKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>emb|CDX71601.1| BnaC09g26420D [Brassica napus]
Length=621

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+F+ SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFSRSQIDYILGKNPRKMSYLVGFGPKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_006858422.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
 gb|ERN19889.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
Length=617

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP F+S D+LRNFA +QIDYILGKNPRKMSY+VGFGNHYPKHVHHR AS
Sbjct  458  LDAADTPGWYCGPTFFSKDVLRNFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRAAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRD+ KP+PN LVGAMVAGPD HDGF DVR NYNYTEPTLAGNA 
Sbjct  518  IPKNKIKYSCKGGWKWRDTPKPSPNTLVGAMVAGPDKHDGFKDVRGNYNYTEPTLAGNAA  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE S  IDKNTIFSAV
Sbjct  578  LVAALVALSGE-SHSIDKNTIFSAV  601



>gb|AEO97185.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97212.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 128/145 (88%), Gaps = 9/145 (6%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS DI         DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  459  LEAADTPGWYCGPNFYSTDI---------DYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  509

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK+RYNCKGGWKWRD+ KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAG
Sbjct  510  IPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAG  569

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+++T IDKNTIFSAV
Sbjct  570  LVAALVALSGDKTTGIDKNTIFSAV  594



>gb|AAN72232.1| At5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|NP_199783.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 sp|Q38890.1|GUN25_ARATH RecName: Full=Endoglucanase 25; AltName: Full=Cellulase homolog 
OR16pep; AltName: Full=Endo-1,4-beta glucanase 25; AltName: 
Full=Protein KORRIGAN; AltName: Full=Protein RADIALLY SWOLLEN 
2 [Arabidopsis thaliana]
 gb|AAB60304.1| cellulase [Arabidopsis thaliana]
 gb|AAC33467.1| cellulase [Arabidopsis thaliana]
 gb|AAC35344.1| cellulase [Arabidopsis thaliana]
 gb|AAC83240.1| endo-1,4-beta-D-glucanase KORRIGAN [Arabidopsis thaliana]
 dbj|BAA98160.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
 gb|AED95850.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
Length=621

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>gb|AAK59818.1| AT5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTSVLRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSGE     +IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEATGKIDKNTIFSAV  605



>ref|XP_004301591.2| PREDICTED: endoglucanase 25 [Fragaria vesca subsp. vesca]
Length=1115

 Score =   231 bits (589),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA+ QIDYILGKNP KMSY+VGFGNHYPK VHHR AS
Sbjct  458  LDAADTPGWYCGPNFYSTDVLRDFAKFQIDYILGKNPAKMSYIVGFGNHYPKRVHHRAAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++YNCKGGWKWRDS K NPNI+ GAMVAGPD  DGF DVR+NYNYTEPTLAGNAG
Sbjct  518  IPKNKIKYNCKGGWKWRDSTKANPNIIEGAMVAGPDKRDGFRDVRSNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV LSG++ST IDKNTIFSAV
Sbjct  578  LVAALVGLSGDKSTGIDKNTIFSAV  602



>ref|XP_009395086.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR+FA++QIDYILG NP+KMSYVVG+G  YPKHVHHRGAS
Sbjct  460  LDAADTPGWYCGPNFYSTDVLRDFAKTQIDYILGNNPQKMSYVVGYGKRYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+Y+CKGGWKWRD+KKPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  520  IPKNGVKYSCKGGWKWRDTKKPNPNTIVGAMVAGPDRHDGFKDVRTNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSG  +T IDKNTIFSAV
Sbjct  580  LVAALVSLSGV-TTGIDKNTIFSAV  603



>ref|XP_008782747.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA++QIDY+LGKNPRKMSYVVGFGNHYPKHVHHRGAS
Sbjct  463  LDAADTPGWYCGPNFYSTGVLRDFAQTQIDYVLGKNPRKMSYVVGFGNHYPKHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+Y+CKGGWKWR++KKPNP+ ++GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNGVKYSCKGGWKWRNTKKPNPHNIIGAMVAGPDRRDGFRDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE++  +DKNTIFSAV
Sbjct  583  LVAALVALSGEKNG-VDKNTIFSAV  606



>emb|CDY21449.1| BnaC03g27480D [Brassica napus]
Length=621

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS ++LR FA +QIDYILGKNP KMSY+VGFG  YPKHVHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTNVLREFARTQIDYILGKNPPKMSYLVGFGTKYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  579  LVAALVALSGEEEASGTIDKNTIFSAV  605



>ref|XP_009406859.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=623

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNF+S  +LR+FA +QIDY+LGKNP+K+SYVVGFG  YPKHVHHRGAS
Sbjct  464  LEAADTPGWYCGPNFFSTGVLRDFARTQIDYVLGKNPQKLSYVVGFGARYPKHVHHRGAS  523

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+YNCKGGWKWRD+KKPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  524  IPKNGVKYNCKGGWKWRDTKKPNPNTIVGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAG  583

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE    +DKNTIFSAV
Sbjct  584  LVAALVALSGE-GNGVDKNTIFSAV  607



>gb|KFK26611.1| hypothetical protein AALP_AA8G271400 [Arabis alpina]
Length=621

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR FA +QIDYILGKNPRKMSY+VGFG  YP+ VHHRGAS
Sbjct  459  LDAADTPGWYCGPNFYSTKVLREFARTQIDYILGKNPRKMSYLVGFGPRYPRRVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD HDGF DVR NYNYTEPTLAGNAG
Sbjct  519  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKHDGFRDVRMNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVALSG+  T   IDKNTIFSAV
Sbjct  579  LVAALVALSGDEDTAGTIDKNTIFSAV  605



>gb|AFL65037.1| endoglucanase, partial [Pinus pinaster]
Length=448

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGW CGPNF+S + LR+FA +QI+YILGKNP KMSYVVG+G+HYPKHVHHRGAS
Sbjct  288  LTAADIPGWNCGPNFFSTETLRDFARTQINYILGKNPMKMSYVVGYGSHYPKHVHHRGAS  347

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRDS +PNPN++VGAMVAGPD  D FHDVRTNYNYTEPTLAGNAG
Sbjct  348  IPKNKIKYSCKGGWKWRDSPRPNPNVIVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAG  407

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSG  +  IDKNT+FSAV
Sbjct  408  LVAALVSLSGGDTGGIDKNTMFSAV  432



>emb|CDX92628.1| BnaC07g38860D [Brassica napus]
Length=619

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FYS D+LR+FA SQIDYILGKNPRKMSYVVGFG  YPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPKFYSTDVLRDFARSQIDYILGKNPRKMSYVVGFGQRYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPK+  R +CKGGWKWRD++K NPN +VGAMVAGPD HDGFHD+RTNYNYTEPTLAGNAG
Sbjct  518  IPKSVKRESCKGGWKWRDTRKNNPNTIVGAMVAGPDKHDGFHDLRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERS-TRIDKNTIFSAV  320
            LVAALVALSGER+   IDKNT+FSAV
Sbjct  578  LVAALVALSGERTFGAIDKNTMFSAV  603



>ref|XP_008793381.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS  +LR+FA +QIDY+LGKNPRKMSYVVGFGN Y KHVHHRGAS
Sbjct  463  LDAADTPGWYCGPDFYSTKVLRDFARTQIDYMLGKNPRKMSYVVGFGNRYAKHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN VRY+CKGGWKWRD+K+PNP+ + GAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  523  IPKNGVRYSCKGGWKWRDTKRPNPHTIFGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL+ALSGE++  +DKNTIFSAV
Sbjct  583  LVAALIALSGEKNG-VDKNTIFSAV  606



>ref|NP_001183308.1| hypothetical protein [Zea mays]
 gb|ACR36366.1| unknown [Zea mays]
 tpg|DAA45168.1| TPA: hypothetical protein ZEAMMB73_159477 [Zea mays]
Length=619

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +QI+YILGKNP KMSYVVGFGNHYPKHVHHRGAS
Sbjct  460  LEAADTPGWYCGPHFYSIEVLRSFARTQIEYILGKNPLKMSYVVGFGNHYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWRD+KKPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAG
Sbjct  520  IPKNGVHYGCKGGWKWRDTKKPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE    +DKNT+FSAV
Sbjct  580  LVAALVALSGE-GHGVDKNTMFSAV  603



>ref|XP_009137436.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
 emb|CDY10998.1| BnaA03g46570D [Brassica napus]
Length=619

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FYS D+LR+FA SQIDYILGKNPRKMSYVVGFG  YPKHVHHRGAS
Sbjct  458  LDAADTPGWYCGPKFYSTDVLRDFARSQIDYILGKNPRKMSYVVGFGQRYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPK+  + +CKGGWKWRD+KK NPN +VGAMVAGPD HDGFHD+RTNYNYTEPTLAGNAG
Sbjct  518  IPKSVKKESCKGGWKWRDTKKNNPNTIVGAMVAGPDKHDGFHDLRTNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGERS-TRIDKNTIFSAV  320
            LVAALVALSGER+   IDKNT+FSAV
Sbjct  578  LVAALVALSGERTFGAIDKNTMFSAV  603



>ref|NP_001142480.1| uncharacterized protein LOC100274698 [Zea mays]
 gb|ACG24268.1| hypothetical protein [Zea mays]
Length=198

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  36   LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  95

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAG
Sbjct  96   IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAG  155

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  156  LVAALISISDIKTGRFGIDKNTIFSAI  182



>ref|XP_004984503.1| PREDICTED: endoglucanase 9-like [Setaria italica]
Length=619

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR FA +QI+YILGKNP KMSYVVGFG HYPKHVHHRGAS
Sbjct  460  LEAADTPGWYCGPHFYSIEVLRGFARTQIEYILGKNPLKMSYVVGFGKHYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWRD+KKPNPNI+VGAMVAGPD HDGF D R NYNYTE TLAGNAG
Sbjct  520  IPKNGVHYGCKGGWKWRDTKKPNPNIIVGAMVAGPDRHDGFKDARKNYNYTEATLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE S  +DKNT+FSAV
Sbjct  580  LVAALVALSGE-SHGVDKNTMFSAV  603



>gb|ABR16291.1| unknown [Picea sitchensis]
 gb|ACN40901.1| unknown [Picea sitchensis]
Length=617

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGW CGP F+S + LRNFA +QI+YILGKNP KMSY+VG+G+HYPKHVHHRGAS
Sbjct  457  LTAADIPGWNCGPTFFSTEALRNFARTQINYILGKNPMKMSYLVGYGSHYPKHVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRDS +PNPN+LVGAMVAGPD  D FHDVRTNYNYTEPTLAGNAG
Sbjct  517  IPKNKIKYSCKGGWKWRDSPRPNPNVLVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSG  +  IDKNT+FSAV
Sbjct  577  LVAALVSLSGGDTGGIDKNTMFSAV  601



>gb|AEL88496.1| membrane-bound endo-1,4-beta-glucanase [Picea glauca]
Length=617

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGW CGP F+S + LRNFA +QI+YILGKNP KMSY+VG+G+HYPKHVHHRGAS
Sbjct  457  LTAADIPGWNCGPTFFSTEALRNFARTQINYILGKNPMKMSYLVGYGSHYPKHVHHRGAS  516

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRDS +PNPN+LVGAMVAGPD  D FHDVRTNYNYTEPTLAGNAG
Sbjct  517  IPKNKIKYSCKGGWKWRDSPRPNPNVLVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSG  +  IDKNT+FSAV
Sbjct  577  LVAALVSLSGGDTGGIDKNTMFSAV  601



>gb|ABR15471.1| endoglucanase [Pinus taeda]
Length=619

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGW CGPNF+S + LR+FA +QI+YILGKNP KMSY+VG+G+HYPKHVHHRGAS
Sbjct  459  LTAADIPGWNCGPNFFSTETLRDFARTQINYILGKNPMKMSYLVGYGSHYPKHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWRDS +PNPN++VGAMVAGPD  D FHDVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNKIKYSCKGGWKWRDSPRPNPNVIVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSG  +  IDKNT+FSAV
Sbjct  579  LVAALVSLSGGDTGGIDKNTMFSAV  603



>ref|XP_009417855.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+D PGWYCGPNF+   +LR+FA +QIDYILGKNP+KMSYVVGFG  YPKHVHHRGAS
Sbjct  461  LEASDTPGWYCGPNFFPAGVLRDFARTQIDYILGKNPQKMSYVVGFGKRYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+Y+CKGGWKWRD+KKPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAG
Sbjct  521  IPKNGVKYSCKGGWKWRDTKKPNPNTIFGAMVAGPDRQDGFRDVRTNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSGE  T +DKNT+FSAV
Sbjct  581  LVAALVSLSGE-GTGVDKNTMFSAV  604



>ref|XP_006402246.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43699.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=620

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGW CGPNFYS ++LR FA +Q+DYILGKNPR MSY+VGFG  YPK VHHRGAS
Sbjct  458  LDAADTPGWNCGPNFYSTNVLREFARTQVDYILGKNPRNMSYLVGFGQKYPKRVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAG
Sbjct  518  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAG  577

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  578  LVAALVALSGEEDASRTIDKNTIFSAV  604



>ref|XP_006402245.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43698.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=648

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGW CGPNFYS ++LR FA +Q+DYILGKNPR MSY+VGFG  YPK VHHRGAS
Sbjct  486  LDAADTPGWNCGPNFYSTNVLREFARTQVDYILGKNPRNMSYLVGFGQKYPKRVHHRGAS  545

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNKV+YNCKGGWKWRDSKKPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAG
Sbjct  546  IPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAG  605

Query  394  lvaalvaLSGER--STRIDKNTIFSAV  320
            LVAALVALSGE   S  IDKNTIFSAV
Sbjct  606  LVAALVALSGEEDASRTIDKNTIFSAV  632



>ref|XP_009400506.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D LR FA++QIDYILG NPRKMSY+VG+G  YPKHVHHRGAS
Sbjct  460  LEAADTPGWYCGPNFYSTDTLRGFAKTQIDYILGNNPRKMSYIVGYGKRYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN  RY CKGG+KWRDS +PNPN +VGAMVAGPD HDGF DVR NYNYTEPTLAGNAG
Sbjct  520  IPKNGARYGCKGGYKWRDSTRPNPNTIVGAMVAGPDRHDGFRDVRVNYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++LSG + T +DKNTIFSAV
Sbjct  580  LVAALISLSGVK-TGVDKNTIFSAV  603



>gb|EYU35397.1| hypothetical protein MIMGU_mgv1a003033mg [Erythranthe guttata]
Length=613

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AAD PGWYCGP FYS D+LR FAE+Q++YILGKNPRKMSYVVG+G HYPK VHHRGAS
Sbjct  453  MKAADTPGWYCGPKFYSTDVLREFAETQMNYILGKNPRKMSYVVGYGTHYPKQVHHRGAS  512

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+Y CKGG KWRDS K NPNI+VGAMVAGPD +DGF D R NYNYTEPTLAGNAG
Sbjct  513  IPKNNVKYTCKGGLKWRDSTKANPNIIVGAMVAGPDRNDGFKDKRNNYNYTEPTLAGNAG  572

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+    IDKNTIFSAV
Sbjct  573  LVAALVALSGDTDVGIDKNTIFSAV  597



>ref|XP_007216021.1| hypothetical protein PRUPE_ppa014845mg, partial [Prunus persica]
 gb|EMJ17220.1| hypothetical protein PRUPE_ppa014845mg, partial [Prunus persica]
Length=561

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = -3

Query  754  LAAADA---PGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHR  584
            L AAD+    G +CGPNF+SVD+LR+FA++QIDYILGKNP+KMSYVVGFGNH+PKHVHH 
Sbjct  396  LEAADSTKPAGLHCGPNFFSVDVLRDFAKTQIDYILGKNPQKMSYVVGFGNHFPKHVHHS  455

Query  583  GASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlag  404
            GASIPK K++Y CK GWKWRDS KPNP  +VGAMVAGPD HDGFHDVR NYNYTEPTL G
Sbjct  456  GASIPKKKIKYTCKEGWKWRDSLKPNPYTIVGAMVAGPDKHDGFHDVRANYNYTEPTLVG  515

Query  403  naglvaalvaLSGERSTR-IDKNTIFSAV  320
            NAGLVAALVALSG+R+T  IDKNT+FSA+
Sbjct  516  NAGLVAALVALSGDRTTDGIDKNTMFSAI  544



>gb|ADQ73896.1| endo-1,4-beta-glucanase [Avena strigosa]
Length=338

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 125/149 (84%), Gaps = 5/149 (3%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGPNFY  D+LR FA+SQIDYILGKNP+KMSYVVG+G  YPK VHHRGAS
Sbjct  175  LDTADTPGWYCGPNFYKTDVLRKFAKSQIDYILGKNPQKMSYVVGYGKKYPKRVHHRGAS  234

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V Y CKGG+KWR+SKK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  235  IPHNGVHYGCKGGFKWRESKKANPNILVGAMVAGPDRHDGFKDIRTNYNYTEPTLAANAG  294

Query  394  lvaalvaL----SGERSTRIDKNTIFSAV  320
            LVAAL++L    +G R T +DKNTIFSAV
Sbjct  295  LVAALISLADIDTGSR-TSVDKNTIFSAV  322



>ref|XP_002465324.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
 gb|EER92322.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
Length=620

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +QI+YILGKNP KMSYVVGFGNHYPKHVHHRGAS
Sbjct  461  LEAADTPGWYCGPHFYSIEVLRSFARTQIEYILGKNPLKMSYVVGFGNHYPKHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWRD+KKPNPNI+VGAMVAGPD HD F D R NYNYTE TL GNAG
Sbjct  521  IPKNGVHYGCKGGWKWRDTKKPNPNIIVGAMVAGPDRHDRFKDARKNYNYTEATLVGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE    +DKN +FSAV
Sbjct  581  LVAALVALSGE-GHGVDKNAMFSAV  604



>ref|XP_008243721.1| PREDICTED: endoglucanase 9-like [Prunus mume]
Length=564

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 132/149 (89%), Gaps = 4/149 (3%)
 Frame = -3

Query  754  LAAADA---PGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHR  584
            L AAD+    G +CGPNF+SVD+LR+FA++QIDYILG+NP+KMSYVVGFGNH+PK VHHR
Sbjct  399  LEAADSTKPAGLHCGPNFFSVDVLRDFAKTQIDYILGRNPQKMSYVVGFGNHFPKQVHHR  458

Query  583  GASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlag  404
            GASIPK K++Y+CKGGWKWR S KPNP  +VGAMVAGPD HDGFHDVR NYNYTEPTL G
Sbjct  459  GASIPKKKIKYSCKGGWKWRGSLKPNPYTIVGAMVAGPDKHDGFHDVRANYNYTEPTLVG  518

Query  403  naglvaalvaLSGERSTR-IDKNTIFSAV  320
            NAGLVAALVALSG+R+T  IDKNT+FSA+
Sbjct  519  NAGLVAALVALSGDRTTDGIDKNTMFSAI  547



>ref|NP_001147537.1| endo-1,4-beta-glucanase [Zea mays]
 gb|ACG27857.1| endo-1,4-beta-glucanase [Zea mays]
 gb|AFW88475.1| endo-1,4-beta-glucanase [Zea mays]
Length=620

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYSV++LR+FA +QIDYILGKNP KMSYVVGFG  YP+HVHHRGAS
Sbjct  460  LEAADTPGWYCGPHFYSVEVLRSFARTQIDYILGKNPLKMSYVVGFGKRYPRHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWRD+KKPNPN + GAMVAGPD HDGF D R NYNYTE TLAGNAG
Sbjct  520  IPKNGVHYGCKGGWKWRDAKKPNPNTIAGAMVAGPDRHDGFKDARRNYNYTEATLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSG+    +DKNT+FSAV
Sbjct  580  LVAALVALSGDGHGGVDKNTMFSAV  604



>ref|XP_010529892.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A D PGWYCGP+F+  D+LR FA SQIDYILGKNP+ MSY+VGFG  YPK VHHRGAS
Sbjct  462  LDATDTPGWYCGPSFFPTDVLRKFARSQIDYILGKNPQSMSYIVGFGQRYPKRVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN+ RY+CKGGWKWRDSK PNPNI+VGAMVAGPD  D FHDVR NYNYTEPTLAGNAG
Sbjct  522  IPKNRNRYSCKGGWKWRDSKMPNPNIIVGAMVAGPDKRDRFHDVRNNYNYTEPTLAGNAG  581

Query  394  lvaalvaLSGER-STRIDKNTIFSAV  320
            LVAALVALSG++ S  IDKNT+FSAV
Sbjct  582  LVAALVALSGDKDSGSIDKNTMFSAV  607



>gb|EMT00674.1| Endoglucanase 10 [Aegilops tauschii]
Length=555

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGPNFY+ D+LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGAS
Sbjct  393  LDTADTPGWYCGPNFYTTDVLRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGAS  452

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  453  IPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAG  512

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL++L+   + R  IDKNTIFSAV
Sbjct  513  LVAALISLADIDTGRYSIDKNTIFSAV  539



>emb|CDY34271.1| BnaA01g13740D [Brassica napus]
Length=561

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS  +LR+FA SQIDYILGKNP+ MSYVV FG  YP+HVHH+GAS
Sbjct  400  LDAADTPGWYCGPDFYSTKVLRDFARSQIDYILGKNPQNMSYVVDFGQRYPRHVHHKGAS  459

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPK+  + +CKGGWKWRD+K+ NPNI+VGAMVAGPD HDGFHD+R+NYNYTEPTLAGN G
Sbjct  460  IPKSVKKESCKGGWKWRDTKRDNPNIIVGAMVAGPDKHDGFHDLRSNYNYTEPTLAGNGG  519

Query  394  lvaalvaLSGERSTR-IDKNTIFSAV  320
            LVAALVALSGE +   IDKNTIFSAV
Sbjct  520  LVAALVALSGEETLESIDKNTIFSAV  545



>gb|EMS52550.1| Endoglucanase 10 [Triticum urartu]
Length=555

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGPNFY+ D+LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGAS
Sbjct  393  LDTADTPGWYCGPNFYTTDVLRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGAS  452

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  453  IPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAG  512

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL++L+   + R  IDKNTIFSAV
Sbjct  513  LVAALISLADIDTGRYSIDKNTIFSAV  539



>ref|XP_009137865.1| PREDICTED: endoglucanase 21 [Brassica rapa]
Length=610

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS  +LR+FA SQIDYILGKNP+ MSYVV FG  YP+HVHH+GAS
Sbjct  449  LDAADTPGWYCGPDFYSTKVLRDFARSQIDYILGKNPQNMSYVVDFGQRYPRHVHHKGAS  508

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPK+  + +CKGGWKWRD+K+ NPNI+VGAMVAGPD HDGFHD+R+NYNYTEPTLAGNAG
Sbjct  509  IPKSVKKESCKGGWKWRDTKRDNPNIIVGAMVAGPDKHDGFHDLRSNYNYTEPTLAGNAG  568

Query  394  lvaalvaLSGERSTR-IDKNTIFSAV  320
            LVAALVALSGE +   IDKNTIFSAV
Sbjct  569  LVAALVALSGEETLESIDKNTIFSAV  594



>dbj|BAJ94336.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGPNFY+ D+LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGAS
Sbjct  459  LDTADTPGWYCGPNFYTTDVLRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL++L+   + R  IDKNTIFSAV
Sbjct  579  LVAALISLADIDTGRYSIDKNTIFSAV  605



>dbj|BAA94257.1| endo-1,4-beta-glucanase Cel1 [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGPNFY+ D+LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGAS
Sbjct  459  LDTADTPGWYCGPNFYTTDVLRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL++L+   + R  IDKNTIFSAV
Sbjct  579  LVAALISLADIDTGRYSIDKNTIFSAV  605



>ref|NP_001050004.1| Os03g0329500 [Oryza sativa Japonica Group]
 sp|P0C1U4.1|GUN9_ORYSJ RecName: Full=Endoglucanase 9; AltName: Full=Endo-1,4-beta glucanase 
9; AltName: Full=OsCel9D; AltName: Full=OsGLU1 [Oryza 
sativa Japonica Group]
 gb|ABF95745.1| membrane-anchored endo-1,4-beta-glucanase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11918.1| Os03g0329500 [Oryza sativa Japonica Group]
 dbj|BAF37261.1| endo-beta-1,4-D-glucanase [Oryza sativa]
 gb|EAY89858.1| hypothetical protein OsI_11408 [Oryza sativa Indica Group]
Length=619

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FY ++ LRNFA +QI+YILGKNP KMSYVVG+GN YPK VHHRGAS
Sbjct  460  LEAADTPGWYCGPHFYPIETLRNFARTQIEYILGKNPLKMSYVVGYGNRYPKRVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWR++KKPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAG
Sbjct  520  IPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE    +DKNT+FSAV
Sbjct  580  LVAALVALSGE-GHGVDKNTMFSAV  603



>gb|EEE58992.1| hypothetical protein OsJ_10702 [Oryza sativa Japonica Group]
Length=619

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FY ++ LRNFA +QI+YILGKNP KMSYVVG+GN YPK VHHRGAS
Sbjct  460  LEAADTPGWYCGPHFYPIETLRNFARTQIEYILGKNPLKMSYVVGYGNRYPKRVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWR++KKPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAG
Sbjct  520  IPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE    +DKNT+FSAV
Sbjct  580  LVAALVALSGE-GHGVDKNTMFSAV  603



>emb|CDI66528.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
 emb|CDI66541.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  579  LVAALISISDIKTGRFGIDKNTIFSAI  605



>emb|CBB36505.1| Hordeum vulgare protein similar to endo-1,4-b-glucanase BAA94257 
[Saccharum hybrid cultivar R570]
Length=626

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  464  LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  523

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAG
Sbjct  524  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAG  583

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  584  LVAALISISDIKTGRFGIDKNTIFSAI  610



>emb|CDI66602.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=624

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  462  LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAG
Sbjct  522  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAG  581

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  582  LVAALISISDIKTGRFGIDKNTIFSAI  608



>gb|ABP96983.1| cellulase [Colocasia esculenta]
Length=618

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A+D PGWYCGPNFYS ++LRNFA +QIDYILG NP+KMSY+VG+G  YPKHV+HRGAS
Sbjct  459  MEASDTPGWYCGPNFYSTEVLRNFARTQIDYILGNNPQKMSYLVGYGKRYPKHVYHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V+Y CK GWK RD+ KPNPN +VGAM+AGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  519  IPKNGVKYGCKAGWKLRDTTKPNPNTIVGAMIAGPDKHDGFKDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+LSG ++  IDKNTIFSAV
Sbjct  579  LVAALVSLSGVQAG-IDKNTIFSAV  602



>ref|XP_006650027.1| PREDICTED: endoglucanase 9-like [Oryza brachyantha]
Length=619

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FY ++ LRNFA +QI+YILGKNP KMS+VVG+G HYPK VHHRGAS
Sbjct  460  LEAADTPGWYCGPHFYPIETLRNFARTQIEYILGKNPLKMSFVVGYGKHYPKRVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN V Y CKGGWKWR++KKPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAG
Sbjct  520  IPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGPDHHDGFKDVRRNYNYTEATLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE    +DKNT+FSAV
Sbjct  580  LVAALVALSGE-GHGVDKNTMFSAV  603



>emb|CDI66566.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YP+  HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPRRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  579  LVAALISISDIKTGRFGIDKNTIFSAI  605



>ref|XP_006413454.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
 gb|ESQ54907.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
Length=624

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+D PGWYCGPNFYS D+LR F+ SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGAS
Sbjct  463  LEASDTPGWYCGPNFYSRDVLREFSRSQIDYILGKNPRKMSYVVGFGQRYPRHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  + +CKGGWKWRDSKK NPN + GAMVAGP+ +DGFHDVR NYNYTEPTLAGNAG
Sbjct  523  IPMSVKKESCKGGWKWRDSKKGNPNTITGAMVAGPNKYDGFHDVRANYNYTEPTLAGNAG  582

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSG ++   IDKNTIFSAV
Sbjct  583  LVAALVALSGGKTVGGIDKNTIFSAV  608



>ref|XP_002463915.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
 gb|EER90913.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
Length=621

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD HDG+ DVRTNYNY+EPTLA NAG
Sbjct  519  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRHDGYKDVRTNYNYSEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  579  LVAALISISDIKTGRFGIDKNTIFSAI  605



>emb|CDY03467.1| BnaC01g16150D [Brassica napus]
Length=561

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS  +LR+FA SQIDYILGKNP+ MSYVV FG  YP+HVHH+GAS
Sbjct  400  LDAADTPGWYCGPNFYSTHVLRDFARSQIDYILGKNPQNMSYVVDFGQRYPRHVHHKGAS  459

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPK+  + +CKGGWKWRD+K+ NPN +VGAMVAGPD HD FHD+R+NYNYTEPTLAGNAG
Sbjct  460  IPKSVKKESCKGGWKWRDTKRDNPNTIVGAMVAGPDKHDEFHDLRSNYNYTEPTLAGNAG  519

Query  394  lvaalvaLSGERSTR-IDKNTIFSAV  320
            LVAALVALSGE +   IDKNTIFSAV
Sbjct  520  LVAALVALSGEETLESIDKNTIFSAV  545



>ref|NP_001151770.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
 gb|ACG44266.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY++++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYTIEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  579  LVAALISISDIKTGRFGIDKNTIFSAI  605



>tpg|DAA51201.1| TPA: endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY++++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYTIEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  579  LVAALISISDIKTGRFGIDKNTIFSAI  605



>ref|XP_003557996.1| PREDICTED: endoglucanase 9 [Brachypodium distachyon]
Length=621

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 128/146 (88%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYSV++LR+FA +QI+YILGKNP KMSYVVG+GNHYPKHVHHRGAS
Sbjct  461  LDAADTPGWYCGPHFYSVEVLRSFARTQIEYILGKNPLKMSYVVGYGNHYPKHVHHRGAS  520

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V Y CK GWKWRDSKKPNP+I+VGAMVAGPD HD F DVR NYNYTE TLAGNA
Sbjct  521  IPKKKGVHYGCKEGWKWRDSKKPNPHIVVGAMVAGPDRHDRFKDVRKNYNYTEATLAGNA  580

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLV ALVALSGE +  +DKNT+FSAV
Sbjct  581  GLVTALVALSGE-AHGLDKNTMFSAV  605



>ref|XP_006650552.1| PREDICTED: endoglucanase 10-like [Oryza brachyantha]
Length=618

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FY+ ++LR FA SQ+DY+LGKNP+KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LDAADTPGWYCGPTFYTTEVLRKFARSQLDYVLGKNPQKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR++KK NPNIL+GAMVAGPD HDGF DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWRETKKANPNILIGAMVAGPDRHDGFKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++LS  + T IDKNTIFSA+
Sbjct  579  LVAALISLSNAK-TGIDKNTIFSAI  602



>gb|ACZ82300.1| beta-1,4 glycosidase [Phyllostachys edulis]
Length=617

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK VHHR AS
Sbjct  458  LEAADTPGWYCGPHFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRVHHREAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNIL+GAMVAGPD HDGF DVRTNYNYTEPTLA NAG
Sbjct  518  IPHNGVKYGCKGGFKWRESKKANPNILIGAMVAGPDRHDGFKDVRTNYNYTEPTLAANAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++LS +  T IDKNT+FSA+
Sbjct  578  LVAALISLS-DVKTGIDKNTLFSAI  601



>gb|ABF98747.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
Length=497

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FY+ ++LR FA SQ+DY+LGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  336  LDAADTPGWYCGPTFYTTEVLRKFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGAS  395

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR++KKPNPNIL+GA+VAGPD HDGF DVRTNYNYTEPTLA NAG
Sbjct  396  IPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAG  455

Query  394  lvaalvaLSG-ERSTRIDKNTIFSAV  320
            LVAAL++L+     + IDKNTIFSAV
Sbjct  456  LVAALISLTNIHVKSGIDKNTIFSAV  481



>gb|ACN28577.1| unknown [Zea mays]
 gb|ACN34658.1| unknown [Zea mays]
 gb|AFW67687.1| hypothetical protein ZEAMMB73_593933 [Zea mays]
Length=621

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LEAADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWRD+KK NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGYKWRDTKKANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL+++S  ++ R  IDKNTIFSA+
Sbjct  579  LVAALISISDIKTGRFGIDKNTIFSAI  605



>gb|EPS69180.1| hypothetical protein M569_05586 [Genlisea aurea]
Length=615

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AAD PGWYCGP+FYS+D+LR+F++SQI+YILG+NPR+MSYVVGFG  YP HVHHRGAS
Sbjct  456  MHAADIPGWYCGPHFYSIDVLRDFSKSQINYILGQNPRQMSYVVGFGRRYPTHVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK + +C+GGWKWRDS KPNPN + GAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  516  IPKNK-KASCEGGWKWRDSSKPNPNTIRGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAG  574

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVAL+   +  IDKNT+FSAV
Sbjct  575  LVAALVALAAGDNAGIDKNTMFSAV  599



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FY+ ++LR FA SQ+DY+LGKNP KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LDAADTPGWYCGPTFYTTEVLRKFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR++KKPNPNIL+GA+VAGPD HDGF DVRTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSG-ERSTRIDKNTIFSAV  320
            LVAAL++L+     + IDKNTIFSAV
Sbjct  579  LVAALISLTNIHVKSGIDKNTIFSAV  604



>ref|XP_003560035.1| PREDICTED: endoglucanase 10 [Brachypodium distachyon]
Length=621

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD PGWYCGP+F+  D+LR FA+SQIDYILG NP+KMSYVVGFG  YPK VHHRGAS
Sbjct  459  LDTADTPGWYCGPHFFKTDVLRKFAKSQIDYILGNNPQKMSYVVGFGKKYPKRVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGPDRHDGFKDIRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            L+AAL++L+   + R  IDKNTIFSAV
Sbjct  579  LIAALISLADIDTGRTAIDKNTIFSAV  605



>ref|NP_194157.1| endoglucanase 21 [Arabidopsis thaliana]
 sp|Q9STW8.1|GUN21_ARATH RecName: Full=Endoglucanase 21; AltName: Full=Endo-1,4-beta glucanase 
21 [Arabidopsis thaliana]
 emb|CAB45061.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 emb|CAB79336.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 gb|AEE84879.1| endoglucanase 21 [Arabidopsis thaliana]
Length=620

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ + LRNF+ SQIDYILGKNPRKMSYVVG+G  YPK VHHRGAS
Sbjct  460  LEAADTPGWYCGPNFYTTEFLRNFSRSQIDYILGKNPRKMSYVVGYGQRYPKQVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN ++  C GG+KW+ SKK NPN + GAMVAGPD HDGFHD+RTNYNYTEPTLAGNAG
Sbjct  520  IPKN-MKETCTGGFKWKKSKKNNPNAINGAMVAGPDKHDGFHDIRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSGE++   IDKNT+FSAV
Sbjct  579  LVAALVALSGEKAVGGIDKNTMFSAV  604



>ref|XP_004981854.1| PREDICTED: endoglucanase 10-like [Setaria italica]
Length=621

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L +AD PGWYCGPNFY+ ++LR FA SQ+DYILGKNP+KMSYVVGFGN YPK  HHRGAS
Sbjct  459  LESADTPGWYCGPNFYTTEVLRKFARSQLDYILGKNPQKMSYVVGFGNKYPKRPHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+SKK NPNILVGAMVAGPD HD F D+RTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWRESKKANPNILVGAMVAGPDKHDRFKDIRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL++++   + R  IDKNTIFSA+
Sbjct  579  LVAALISIADIPTGRYSIDKNTIFSAI  605



>ref|XP_010433798.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=622

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FY+ + LRNF+ SQIDYILGKNPRKMSYVVGFG  YPK VHHRGAS
Sbjct  462  LEAADTPGWYCGPYFYTNEYLRNFSRSQIDYILGKNPRKMSYVVGFGQRYPKQVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP+N ++ +CKGG KW  SKK NPNI+ GAMVAGPD HDGFHDVRTNYNYTEPTL+GNAG
Sbjct  522  IPQN-MKESCKGGLKWEKSKKDNPNIIKGAMVAGPDKHDGFHDVRTNYNYTEPTLSGNAG  580

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSGE +   IDKNT+FSAV
Sbjct  581  LVAALVALSGEEAVGDIDKNTMFSAV  606



>gb|AFR40585.1| cellulase, partial [Populus nigra]
 gb|AFR40590.1| cellulase, partial [Populus nigra]
 gb|AFR40592.1| cellulase, partial [Populus nigra]
 gb|AFR40593.1| cellulase, partial [Populus nigra]
Length=131

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRK+SYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKISYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40584.1| cellulase, partial [Populus nigra]
Length=131

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRK+SYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKISYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTMKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_006431346.1| hypothetical protein CICLE_v10003884mg, partial [Citrus clementina]
 gb|ESR44586.1| hypothetical protein CICLE_v10003884mg, partial [Citrus clementina]
Length=477

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AA   GW+CGPN  + D++R FA++QIDYILG NP+KMSY+VGFG+ YP++VHHRGAS
Sbjct  325  LEAAGLLGWFCGPNLITTDVMRRFAKTQIDYILGNNPQKMSYLVGFGSPYPQYVHHRGAS  384

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK++Y+CKGGWKWR S KPNPN LVGAMVAGP  HDGFHDVR+NYNYT PTL  NAG
Sbjct  385  IPKNKIKYSCKGGWKWRHSSKPNPNTLVGAMVAGPHKHDGFHDVRSNYNYTVPTLHDNAG  444

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSG++ST  IDK+TIF+ V
Sbjct  445  LVAALVALSGKKSTGGIDKSTIFTEV  470



>gb|KFK22234.1| hypothetical protein AALP_AAs42893U000400 [Arabis alpina]
Length=616

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFYS D+LR F++SQIDYILG NPR MSYVVGFG  YPKHVHHRGAS
Sbjct  454  LDAADTPGWYCGPNFYSTDVLREFSKSQIDYILGDNPRGMSYVVGFGKRYPKHVHHRGAS  513

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN  + +CKGGW WRD KK NPN + GAMVAGPD HDGFHD+R NYNYTEPTLAGNAG
Sbjct  514  IPKNAKKQSCKGGWHWRDIKKENPNTIEGAMVAGPDKHDGFHDLRINYNYTEPTLAGNAG  573

Query  394  lvaalvaLSGERST--RIDKNTIFSAV  320
            LVAALVAL+   ++   IDKNTIFSAV
Sbjct  574  LVAALVALTRPPNSFGTIDKNTIFSAV  600



>gb|AFR40563.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40564.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40565.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40566.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40567.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40568.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40569.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40570.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40571.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40572.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40573.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40574.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40575.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40576.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40577.1| cellulase, partial [Populus trichocarpa]
Length=131

 Score =   192 bits (487),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_002867672.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=620

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ ++LR+F+ SQIDYILGKNPRKMSYVVG+G  YPK VHHRGAS
Sbjct  460  LDAADTPGWYCGPNFYTTELLRDFSRSQIDYILGKNPRKMSYVVGYGQRYPKQVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK R  C GG KW+ SKK NPN + GAMVAGPD HDGFHDVR+NYNYTEPTLAGNAG
Sbjct  520  IPKNK-RETCTGGLKWKKSKKGNPNTIDGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSGE+    IDKNT+FSAV
Sbjct  579  LVAALVALSGEKPVGGIDKNTMFSAV  604



>ref|XP_006283336.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
 gb|EOA16234.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
Length=622

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGPNFY+ + LR+F+ SQIDYILGKNPRKMSYVVG+G  YPKHVHHRGAS
Sbjct  462  LVAADTPGWYCGPNFYTTEYLRDFSRSQIDYILGKNPRKMSYVVGYGQRYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP+NK + +C GGWKW+ SK  NPNI+ GAMVAGPD +DGFHDVRTNYNYTEPTLAGNAG
Sbjct  522  IPRNK-KESCTGGWKWKKSKDANPNIIYGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAG  580

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSG  +   IDKNT+FSAV
Sbjct  581  LVAALVALSGGIAVGGIDKNTMFSAV  606



>gb|AAM13693.1| endo-1,4-beta-glucanase [Triticum aestivum]
Length=620

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  AD P WYC PNFY+ D+LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGAS
Sbjct  459  LDTADTPRWYCRPNFYTTDVLRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y CKGG+KWR+ KK NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAG
Sbjct  519  IPHNGVKYGCKGGFKWREFKKANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAG  578

Query  394  lvaalvaLSGERSTR--IDKNTIFSAV  320
            LVAAL++L+   + R  IDKNTIFSAV
Sbjct  579  LVAALISLADIDTGRYSIDKNTIFSAV  605



>gb|AFR40589.1| cellulase, partial [Populus nigra]
Length=131

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRK+ YVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKIXYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTXKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40578.1| cellulase, partial [Populus fremontii]
 gb|AFR40579.1| cellulase, partial [Populus fremontii]
 gb|AFR40580.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRANYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40581.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRXNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40588.1| cellulase, partial [Populus nigra]
Length=131

 Score =   189 bits (480),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRK  YVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKXXYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLV ALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVXALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_010448587.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=620

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FY+ + LRNF+ SQIDYILGKNPRKMSYVVGFG  YPK VHHRGAS
Sbjct  460  LEAADTPGWYCGPYFYTNEYLRNFSRSQIDYILGKNPRKMSYVVGFGQRYPKQVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP+N ++ +C GG+KW++SKK NPNI+ GAMVAGPD  DGFHDVRTNYNYTEPTLAGNAG
Sbjct  520  IPRN-MKESCTGGYKWKNSKKDNPNIIKGAMVAGPDKQDGFHDVRTNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSG+ +   IDKNT+FSAV
Sbjct  579  LVAALVALSGKEAVWGIDKNTMFSAV  604



>gb|EMS51342.1| Endoglucanase 9 [Triticum urartu]
Length=694

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG+G HYPK VHHRGAS
Sbjct  534  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGYGKHYPKRVHHRGAS  593

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF D+R N NYTEPTLAGNA
Sbjct  594  IPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDIRKNRNYTEPTLAGNA  653

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  654  GLVAALVALSGE-GHGVDKNTMFSAV  678



>ref|XP_010277803.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=615

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A D PGW+CGPN+ + D+LR FA SQIDYILGKNP KMSYVVG+G+ YPKHVHHRGAS
Sbjct  455  MNATDVPGWFCGPNYIASDVLRQFATSQIDYILGKNPLKMSYVVGYGSKYPKHVHHRGAS  514

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+C GGWKWRDS+ PNPN +VGAMV GPD  D F DVRTNYNYTEPTLAGNAG
Sbjct  515  IPHDHNKYSCTGGWKWRDSRNPNPNTIVGAMVGGPDRFDQFRDVRTNYNYTEPTLAGNAG  574

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+G     IDKNTIFSAV
Sbjct  575  LVAALVSLTGSAGGGIDKNTIFSAV  599



>gb|EMT18790.1| Endoglucanase 9 [Aegilops tauschii]
Length=604

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGAS
Sbjct  444  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGAS  503

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNA
Sbjct  504  IPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNA  563

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  564  GLVAALVALSGE-GHGVDKNTMFSAV  588



>gb|AGK26801.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGAS
Sbjct  462  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGAS  521

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNA
Sbjct  522  IPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNA  581

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  582  GLVAALVALSGE-GHGVDKNTMFSAV  606



>gb|AGK26803.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGAS
Sbjct  462  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGAS  521

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNA
Sbjct  522  IPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNA  581

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  582  GLVAALVALSGE-GHGVDKNTMFSAV  606



>gb|AGK26798.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26799.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26800.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGAS
Sbjct  462  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGAS  521

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNA
Sbjct  522  IPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNA  581

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  582  GLVAALVALSGE-GHGVDKNTMFSAV  606



>gb|AGK26802.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGAS
Sbjct  462  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGAS  521

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K V   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNA
Sbjct  522  IPKKKGVHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNA  581

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  582  GLVAALVALSGE-GHGVDKNTMFSAV  606



>ref|XP_010439066.1| PREDICTED: endoglucanase 21 [Camelina sativa]
Length=618

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP FY+ + LRNF+ SQIDYILGKNPRKMSYVVGFG  YPK VHHRGAS
Sbjct  458  LEAADTPGWYCGPYFYTNEYLRNFSRSQIDYILGKNPRKMSYVVGFGQRYPKQVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP+N ++ +C GG KW  SKK NPNI+ GAMVAGPD HDGFHDVRTNYNYTEPTLAGNAG
Sbjct  518  IPRN-MKESCTGGSKWEKSKKDNPNIIKGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAG  576

Query  394  lvaalvaLSGERST-RIDKNTIFSAV  320
            LVAALVALSG+ +   IDKNT+FSAV
Sbjct  577  LVAALVALSGKEAVWGIDKNTMFSAV  602



>emb|CDY45056.1| BnaA08g02190D [Brassica napus]
Length=540

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+D PGW CGPNFY   +LR+F+ SQIDYILGKNP+ MSYVVGFG  YPK VHHRGAS
Sbjct  382  LDASDTPGWSCGPNFYLTYVLRDFSRSQIDYILGKNPQNMSYVVGFGERYPKRVHHRGAS  441

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN+ + +CKGGWKWR+S K NPN++ GAMVAGPD HDGFHDVRTN NYTEPTL GNAG
Sbjct  442  IPKNR-KESCKGGWKWRESSKENPNVIEGAMVAGPDGHDGFHDVRTNSNYTEPTLTGNAG  500

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            L+AALVALSG++   +DKN IFSA+
Sbjct  501  LIAALVALSGQKDN-LDKNGIFSAI  524



>dbj|BAK04500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AAD PGWYCGP+FYS+++LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGAS
Sbjct  462  LEAADTPGWYCGPHFYSIEVLRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGAS  521

Query  574  IPKNK-VRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagna  398
            IPK K +   CKGGW WRD+KKPNP+I+VGAMVAGPD HDGF D+R N NYTEPTLAGNA
Sbjct  522  IPKKKGIHPGCKGGWTWRDTKKPNPHIIVGAMVAGPDRHDGFKDIRKNRNYTEPTLAGNA  581

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
            GLVAALVALSGE    +DKNT+FSAV
Sbjct  582  GLVAALVALSGE-GHGVDKNTMFSAV  606



>emb|CAN68337.1| hypothetical protein VITISV_025978 [Vitis vinifera]
Length=616

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  697  ILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDS  518
            ++     ++IDYILGKNPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS
Sbjct  475  VINIVGTNKIDYILGKNPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDS  534

Query  517  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  338
             KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKN
Sbjct  535  SKPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKN  594

Query  337  TIFSAV  320
            TIFSAV
Sbjct  595  TIFSAV  600



>gb|EPS66085.1| hypothetical protein M569_08689 [Genlisea aurea]
Length=615

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AAD PGWYCGP FY VD+LR F+ +QI+YILG+NPRK SYVVGFG+ YP HVHHRGAS
Sbjct  455  MRAADIPGWYCGPQFYPVDVLREFSSTQINYILGRNPRKTSYVVGFGSRYPTHVHHRGAS  514

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN+ + +C GGWKWRD  KPNPN++ GAMVAGPD HDGF DVRTNYNYTEPTLAGNAG
Sbjct  515  IPKNR-KASCAGGWKWRDGPKPNPNVIRGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAG  573

Query  394  lvaalvaLSGE-RSTRIDKNTIFSAV  320
            LVAAL++LS       +DKNT+FSAV
Sbjct  574  LVAALISLSSSGDGVGVDKNTMFSAV  599



>ref|XP_008342152.1| PREDICTED: endoglucanase 9-like [Malus domestica]
Length=511

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  748  AADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIP  569
            A  APGW+CG NFY  + LR FA +QIDYI+GKNPR +SY+VGFG  +P+ VHHRGASIP
Sbjct  353  AISAPGWHCGSNFYPTEELRRFARTQIDYIIGKNPRGISYIVGFGERFPQQVHHRGASIP  412

Query  568  KNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglv  389
            KNK++Y CKGG KWRDSKKPNPNI+VGAMVAGPD HD F DVR+NYNYTEPTLAGNAGLV
Sbjct  413  KNKIKYGCKGGLKWRDSKKPNPNIIVGAMVAGPDEHDNFQDVRSNYNYTEPTLAGNAGLV  472

Query  388  aalvaLSGERSTRIDKNTIFSAV  320
            AALVALS      +DKN++F AV
Sbjct  473  AALVALSTGNPAGVDKNSMFYAV  495



>gb|AFR40591.1| cellulase, partial [Populus nigra]
Length=131

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRK  YVVGFGNHYPKHVHHRGASIPKN +RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKXXYVVGFGNHYPKHVHHRGASIPKNXIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFXDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_006403190.1| hypothetical protein EUTSA_v10003366mg, partial [Eutrema salsugineum]
 gb|ESQ44643.1| hypothetical protein EUTSA_v10003366mg, partial [Eutrema salsugineum]
Length=528

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+D PGW CGP FY+   LR+FA SQIDYILGKNP+ MSYVVGFG  YPKHVHHRGAS
Sbjct  368  LHASDIPGWNCGPTFYATHDLRDFARSQIDYILGKNPQNMSYVVGFGERYPKHVHHRGAS  427

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTla-gna  398
            IPKN+ + +CKGGWKWRDSK+ NPN + GAMVAGPD HDGFHDVR NYNYTEPTL     
Sbjct  428  IPKNE-KVSCKGGWKWRDSKQENPNTIEGAMVAGPDKHDGFHDVRANYNYTEPTLTGNAG  486

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
             + A + ALS E   + D N++FSA+
Sbjct  487  LVTAVVAALSAEDKLKFDPNSMFSAL  512



>ref|XP_009339798.1| PREDICTED: endoglucanase 9-like [Pyrus x bretschneideri]
Length=618

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  748  AADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIP  569
            A  APGW+CG NFY  + LR FA +QIDYI+GKNPR +SY+VGFG  +P+ VHHRGASIP
Sbjct  460  AISAPGWHCGSNFYPTEELRRFARTQIDYIIGKNPRGISYIVGFGERFPQQVHHRGASIP  519

Query  568  KNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglv  389
            KNK++Y CKGG KWRDSKKPNPNI+VGAMVAGPD HD F DVR+NYNYTEPTLAGNAGLV
Sbjct  520  KNKIKYGCKGGLKWRDSKKPNPNIIVGAMVAGPDEHDNFQDVRSNYNYTEPTLAGNAGLV  579

Query  388  aalvaLSGERSTRIDKNTIFSAV  320
            AALVALS      +DKN++F AV
Sbjct  580  AALVALSTGNPAGVDKNSMFYAV  602



>ref|XP_002960146.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
 gb|EFJ37685.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
Length=620

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A D PGWYCG  FY+ D +RNFA+SQ+DYILGKNPRKMSYVVG+GN YPK VHHR AS
Sbjct  459  MIAGDVPGWYCGSQFYTADTMRNFAKSQVDYILGKNPRKMSYVVGYGNKYPKQVHHRAAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK +Y C+ GW++RDSKK NPN +VGAMV GPD  D FHDVR+NYN+TEPTLAGNAG
Sbjct  519  IPKNKRKYGCQEGWRFRDSKKANPNTIVGAMVGGPDTKDRFHDVRSNYNFTEPTLAGNAG  578

Query  394  lvaalvaLS-GERSTRIDKNTIFSAV  320
            L  ALVALS G+ S+ +D + IFSA+
Sbjct  579  LAFALVALSGGDSSSGVDASNIFSAI  604



>gb|AFR40586.1| cellulase, partial [Populus nigra]
Length=126

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YILGKNPRK  YVVGFGNHYPKHVHHRGASIPKN +RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKXXYVVGFGNHYPKHVHHRGASIPKNXIRYNCKGGWKWRDTMKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSA  323
            MVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSA
Sbjct  61   MVAGPDRHDGFXDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSA  114



>gb|AFR40583.1| cellulase, partial [Populus nigra]
Length=122

 Score =   181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            Y  GKNPRK   VVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YXXGKNPRKXXXVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTMKPNPNTLVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_006444448.1| hypothetical protein CICLE_v10024241mg [Citrus clementina]
 gb|ESR57688.1| hypothetical protein CICLE_v10024241mg [Citrus clementina]
Length=610

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A++ PG +CGP FY+    R+FA++Q+DYILGKNP+ MSY+VGFG  +P+HV HRGAS
Sbjct  453  LEASEIPGCFCGPQFYTRTAFRSFAKTQMDYILGKNPQNMSYIVGFGTRFPQHVLHRGAS  512

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN ++YNC+GG KWRDS KPNPN+++GAMV GPD +DGF D R+NYNYTEPT+AGNAG
Sbjct  513  IPKNNIKYNCQGGRKWRDSAKPNPNVIIGAMVGGPDQNDGFLDSRSNYNYTEPTIAGNAG  572

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE++ +ID+NT+F A+
Sbjct  573  LVAALVALSGEKTAQIDRNTLFYAI  597



>ref|XP_002983992.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
 gb|EFJ15004.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
Length=610

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A D PGWYCG  FY+ D +RNFA+SQ+DYILGKNPRKMSYVVG+GN YPK VHHR AS
Sbjct  449  MIAGDVPGWYCGSQFYTADTMRNFAKSQVDYILGKNPRKMSYVVGYGNKYPKQVHHRAAS  508

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKNK +Y C+ GW++RDSKK NPN +VGAMV GPD  D FHDVR+NYN+TEPTLAGNAG
Sbjct  509  IPKNKRKYGCQEGWRFRDSKKANPNTIVGAMVGGPDTKDRFHDVRSNYNFTEPTLAGNAG  568

Query  394  lvaalvaLS-GERSTRIDKNTIFS  326
            L  ALVALS G+ S+ +D + IFS
Sbjct  569  LAFALVALSGGDSSSGVDASNIFS  592



>gb|KDO87072.1| hypothetical protein CISIN_1g046335mg [Citrus sinensis]
Length=613

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A++ PG +CGP FY+    R+FA++Q+DYILGKNP+ MSY+VGFG  +P+HV HRGAS
Sbjct  456  LEASEIPGCFCGPQFYTRTAFRSFAKTQMDYILGKNPQNMSYIVGFGTRFPQHVLHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP+N ++YNC+GG KWRDS KPNPN+++GAMV GPD +DGF D R+NYNYTEPT+AGNAG
Sbjct  516  IPRNNIKYNCQGGRKWRDSAKPNPNVIIGAMVGGPDQNDGFLDSRSNYNYTEPTIAGNAG  575

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE++ +ID+NT+F A+
Sbjct  576  LVAALVALSGEKTAQIDRNTLFYAI  600



>gb|EYU33245.1| hypothetical protein MIMGU_mgv1a022358mg, partial [Erythranthe 
guttata]
Length=423

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L+A+D  GWYCGP+FY+ D LR FAE QI YILG NPR M   VGFG+HYPKHVHHRG S
Sbjct  265  LSASDTGGWYCGPDFYTRDALRQFAEKQIGYILGANPRNM---VGFGDHYPKHVHHRGPS  321

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP + ++Y+CKGGW+WR+SKK NPN +VGAMVAGP  HDGF D+R NYNYTEP + GNAG
Sbjct  322  IPNDNIKYSCKGGWRWRNSKKSNPNTIVGAMVAGPYKHDGFEDLRENYNYTEPAITGNAG  381

Query  394  lvaa-lvaLSGERSTRIDKNTIFSAV  320
            LVAA LVALSG+ S+ ID+NT+FSAV
Sbjct  382  LVAAPLVALSGKESSGIDRNTVFSAV  407



>ref|XP_006480121.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
Length=610

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A++ PG +CGP FY+    R+FA++Q+DYILGKNP+ MSY+VGFG  +P+HV HRGAS
Sbjct  453  LEASEIPGCFCGPQFYTRTAFRSFAKTQMDYILGKNPQNMSYIVGFGTRFPQHVLHRGAS  512

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP+N ++YNC+GG KWRDS KPNPN+++GAMV GPD +DGF D R+NYNYTEPT+AGNAG
Sbjct  513  IPRNNIKYNCQGGRKWRDSAKPNPNVIIGAMVGGPDQNDGFLDSRSNYNYTEPTIAGNAG  572

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE++ +ID+NT+F A+
Sbjct  573  LVAALVALSGEKTAQIDRNTLFYAI  597



>ref|XP_002515321.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47305.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=598

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A    GW CG  FY+ + LRNFA SQIDYILGKNP  MSY+VGFG+H+P+  HHRGAS
Sbjct  438  LEANLVSGWQCGQEFYTNEALRNFARSQIDYILGKNPCDMSYIVGFGSHFPQQAHHRGAS  497

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +KV+Y CK GW+W+ S++PNPN ++GAMVAGPD  DGF D+R NYNYTEPT+AGNAG
Sbjct  498  IPNSKVKYRCKDGWQWQVSRRPNPNTIIGAMVAGPDKEDGFQDIRYNYNYTEPTIAGNAG  557

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            L+AALVAL+G R+++IDKNTIFSA+
Sbjct  558  LIAALVALTGGRTSKIDKNTIFSAI  582



>ref|XP_008235173.1| PREDICTED: endoglucanase 9-like [Prunus mume]
Length=605

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -3

Query  748  AADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIP  569
            A  APGWYCGP FYS   LR FA +QIDYILGKNPR +SYVVGF  H+P+HVHHRGASIP
Sbjct  447  AISAPGWYCGPTFYSNVELRRFARTQIDYILGKNPRGISYVVGFSEHFPQHVHHRGASIP  506

Query  568  KNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglv  389
             NK++Y CKGG KWR S+ PNPN +VGAMVAGPD HD F DVR NYNYTEP+L GNAGLV
Sbjct  507  HNKIKYGCKGGLKWRKSRTPNPNTIVGAMVAGPDKHDNFQDVRFNYNYTEPSLVGNAGLV  566

Query  388  aalvaLSGERSTRIDKNTIFSAV  320
            AALVALS    + ID+N++F AV
Sbjct  567  AALVALSSGTPSGIDRNSMFYAV  589



>emb|CBI18623.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGWYCGPNF   + LR+FA SQI+YILGKNP KMSY+VG+G  +PKHVHHRGAS
Sbjct  278  MNATSIPGWYCGPNFIRAETLRSFATSQINYILGKNPMKMSYLVGYGTKFPKHVHHRGAS  337

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+C GGWKWRDS+ PNP+ + GAMV GP   D F D+RTNYNYTEPTLAGNAG
Sbjct  338  IPNDNKKYSCTGGWKWRDSRNPNPHNITGAMVGGPIRTDNFQDIRTNYNYTEPTLAGNAG  397

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+G     IDKNTIFSAV
Sbjct  398  LVAALVSLTGSGGMSIDKNTIFSAV  422



>ref|XP_007199407.1| hypothetical protein PRUPE_ppa026228mg [Prunus persica]
 gb|EMJ00606.1| hypothetical protein PRUPE_ppa026228mg [Prunus persica]
Length=605

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -3

Query  748  AADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIP  569
            A  APGWYCGP FYS   LR FA +QIDYILGKNPR +SYVVGF  H+P+HVHHRGASIP
Sbjct  447  AISAPGWYCGPTFYSNVELRRFARTQIDYILGKNPRGISYVVGFSEHFPQHVHHRGASIP  506

Query  568  KNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglv  389
             NK++Y CKGG KW++S+ PNPN +VGAMVAGPD HD F DVR NYNYTEP+L GNAGLV
Sbjct  507  HNKIKYGCKGGLKWKNSRTPNPNTIVGAMVAGPDKHDNFQDVRFNYNYTEPSLVGNAGLV  566

Query  388  aalvaLSGERSTRIDKNTIFSAV  320
            AALVALS      ID+N++F AV
Sbjct  567  AALVALSSGTPAGIDRNSMFYAV  589



>ref|XP_010646848.1| PREDICTED: endoglucanase 12 [Vitis vinifera]
Length=529

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGWYCGPNF   + LR+FA SQI+YILGKNP KMSY+VG+G  +PKHVHHRGAS
Sbjct  369  MNATSIPGWYCGPNFIRAETLRSFATSQINYILGKNPMKMSYLVGYGTKFPKHVHHRGAS  428

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+C GGWKWRDS+ PNP+ + GAMV GP   D F D+RTNYNYTEPTLAGNAG
Sbjct  429  IPNDNKKYSCTGGWKWRDSRNPNPHNITGAMVGGPIRTDNFQDIRTNYNYTEPTLAGNAG  488

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+G     IDKNTIFSAV
Sbjct  489  LVAALVSLTGSGGMSIDKNTIFSAV  513



>ref|XP_008801082.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AA+ PGWYCGP ++S   LR+FA SQ+DYILG NP+KMSYVVG+G +YPKHVHHRGAS
Sbjct  458  MDAANVPGWYCGPYYFSTSSLRSFAASQVDYILGDNPKKMSYVVGYGKNYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y+C GG KW ++K PNPN++ GAMV GPD  DGF DVR NY YTEPTLAGNAG
Sbjct  518  IPDNGVKYSCTGGRKWLNAKSPNPNVITGAMVGGPDRSDGFVDVRKNYGYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      +DKNT+FSAV
Sbjct  578  LVAALVSLTSSGGAGVDKNTMFSAV  602



>gb|AFZ78629.1| korrigan [Populus tomentosa]
Length=621

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PG+ CGP F S+D+LRNFA SQI+YILG NP KMSYVVG+G  +P+HVHHRGAS
Sbjct  461  LNATRVPGFNCGPQFISLDVLRNFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P + VRY+C GGWKWRDS KPNP+ + GAMV GPD  D F DVRTNYN+TEPTLAGNAG
Sbjct  521  TPSDNVRYSCTGGWKWRDSSKPNPHNITGAMVGGPDRFDQFRDVRTNYNFTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      I+KN+IFSAV
Sbjct  581  LVAALVSLTSSGGIGINKNSIFSAV  605



>ref|XP_010065082.1| PREDICTED: endoglucanase 12 [Eucalyptus grandis]
 gb|KCW87984.1| hypothetical protein EUGRSUZ_A00393 [Eucalyptus grandis]
Length=629

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGW CGPNF + D LR+FA SQIDYILGKNP KMSYVVGFG  YPKHVHHRGAS
Sbjct  462  MNATGVPGWNCGPNFITSDTLRSFATSQIDYILGKNPMKMSYVVGFGAKYPKHVHHRGAS  521

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+C GGWKWRD++  NPN + GAMV GPD  D F DVRTNY+YTEPTLAGNAG
Sbjct  522  IPNDHKKYSCTGGWKWRDTRNNNPNTINGAMVGGPDRFDKFKDVRTNYSYTEPTLAGNAG  581

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      IDKN+IFSAV
Sbjct  582  LVAALVSLTESGGRAIDKNSIFSAV  606



>gb|AFR40582.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  664  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  485
            YI GKNPRKM  VVGFGNHYPKHVHHRGA IPKNK+RYNCKGG  WRD+ KPNPN  VGA
Sbjct  1    YIXGKNPRKMXXVVGFGNHYPKHVHHRGAXIPKNKIRYNCKGGXXWRDTTKPNPNXXVGA  60

Query  484  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            MVAGPD HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRXNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_010088713.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36894.1| Endoglucanase 25 [Morus notabilis]
Length=212

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -3

Query  673  QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNIL  494
            +IDYILG NPRKMSY+VGFG+HYPKHV HRGA IP N+++YNCKGGWKWRD+KKPNPN++
Sbjct  25   RIDYILGNNPRKMSYLVGFGSHYPKHVRHRGAFIPNNEIKYNCKGGWKWRDTKKPNPNVI  84

Query  493  VGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
            VGAMVAGPD  DGFHDVRTNYNY EPTLAGNAGL+AALVALSGE++   DK+ IFSAV
Sbjct  85   VGAMVAGPDKDDGFHDVRTNYNYAEPTLAGNAGLIAALVALSGEKNVG-DKSAIFSAV  141



>ref|XP_009141938.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
Length=566

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 118/145 (81%), Gaps = 3/145 (2%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+D  GW CGPN Y  ++LR+F+ SQ+DYILGKNP  +SYVVG+G  YPKHVHHRGAS
Sbjct  409  LEASDTRGWSCGPNVYFTNVLRDFSRSQVDYILGKNPENISYVVGYGERYPKHVHHRGAS  468

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IPKN+ + +CKGGWKWR+S K NPN++ GAMVAGPD HD FHDVRT  NYTEPTL GNAG
Sbjct  469  IPKNR-KESCKGGWKWRESSKENPNVIEGAMVAGPDGHDVFHDVRTA-NYTEPTLTGNAG  526

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVALSGE+   +DKN +FS V
Sbjct  527  LVAALVALSGEKHM-LDKNRMFSGV  550



>gb|KHN40215.1| Endoglucanase 25 [Glycine soja]
Length=122

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -3

Query  637  MSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHD  458
            MSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGPD HD
Sbjct  1    MSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGPDKHD  60

Query  457  GFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  320
             FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT+FSAV
Sbjct  61   HFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTLFSAV  106



>ref|XP_002514768.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47322.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=624

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+  PG  CGPNF S+  LR FA SQIDYILGKNP  MSYVVG+G  +P+HVHHR AS
Sbjct  464  LNASGIPGLNCGPNFISLVDLRTFATSQIDYILGKNPMNMSYVVGYGTKFPRHVHHRAAS  523

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K RY+C GGWKWRDS+ PNPN + GAMV GPD  D FHDVRT+YNYTEPTLAGNAG
Sbjct  524  IPHDKKRYSCTGGWKWRDSRNPNPNNITGAMVGGPDRFDKFHDVRTSYNYTEPTLAGNAG  583

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKNTIFSAV
Sbjct  584  LVAALASLTVSGGHGIDKNTIFSAV  608



>ref|XP_002312211.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE89578.1| endo-1 family protein [Populus trichocarpa]
 gb|AEO97187.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97214.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=620

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PG  CGP F S+D+LR+FA SQI+YILG NP KMSYVVG+G  +P+HVHHRGAS
Sbjct  460  LNATRVPGLNCGPKFISLDLLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P +K RY+C GGWKWRDS KPNP+ + GAMV GPD  D F DVRTNYN+TEPTLAGNAG
Sbjct  520  TPSDKTRYSCTGGWKWRDSSKPNPHNITGAMVGGPDRFDQFRDVRTNYNFTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKN+IF+AV
Sbjct  580  LVAALASLTSSGGIGIDKNSIFTAV  604



>gb|KDP28223.1| hypothetical protein JCGZ_13994 [Jatropha curcas]
Length=564

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -3

Query  733  GWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVR  554
            GW CG NFY+ + LR+ A  QI+YILGKN + +SYVVGFGNH+P+HVHHRGASIP +KV+
Sbjct  422  GWQCGANFYTTETLRDLARKQINYILGKNHQSISYVVGFGNHFPQHVHHRGASIPNDKVK  481

Query  553  YNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalva  374
            Y C+GGWKWR++++PNPNI+VGAMV GPD  D F D+R+NYNYTE T+AGNAGLVAALVA
Sbjct  482  YGCEGGWKWRNTRRPNPNIIVGAMVGGPDQRDDFQDIRSNYNYTESTIAGNAGLVAALVA  541

Query  373  LSG--ERSTRIDKNTIFSAV  320
            LS     S+ IDKNTIF A+
Sbjct  542  LSDGPGNSSEIDKNTIFYAI  561



>ref|XP_006448516.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
 gb|ESR61756.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
Length=637

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+ APG+ CGPNF ++  LR+F+ SQIDYILGKNP KMSYVVG+G  +P+HVHHRGAS
Sbjct  477  LNASGAPGFTCGPNFITLAKLRSFSTSQIDYILGKNPTKMSYVVGYGKKFPRHVHHRGAS  536

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+CKGGWKW ++ KPNP+ + GAMVAGPD  D FHDVRTN+NYTEPTLAGNAG
Sbjct  537  IPSDGKKYSCKGGWKWSNNPKPNPHNITGAMVAGPDRFDKFHDVRTNHNYTEPTLAGNAG  596

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKNT+FSA+
Sbjct  597  LVAALASLTTSAGIGIDKNTMFSAI  621



>gb|KDO77086.1| hypothetical protein CISIN_1g013288mg [Citrus sinensis]
Length=446

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+ APG+ CGPNF ++  LR+FA SQI YILGKNP KMSYVVG+G  +P+HVHHRGAS
Sbjct  286  LNASGAPGFTCGPNFITLAKLRSFATSQIGYILGKNPMKMSYVVGYGKQFPRHVHHRGAS  345

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+CKGGWKW ++ KPNP+ + GAMVAGPD  D F+DVRTN+NYTEPTLAGNAG
Sbjct  346  IPSDGKKYSCKGGWKWSNNPKPNPHNITGAMVAGPDRFDKFNDVRTNHNYTEPTLAGNAG  405

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKNT+FSA+
Sbjct  406  LVAALASLTTSAGIGIDKNTMFSAI  430



>gb|KDP32490.1| hypothetical protein JCGZ_13415 [Jatropha curcas]
Length=623

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A+  PG+ CGP F  +D L+ FA SQIDYILGKNP  MSYVVG+G  +P+HVHHRGAS
Sbjct  463  MNASGIPGFVCGPKFVLLDELQTFANSQIDYILGKNPMNMSYVVGYGTKFPRHVHHRGAS  522

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K RY+CKGGWKWRD++ PNPN + GAMV GPD  D FHDVR+NYN +EPTLAGNAG
Sbjct  523  IPHDKNRYSCKGGWKWRDTRNPNPNNITGAMVGGPDRFDKFHDVRSNYNSSEPTLAGNAG  582

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKNTIFSAV
Sbjct  583  LVAALASLTSSGGFGIDKNTIFSAV  607



>ref|XP_006858738.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
 gb|ERN20205.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
Length=619

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGW+CGP ++S  +LR FA+SQI+YILG NPRKMSYVVG+G++YPKHVHHRGAS
Sbjct  460  MNATGVPGWFCGPYYFSAIVLRQFAQSQINYILGDNPRKMSYVVGYGSNYPKHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N+ +  C GGWKWRDS  PNPN + GAMV GPD  D F DVR+NYNYTEPTLAGNAG
Sbjct  520  IPNNQ-KTTCTGGWKWRDSNNPNPNTITGAMVGGPDRFDQFRDVRSNYNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++L+G     ID N IFS +
Sbjct  579  LVAALISLTGSGGGGIDTNKIFSGI  603



>ref|XP_011010912.1| PREDICTED: endoglucanase 12 [Populus euphratica]
 ref|XP_011010993.1| PREDICTED: endoglucanase 12 [Populus euphratica]
Length=620

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PG+ CGP F S+D+LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGAS
Sbjct  460  LNATRIPGFNCGPRFISLDLLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P +  RY+C GGWKWRDS KPNP+ + GAMV GPD  D F DVRTNYN+TEPTLAGNAG
Sbjct  520  TPSDNTRYSCTGGWKWRDSSKPNPHNITGAMVGGPDRFDRFRDVRTNYNFTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKN+IFSAV
Sbjct  580  LVAALASLTSSGGIGIDKNSIFSAV  604



>gb|ACF87544.1| unknown [Zea mays]
 gb|ACN34482.1| unknown [Zea mays]
Length=450

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A + PGWYCGPNF + + LR FA SQ++YILG NP+KMSYVVGFG+ YP+HVHHRGAS
Sbjct  286  MEAVNVPGWYCGPNFMTTNDLREFARSQVNYILGDNPKKMSYVVGFGSKYPRHVHHRGAS  345

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P N V+Y+C GG+KWRDSKK +PN+L GAMV GPD +DGF D R  +   EPTL GNAG
Sbjct  346  TPHNGVKYSCTGGYKWRDSKKADPNLLAGAMVGGPDKNDGFKDSRNTFGQNEPTLVGNAG  405

Query  394  lvaalvaLS----GERSTRIDKNTIFSAV  320
            LVAALVAL+    G   T +DKNT+FSAV
Sbjct  406  LVAALVALTNSGRGAGVTTVDKNTMFSAV  434



>ref|XP_004250089.1| PREDICTED: endoglucanase 12 [Solanum lycopersicum]
Length=635

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PGWYCGP F +++ LR+FA  Q++YILG+NP KMSY+VG+G+ +PKHVHHRGAS
Sbjct  475  LNATGVPGWYCGPFFITLEDLRSFATFQMNYILGENPLKMSYIVGYGDKFPKHVHHRGAS  534

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP  K +Y+C GGW+WRD+KKPN + + GAMV GPD  D F D+RTN++YTEPTLAGNAG
Sbjct  535  IPTGKTKYSCTGGWRWRDTKKPNVHNMTGAMVGGPDKFDKFKDLRTNFSYTEPTLAGNAG  594

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+G     IDKNTIFSAV
Sbjct  595  LVAALVSLTGTGGYGIDKNTIFSAV  619



>ref|XP_006468640.1| PREDICTED: endoglucanase 12-like [Citrus sinensis]
Length=637

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+ APG+ CGPNF ++  LR+FA SQI YILGKNP KMSYVVG+G  +P+HVHHRGAS
Sbjct  477  LNASGAPGFTCGPNFITLAKLRSFATSQIGYILGKNPMKMSYVVGYGKQFPRHVHHRGAS  536

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +  +Y+CKGGWKW ++ KPNP+ + GAMVAGPD  D FHDVRTN+NYTEPTLAGNAG
Sbjct  537  IPSDGKKYSCKGGWKWSNNPKPNPHNITGAMVAGPDRFDKFHDVRTNHNYTEPTLAGNAG  596

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKNT+FSA+
Sbjct  597  LVAALASLTTSAGIGIDKNTMFSAI  621



>ref|XP_004502103.1| PREDICTED: endoglucanase 12-like [Cicer arietinum]
Length=620

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGW CGPN++ + +L+ FA SQ+DYI+GKNP  MSY+VG+GN++P+HVHHRGAS
Sbjct  460  MEARGIPGWNCGPNYFPISVLKTFATSQMDYIMGKNPMNMSYIVGYGNNFPRHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             PK+   Y+C GGWKWRD+ KPNP+ + GAMV GP+  D FHD R NYNYTEPTLAGNAG
Sbjct  520  TPKDHKHYSCTGGWKWRDTHKPNPHNITGAMVGGPNRFDQFHDSRINYNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++L+   ST ID NTIFSA+
Sbjct  580  LVAALISLTSTPSTGIDINTIFSAI  604



>tpg|DAA36812.1| TPA: hypothetical protein ZEAMMB73_340402, partial [Zea mays]
Length=496

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A + PGWYCGPNF + + LR FA SQ++YILG NP+KMSYVVGFG+ YP+HVHHRGAS
Sbjct  332  MEAVNVPGWYCGPNFMTTNDLREFARSQVNYILGDNPKKMSYVVGFGSKYPRHVHHRGAS  391

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P N V+Y+C GG+KWRDSKK +PN+L GAMV GPD +DGF D R  +   EPTL GNAG
Sbjct  392  TPHNGVKYSCTGGYKWRDSKKADPNLLAGAMVGGPDKNDGFKDSRNTFGQNEPTLVGNAG  451

Query  394  lvaalvaLS----GERSTRIDKNTIFSAV  320
            LVAALVAL+    G   T +DKNT+FSAV
Sbjct  452  LVAALVALTNSGRGAGVTTVDKNTMFSAV  480



>ref|XP_011077092.1| PREDICTED: endoglucanase 12 [Sesamum indicum]
Length=620

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+  PGW CGP+F  + +L++FA SQ++YILG NP  MSYVVG+G  YP+HVHHRGAS
Sbjct  460  LNASGIPGWNCGPDFVPLTVLKDFATSQMNYILGANPMNMSYVVGYGPKYPRHVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP NKV+Y+C GGW+WRD+  PNPN + GAMV GPD  D F DVRTNY+YTEPT+AGNAG
Sbjct  520  IPNNKVKYSCTGGWRWRDAATPNPNTISGAMVGGPDRFDNFRDVRTNYSYTEPTVAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      +DKNTIF+ V
Sbjct  580  LVAALVSLTSSGGIGVDKNTIFTNV  604



>ref|XP_004976098.1| PREDICTED: endoglucanase 12-like [Setaria italica]
Length=623

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AA+ PGWYCGPNF S + LR FA+SQ++YILG NPRKMSYVVGFG  YP+H+HHRGAS
Sbjct  459  MEAANVPGWYCGPNFMSTNDLRAFAKSQLNYILGDNPRKMSYVVGFGKKYPRHLHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             PKN V+Y+C GG+KWRDSKK +PN+L GAMV GPD +DGF D R +Y   EPTL GNAG
Sbjct  519  TPKNGVKYSCTGGYKWRDSKKADPNLLTGAMVGGPDKNDGFKDSRNSYGQNEPTLVGNAG  578

Query  394  lvaalvaLS----GERSTRIDKNTIFS  326
            LVAALVA++    G   T +DKNT+FS
Sbjct  579  LVAALVAITNSGRGVGVTAVDKNTMFS  605



>ref|XP_007146006.1| hypothetical protein PHAVU_006G0049001g, partial [Phaseolus vulgaris]
 gb|ESW18000.1| hypothetical protein PHAVU_006G0049001g, partial [Phaseolus vulgaris]
Length=495

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            +     PGWYCG  ++ V +L+ FA SQ+DYILGKNP KMSY+VGFGN +P+HVHHRGAS
Sbjct  331  MQGVGVPGWYCGSTYFPVSVLKKFATSQVDYILGKNPMKMSYIVGFGNKFPRHVHHRGAS  390

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTla-gna  398
            IP +   ++C GGWKWRD+   NPN + GAMV GPD  D FHD R NYN+TEPTLA    
Sbjct  391  IPNDHKHHSCTGGWKWRDTSNNNPNTITGAMVGGPDRFDQFHDSRKNYNFTEPTLAGNAG  450

Query  397  glvaalvaLSGERSTRIDKNTIFSAV  320
             + A +   S   S+ ID+NTIFSA+
Sbjct  451  IVAALISLTSTTGSSVIDRNTIFSAI  476



>ref|XP_007028162.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
 gb|EOY08664.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
Length=619

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PGW C   F+S + LRNFA SQ+DYILGKNP  MSYVVG+   +P+HVHHRGAS
Sbjct  459  LNATGVPGWNCNSRFFSSEYLRNFATSQVDYILGKNPMNMSYVVGYDKKFPRHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N ++Y+C GGWKWRDS+ PNPN + GAMV GPD  D F DVRTN NYTEPTLAGNAG
Sbjct  519  IPHNNIKYSCTGGWKWRDSQNPNPNNITGAMVGGPDRFDHFRDVRTNSNYTEPTLAGNAG  578

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            L+AAL +L+      IDKNTIFSAV
Sbjct  579  LIAALASLTRSGGHGIDKNTIFSAV  603



>emb|CDP21162.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A + PGWYCG +F S D++R FA SQ+DYILGKNP  MSYVVG+G  +PKHVHHRGAS
Sbjct  458  MNATNVPGWYCGSSFMSQDVIREFAASQMDYILGKNPLNMSYVVGYGKKFPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P N V+ +C GGWKWRDS+ PNPN + GAMV GPD  D F DVR +Y+YTEPTLAGNAG
Sbjct  518  TPHN-VKTSCTGGWKWRDSRNPNPNTITGAMVGGPDKFDKFQDVRKSYSYTEPTLAGNAG  576

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      +D+NTIFSAV
Sbjct  577  LVAALVSLTSTAGNGVDRNTIFSAV  601



>ref|XP_010930303.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=618

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AA+ PGWYCGP ++S   LR+FA SQ++YILG NP+KMSYVVG+GN YPK VHHRGAS
Sbjct  458  MDAANVPGWYCGPFYFSTSSLRSFAASQMNYILGDNPKKMSYVVGYGNKYPKQVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y+C GG KW  +K  NPN++ GAMV GPD  DGF DVR +Y YTEPTLAGNAG
Sbjct  518  IPDNGVKYSCTGGRKWLYAKSSNPNVITGAMVGGPDRFDGFMDVRKDYGYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      +DKNTIFSAV
Sbjct  578  LVAALVSLTSSGGAGVDKNTIFSAV  602



>ref|NP_001147970.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|ACG29288.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
Length=623

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A + PGWYCGPNF + + LR FA SQ++YILG NP+KMSYVVGFG+ YP+HVHHRGAS
Sbjct  459  MEAVNVPGWYCGPNFMTTNDLREFARSQVNYILGDNPKKMSYVVGFGSKYPRHVHHRGAS  518

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
             P N V+Y+C GG+KWRDSKK +PN+L GAMV GPD +DGF D R  +   EPTL GNAG
Sbjct  519  TPHNGVKYSCTGGYKWRDSKKADPNLLAGAMVGGPDKNDGFKDSRNTFGQNEPTLVGNAG  578

Query  394  lvaalvaLS----GERSTRIDKNTIFSAV  320
            LVAALVAL+    G   T +DKNT+FSAV
Sbjct  579  LVAALVALTNSGRGAGVTTVDKNTMFSAV  607



>ref|XP_010912745.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=446

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AA+ PGWYCGP ++  + LR+FA SQ++YILG NP+KMSYVVG+G +YPKHVHHRGAS
Sbjct  286  MDAANVPGWYCGPYYFPTNSLRSFAASQVNYILGDNPKKMSYVVGYGKNYPKHVHHRGAS  345

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP + V+Y+C  GWKW  +K PNPN++ GAMV GPD  DGF D R +Y YTEPTLAGNAG
Sbjct  346  IPDDGVKYSCTIGWKWFHAKSPNPNVITGAMVGGPDRFDGFKDARQSYGYTEPTLAGNAG  405

Query  394  lvaalvaLSGERSTRIDKNTIFS  326
            LVAALV+++      +DKNT+FS
Sbjct  406  LVAALVSVTSSGGAGVDKNTMFS  428



>ref|XP_009602898.1| PREDICTED: endoglucanase 12 [Nicotiana tomentosiformis]
Length=635

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A+  PGW CGP + S+DILR FA SQ++YILG NP KMSYVVG+GN +P+HVHHRGAS
Sbjct  475  MNASGVPGWNCGPRYISLDILRRFATSQMNYILGDNPLKMSYVVGYGNKFPRHVHHRGAS  534

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP  K +Y+C GGWKWRD+K PNP+ + GAMV GPD  D F D R N++YTEPTLAGNAG
Sbjct  535  IPSGKTKYSCTGGWKWRDTKNPNPHNITGAMVGGPDKFDKFKDARKNFSYTEPTLAGNAG  594

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      +DKN IFSAV
Sbjct  595  LVAALVSLTSSGGYGVDKNAIFSAV  619



>ref|XP_009385674.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L AA+ PG+YCGP ++S D LR+FA SQ++YILG NP KMSYVVG+G +YPKHVHHRGAS
Sbjct  456  LDAANIPGYYCGPYYFSADSLRSFATSQVNYILGDNPMKMSYVVGYGRNYPKHVHHRGAS  515

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y+C GGWKWRD+K  NPN + GAMV GPD  D F D R NYNYTEPTLAGNAG
Sbjct  516  IPHNGVKYSCTGGWKWRDAKTANPNTITGAMVGGPDRFDRFSDSRPNYNYTEPTLAGNAG  575

Query  394  lvaalvaLSGERSTR-IDKNTIFSAV  320
            LVAALV+L+   S+  +D NTIFSAV
Sbjct  576  LVAALVSLTSTSSSSGVDTNTIFSAV  601



>ref|XP_009782313.1| PREDICTED: endoglucanase 12 [Nicotiana sylvestris]
Length=634

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGW CGP + S+D+LR FA SQ++YILG NP KMSYVVG+GN +P+HVHHRGAS
Sbjct  474  MNATGVPGWNCGPTYISLDVLRRFATSQMNYILGDNPLKMSYVVGYGNKFPRHVHHRGAS  533

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP  K +Y+C GGWKWRD+  PNP+ + GAMV GPD  D F D R N++YTEPTLAGNAG
Sbjct  534  IPSGKTKYSCTGGWKWRDTSNPNPHNITGAMVGGPDKFDRFKDARKNFSYTEPTLAGNAG  593

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      +DKNTIFSAV
Sbjct  594  LVAALVSLTSSGGYGVDKNTIFSAV  618



>ref|XP_010528623.1| PREDICTED: endoglucanase 7 [Tarenaya hassleriana]
Length=632

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGWYCGP F S  +L+ FA SQ+DYILGKNP  MS+VVGFG+ +P+HVHHRGA+
Sbjct  472  MNATGVPGWYCGPTFISNVVLKQFATSQVDYILGKNPLNMSFVVGFGSKFPRHVHHRGAT  531

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP ++ R +C  GW+WRD+K PNPN +VGAMV GP++ D FHD+R NYN +EPTLAGN+G
Sbjct  532  IPSDRKRRSCSEGWQWRDTKNPNPNNIVGAMVGGPNSFDQFHDLRHNYNASEPTLAGNSG  591

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+   S  IDKNTIF+AV
Sbjct  592  LVAALVSLTNSESHGIDKNTIFNAV  616



>ref|XP_011014628.1| PREDICTED: endoglucanase 12-like isoform X3 [Populus euphratica]
Length=549

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+  PG+ CG  F  +D+LR+FA SQI+YILG NP KMSYVVG+G  +P+HVHHRGAS
Sbjct  389  LNASRVPGFQCGSKFIPLDVLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGAS  448

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K  Y+C GGWKWRDS KPNPN + GAMV GPD +D F DVR NYN+TEPTLAGNAG
Sbjct  449  IPNDKRTYSCTGGWKWRDSPKPNPNNITGAMVGGPDRYDRFRDVRKNYNFTEPTLAGNAG  508

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKN +FSAV
Sbjct  509  LVAALSSLTSSGGVGIDKNRMFSAV  533



>ref|XP_010929679.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=619

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L  ++ PGWYCGP F +   L  FA SQ+DYILG NP+ +SYVVG+G +YP+ VHHRGAS
Sbjct  460  LNTSNIPGWYCGPYFMNSRTLYGFAASQVDYILGNNPKNISYVVGYGKNYPRQVHHRGAS  519

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +++ Y+C  GWKWRDSK PNPN++ GAMV GP+  DGF DVR N NYTEPTLAGNAG
Sbjct  520  IPHDRIAYSCTAGWKWRDSKSPNPNVITGAMVGGPNRFDGFSDVRNNKNYTEPTLAGNAG  579

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            L+AALV+L+     RIDKN IFS+V
Sbjct  580  LIAALVSLTSSGGDRIDKNAIFSSV  604



>ref|XP_003601506.1| Endoglucanase [Medicago truncatula]
 gb|AES71757.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=624

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + A   PGWYCGPNF+ + +L++FA SQ+DYI+GKNP  MSY+VG+G  +P+HVHHRGAS
Sbjct  464  MEAKGVPGWYCGPNFFPISVLKSFATSQMDYIMGKNPMNMSYIVGYGEKFPRHVHHRGAS  523

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +   Y+C GGWKWRDS   NPN + GAMV GP+  D FHD R NYNYTEPTLAGNAG
Sbjct  524  IPNDHKNYSCTGGWKWRDSPDRNPNNVTGAMVGGPNPFDQFHDSRKNYNYTEPTLAGNAG  583

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++L+    + ID NTIF A+
Sbjct  584  LVAALISLTSTTGSGIDVNTIFEAI  608



>ref|XP_006353239.1| PREDICTED: endoglucanase 12-like [Solanum tuberosum]
Length=634

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PGWYCGP F ++D LR+FA  Q++YILG+NP KMSY+VG+G+ +P HVHHRGAS
Sbjct  474  LNATGVPGWYCGPFFITLDKLRSFATFQMNYILGENPLKMSYIVGYGDKFPNHVHHRGAS  533

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP  K +Y+C GGW+WRD+K PN + + GAMV GPD  D F DVR N++YTEPTLAGNAG
Sbjct  534  IPTGKTKYSCTGGWRWRDTKNPNVHNITGAMVGGPDKFDKFKDVRANFSYTEPTLAGNAG  593

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+G     IDKNT+FSAV
Sbjct  594  LVAALVSLTGTGGYGIDKNTMFSAV  618



>ref|XP_011014603.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014609.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014618.1| PREDICTED: endoglucanase 12-like isoform X2 [Populus euphratica]
Length=621

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+  PG+ CG  F  +D+LR+FA SQI+YILG NP KMSYVVG+G  +P+HVHHRGAS
Sbjct  461  LNASRVPGFQCGSKFIPLDVLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K  Y+C GGWKWRDS KPNPN + GAMV GPD +D F DVR NYN+TEPTLAGNAG
Sbjct  521  IPNDKRTYSCTGGWKWRDSPKPNPNNITGAMVGGPDRYDRFRDVRKNYNFTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKN +FSAV
Sbjct  581  LVAALSSLTSSGGVGIDKNRMFSAV  605



>ref|XP_002315101.2| hypothetical protein POPTR_0010s18480g [Populus trichocarpa]
 gb|EEF01272.2| hypothetical protein POPTR_0010s18480g [Populus trichocarpa]
Length=505

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PG+ CG  F  +D+LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGAS
Sbjct  345  LNATRVPGFQCGSKFIPLDVLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGAS  404

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K  Y+C GGWKWRDS KPNPN + GAMV GPD  D F DVR NYN+TEPTLAGNAG
Sbjct  405  IPNDKRSYSCTGGWKWRDSPKPNPNNITGAMVGGPDRFDRFRDVRKNYNFTEPTLAGNAG  464

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKN +FSAV
Sbjct  465  LVAALSSLTSSGGIGIDKNRMFSAV  489



>gb|AFZ78628.1| korrigan [Populus tomentosa]
Length=691

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PG+ CG  F  +D+LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGAS
Sbjct  461  LNATRVPGFQCGSKFIPLDVLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K RY+C GGWKWRD  KPNPN + GAMV GPD  D F DVR NYN+TEPTLAGNAG
Sbjct  521  IPNDKRRYSCTGGWKWRDRPKPNPNNITGAMVGGPDRFDRFRDVRKNYNFTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALV+L+      I+KN+IFSAV
Sbjct  581  LVAALVSLTSSGGIGINKNSIFSAV  605



>gb|KHN09941.1| Endoglucanase 7 [Glycine soja]
Length=630

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            +   D PGW CG  ++ +  L+ FA SQI+YILGKNP KMSY+VGFGN +PKHVHHRGAS
Sbjct  467  MLEIDVPGWQCGSTYFPISALKAFATSQIEYILGKNPMKMSYIVGFGNKFPKHVHHRGAS  526

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +    +C GGWKWRD+  PNPN + GAMV GPD  D F D R NYN+TEPTLAGNAG
Sbjct  527  IPNDHKHRSCTGGWKWRDTPNPNPNTITGAMVGGPDRFDQFRDSRKNYNFTEPTLAGNAG  586

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++L+    + ID+NTIFSA+
Sbjct  587  LVAALISLTSTTGSGIDRNTIFSAI  611



>ref|XP_003556773.1| PREDICTED: endoglucanase 12-like [Glycine max]
Length=630

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            +   D PGW CG  ++ +  L+ FA SQI+YILGKNP KMSY+VGFGN +PKHVHHRGAS
Sbjct  467  MLEIDVPGWQCGSTYFPISALKAFATSQIEYILGKNPMKMSYIVGFGNKFPKHVHHRGAS  526

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +    +C GGWKWRD+  PNPN + GAMV GPD  D F D R NYN+TEPTLAGNAG
Sbjct  527  IPNDHKHRSCTGGWKWRDTPNPNPNTITGAMVGGPDRFDQFRDSRKNYNFTEPTLAGNAG  586

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL++L+    + ID+NTIFSA+
Sbjct  587  LVAALISLTSTTGSGIDRNTIFSAI  611



>ref|XP_008813788.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            + AA+ PGWYCGP ++S   LR+FA SQ+ YILG NP KMSYVVG+G +YPKHVHHRGAS
Sbjct  458  MDAANVPGWYCGPYYFSTTSLRSFAASQVTYILGDNPEKMSYVVGYGENYPKHVHHRGAS  517

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP N V+Y+C  GWKW  +K PNPN++ GAMV GPD  D F D R NY YTEPTLAGNAG
Sbjct  518  IPDNGVKYSCAAGWKWFHAKSPNPNVIAGAMVGGPDRFDVFKDARQNYGYTEPTLAGNAG  577

Query  394  lvaalvaLSGERSTRIDKNTIFS  326
            LVAALV+L+      +DKN +FS
Sbjct  578  LVAALVSLTSSGGAGVDKNAMFS  600



>gb|AEO97186.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97213.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=621

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A   PG+ CG  F  +D+LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGAS
Sbjct  461  LNATRVPGFQCGSKFIPLDVLRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGAS  520

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K  Y+C GGWKWRDS KPNPN + GAMV GPD  D F DVR NYN+TEPTLAGNAG
Sbjct  521  IPNDKRSYSCTGGWKWRDSPKPNPNNITGAMVGGPDRFDRFRDVRKNYNFTEPTLAGNAG  580

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAAL +L+      IDKN +FSAV
Sbjct  581  LVAALSSLTSSGGIGIDKNRMFSAV  605



>emb|CDY39820.1| BnaC02g42980D [Brassica napus]
Length=564

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 115/145 (79%), Gaps = 3/145 (2%)
 Frame = -3

Query  754  LAAADAPGWYCGPNFYSVDILRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGAS  575
            L A+  PGWYCGP+FY++  LR+F++SQ+DYILG+NPR +SYVVGFG  YP  VHHRGAS
Sbjct  407  LEASSTPGWYCGPSFYTLKNLRDFSKSQMDYILGRNPRNLSYVVGFGERYPSQVHHRGAS  466

Query  574  IPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnag  395
            IP +K + +CKGGW+W+DS   NPNI+ GA+VA  D +DGF DVRT+ NYTEPTL GNAG
Sbjct  467  IPAHK-KESCKGGWRWKDSNMDNPNIIQGALVAATDKYDGFQDVRTSSNYTEPTLVGNAG  525

Query  394  lvaalvaLSGERSTRIDKNTIFSAV  320
            LVAALVAL G     +DKN IFSAV
Sbjct  526  LVAALVALGG--GGTLDKNGIFSAV  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260