BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034G07

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606233.1|  PREDICTED: pre-mRNA-processing protein 40A i...    313   2e-95   Nicotiana tomentosiformis
ref|XP_009606231.1|  PREDICTED: pre-mRNA-processing protein 40A i...    313   2e-95   Nicotiana tomentosiformis
ref|XP_009606232.1|  PREDICTED: pre-mRNA-processing protein 40A i...    313   2e-95   Nicotiana tomentosiformis
ref|XP_009606230.1|  PREDICTED: pre-mRNA-processing protein 40A i...    313   3e-95   Nicotiana tomentosiformis
ref|XP_009765765.1|  PREDICTED: pre-mRNA-processing protein 40A i...    308   7e-94   Nicotiana sylvestris
ref|XP_009765767.1|  PREDICTED: pre-mRNA-processing protein 40A i...    308   8e-94   Nicotiana sylvestris
ref|XP_009765764.1|  PREDICTED: pre-mRNA-processing protein 40A i...    308   9e-94   Nicotiana sylvestris
ref|XP_006343435.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    302   1e-92   
ref|XP_006343434.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    302   2e-92   Solanum tuberosum [potatoes]
ref|XP_006343433.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    303   8e-92   Solanum tuberosum [potatoes]
ref|XP_010323429.1|  PREDICTED: pre-mRNA-processing protein 40A         295   7e-89   Solanum lycopersicum
ref|XP_011074334.1|  PREDICTED: pre-mRNA-processing protein 40A         288   2e-86   Sesamum indicum [beniseed]
emb|CDP01015.1|  unnamed protein product                                282   2e-85   Coffea canephora [robusta coffee]
ref|XP_010664484.1|  PREDICTED: pre-mRNA-processing protein 40A         278   1e-82   Vitis vinifera
ref|XP_010273523.1|  PREDICTED: pre-mRNA-processing protein 40A         266   2e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010061631.1|  PREDICTED: pre-mRNA-processing protein 40A i...    264   8e-78   Eucalyptus grandis [rose gum]
gb|KCW68619.1|  hypothetical protein EUGRSUZ_F02226                     264   1e-77   Eucalyptus grandis [rose gum]
ref|XP_010110128.1|  hypothetical protein L484_003757                   256   1e-77   Morus notabilis
gb|KDP41586.1|  hypothetical protein JCGZ_15993                         263   2e-77   Jatropha curcas
gb|KJB63963.1|  hypothetical protein B456_010G027200                    256   7e-77   Gossypium raimondii
gb|KCW68618.1|  hypothetical protein EUGRSUZ_F02226                     259   7e-76   Eucalyptus grandis [rose gum]
ref|XP_010105833.1|  Pre-mRNA-processing factor 40-A-like protein       258   1e-75   Morus notabilis
gb|KJB63964.1|  hypothetical protein B456_010G027200                    255   2e-75   Gossypium raimondii
gb|KJB63969.1|  hypothetical protein B456_010G027200                    257   4e-75   Gossypium raimondii
gb|KJB63968.1|  hypothetical protein B456_010G027200                    256   4e-75   Gossypium raimondii
gb|KJB63966.1|  hypothetical protein B456_010G027200                    256   5e-75   Gossypium raimondii
ref|XP_010061630.1|  PREDICTED: pre-mRNA-processing protein 40A i...    256   8e-75   
gb|EYU36395.1|  hypothetical protein MIMGU_mgv1a000784mg                255   1e-74   Erythranthe guttata [common monkey flower]
gb|KHG26690.1|  Pre-mRNA-processing factor 40 A                         254   2e-74   Gossypium arboreum [tree cotton]
ref|XP_004169188.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    251   5e-74   
ref|XP_006422754.1|  hypothetical protein CICLE_v100277412mg            251   9e-74   
ref|XP_008452677.1|  PREDICTED: pre-mRNA-processing protein 40A         252   1e-73   Cucumis melo [Oriental melon]
ref|XP_007227030.1|  hypothetical protein PRUPE_ppa000697mg             253   1e-73   Prunus persica
ref|XP_008220399.1|  PREDICTED: pre-mRNA-processing protein 40A i...    252   1e-73   Prunus mume [ume]
ref|XP_008220401.1|  PREDICTED: pre-mRNA-processing protein 40A i...    252   1e-73   Prunus mume [ume]
gb|KJB77626.1|  hypothetical protein B456_012G147100                    249   2e-73   Gossypium raimondii
ref|XP_006486888.1|  PREDICTED: pre-mRNA-processing protein 40A-like    251   2e-73   Citrus sinensis [apfelsine]
ref|XP_004141297.1|  PREDICTED: pre-mRNA-processing protein 40A-like    251   2e-73   
ref|XP_010918636.1|  PREDICTED: pre-mRNA-processing protein 40A i...    249   4e-73   
gb|KJB77624.1|  hypothetical protein B456_012G147100                    249   1e-72   Gossypium raimondii
gb|KJB77621.1|  hypothetical protein B456_012G147100                    249   1e-72   Gossypium raimondii
ref|XP_002320019.2|  FF domain-containing family protein                249   2e-72   
ref|XP_010918635.1|  PREDICTED: pre-mRNA-processing protein 40A i...    248   4e-72   Elaeis guineensis
ref|XP_007042685.1|  Pre-mRNA-processing protein 40B, putative          248   4e-72   
ref|XP_002510055.1|  protein binding protein, putative                  248   4e-72   
ref|XP_002300284.2|  hypothetical protein POPTR_0001s29710g             248   5e-72   
ref|XP_002522113.1|  protein binding protein, putative                  248   6e-72   
ref|XP_011030297.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    248   7e-72   Populus euphratica
gb|KDO49545.1|  hypothetical protein CISIN_1g001687mg                   247   1e-71   Citrus sinensis [apfelsine]
ref|XP_006422756.1|  hypothetical protein CICLE_v10027732mg             247   1e-71   
ref|XP_006486884.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    247   1e-71   Citrus sinensis [apfelsine]
gb|KDO49541.1|  hypothetical protein CISIN_1g0018782mg                  246   1e-71   Citrus sinensis [apfelsine]
gb|KDO49544.1|  hypothetical protein CISIN_1g001687mg                   246   1e-71   Citrus sinensis [apfelsine]
ref|XP_006422757.1|  hypothetical protein CICLE_v10027732mg             246   1e-71   Citrus clementina [clementine]
ref|XP_007018440.1|  Pre-mRNA-processing protein 40A isoform 5          245   2e-71   
ref|XP_007018438.1|  Pre-mRNA-processing protein 40A isoform 3          245   5e-71   
ref|XP_007018436.1|  Pre-mRNA-processing protein 40A isoform 1          245   5e-71   
ref|XP_010248342.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    244   2e-70   
ref|XP_010248344.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    243   2e-70   
ref|XP_010999910.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    242   2e-70   Populus euphratica
ref|XP_011457824.1|  PREDICTED: pre-mRNA-processing protein 40A-like    243   4e-70   Fragaria vesca subsp. vesca
ref|XP_010999909.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    242   5e-70   Populus euphratica
ref|XP_007201807.1|  hypothetical protein PRUPE_ppa000966mg             241   6e-70   
ref|XP_008380122.1|  PREDICTED: pre-mRNA-processing protein 40A-like    241   1e-69   
ref|XP_006589615.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    239   1e-69   
ref|XP_010095738.1|  Pre-mRNA-processing factor 40-A-like protein       241   2e-69   
ref|XP_008337025.1|  PREDICTED: pre-mRNA-processing protein 40A-like    241   2e-69   
ref|XP_008236261.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    240   2e-69   
ref|XP_006589614.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    240   3e-69   Glycine max [soybeans]
ref|XP_003535678.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    240   3e-69   Glycine max [soybeans]
ref|XP_009361094.1|  PREDICTED: pre-mRNA-processing protein 40A         239   7e-69   Pyrus x bretschneideri [bai li]
ref|XP_007143139.1|  hypothetical protein PHAVU_007G047100g             237   8e-69   Phaseolus vulgaris [French bean]
ref|XP_006393692.1|  hypothetical protein EUTSA_v10011212mg             238   9e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006393693.1|  hypothetical protein EUTSA_v10011212mg             238   9e-69   Eutrema salsugineum [saltwater cress]
ref|XP_008808873.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    235   1e-68   
ref|XP_006606005.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    238   1e-68   
ref|XP_011002339.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    239   1e-68   Populus euphratica
ref|XP_011002329.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    238   1e-68   Populus euphratica
ref|XP_011002323.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    238   1e-68   Populus euphratica
ref|XP_011002294.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    238   1e-68   Populus euphratica
ref|XP_010520792.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    238   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_009418171.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    238   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418172.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    238   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007143137.1|  hypothetical protein PHAVU_007G047100g             238   3e-68   Phaseolus vulgaris [French bean]
ref|XP_007143140.1|  hypothetical protein PHAVU_007G047100g             237   3e-68   Phaseolus vulgaris [French bean]
ref|XP_010530462.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    237   3e-68   Tarenaya hassleriana [spider flower]
gb|KHN01575.1|  Pre-mRNA-processing factor 40 like A                    237   3e-68   Glycine soja [wild soybean]
ref|XP_010530434.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    236   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_002313923.2|  hypothetical protein POPTR_0009s08880g             236   6e-68   
gb|KCW63559.1|  hypothetical protein EUGRSUZ_G01189                     236   9e-68   Eucalyptus grandis [rose gum]
ref|XP_010065860.1|  PREDICTED: pre-mRNA-processing protein 40A-like    236   1e-67   Eucalyptus grandis [rose gum]
dbj|BAH19565.1|  AT1G44910                                              234   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|EPS72133.1|  hypothetical protein M569_02623                         219   1e-67   Genlisea aurea
ref|NP_001043246.2|  Os01g0532200                                       227   2e-67   
ref|XP_002891304.1|  hypothetical protein ARALYDRAFT_891421             235   2e-67   
ref|NP_001117438.1|  pre-mRNA-processing protein 40A                    234   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175113.2|  pre-mRNA-processing protein 40A                       234   3e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47957.1|  BnaA10g28290D                                          231   3e-67   Brassica napus [oilseed rape]
ref|XP_008808871.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    234   4e-67   Phoenix dactylifera
ref|XP_008808868.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    234   4e-67   Phoenix dactylifera
ref|XP_008365587.1|  PREDICTED: pre-mRNA-processing protein 40A-like    234   5e-67   
ref|XP_008808872.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    233   6e-67   
ref|XP_009350341.1|  PREDICTED: pre-mRNA-processing protein 40A-like    233   8e-67   Pyrus x bretschneideri [bai li]
ref|XP_004150264.1|  PREDICTED: pre-mRNA-processing protein 40A-like    232   9e-67   
gb|KGN52740.1|  hypothetical protein Csa_4G000610                       232   2e-66   Cucumis sativus [cucumbers]
emb|CDY12575.1|  BnaC06g01010D                                          228   2e-66   Brassica napus [oilseed rape]
ref|XP_008454417.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    231   4e-66   Cucumis melo [Oriental melon]
ref|XP_008805735.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    231   4e-66   Phoenix dactylifera
ref|XP_008805734.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    231   5e-66   
ref|XP_008805733.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    231   5e-66   
ref|XP_006595998.1|  PREDICTED: pre-mRNA-processing protein 40A-like    231   5e-66   
gb|KHN17176.1|  Pre-mRNA-processing factor 40 like A                    231   5e-66   Glycine soja [wild soybean]
ref|XP_008805730.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    231   6e-66   Phoenix dactylifera
gb|KJB63965.1|  hypothetical protein B456_010G027200                    230   6e-66   Gossypium raimondii
gb|KDP44546.1|  hypothetical protein JCGZ_16379                         228   6e-66   Jatropha curcas
ref|XP_008364430.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    229   7e-66   
ref|XP_008364431.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    229   7e-66   
ref|XP_006827042.1|  hypothetical protein AMTR_s00010p00227470          230   7e-66   
ref|XP_009124535.1|  PREDICTED: pre-mRNA-processing protein 40A i...    230   9e-66   Brassica rapa
ref|XP_004156902.1|  PREDICTED: pre-mRNA-processing protein 40A-like    230   1e-65   
ref|XP_009124533.1|  PREDICTED: pre-mRNA-processing protein 40A i...    229   1e-65   Brassica rapa
ref|XP_009124532.1|  PREDICTED: pre-mRNA-processing protein 40A i...    229   1e-65   Brassica rapa
ref|XP_011458881.1|  PREDICTED: pre-mRNA-processing protein 40A         230   1e-65   Fragaria vesca subsp. vesca
ref|XP_010692587.1|  PREDICTED: pre-mRNA-processing protein 40A i...    228   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003549369.2|  PREDICTED: pre-mRNA-processing protein 40A-like    228   4e-65   Glycine max [soybeans]
gb|KHN23176.1|  Pre-mRNA-processing factor 40 like A                    228   5e-65   Glycine soja [wild soybean]
ref|XP_010692586.1|  PREDICTED: pre-mRNA-processing protein 40A i...    228   9e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009397415.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    227   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397407.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    227   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010479065.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    226   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010479066.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    226   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010479063.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    226   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010479064.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    226   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006306359.1|  hypothetical protein CARUB_v10012256mg             224   8e-64   Capsella rubella
ref|XP_004496865.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    224   1e-63   Cicer arietinum [garbanzo]
ref|XP_003563698.1|  PREDICTED: pre-mRNA-processing protein 40A         224   1e-63   
ref|XP_007160939.1|  hypothetical protein PHAVU_001G029800g             223   1e-63   Phaseolus vulgaris [French bean]
gb|EEE54732.1|  hypothetical protein OsJ_02081                          224   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160940.1|  hypothetical protein PHAVU_001G029800g             223   3e-63   Phaseolus vulgaris [French bean]
ref|XP_010461464.1|  PREDICTED: pre-mRNA-processing protein 40A-like    223   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010500169.1|  PREDICTED: pre-mRNA-processing protein 40A i...    223   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010500168.1|  PREDICTED: pre-mRNA-processing protein 40A i...    221   9e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004956604.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    221   2e-62   Setaria italica
gb|KEH44000.1|  pre-mRNA-processing 40A-like protein                    221   2e-62   Medicago truncatula
ref|XP_011092479.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    219   1e-61   Sesamum indicum [beniseed]
gb|AAF69150.1|AC007915_2  F27F5.2                                       218   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40000.1|  pre-mRNA-processing 40A-like protein                    218   2e-61   Medicago truncatula
ref|XP_006644254.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    217   3e-61   
ref|XP_008675544.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    218   3e-61   Zea mays [maize]
ref|XP_006644255.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    217   3e-61   
ref|XP_008675538.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    217   3e-61   Zea mays [maize]
ref|XP_006644253.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    217   3e-61   
ref|XP_011017521.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    214   8e-61   Populus euphratica
gb|KCW63560.1|  hypothetical protein EUGRSUZ_G01189                     215   1e-60   Eucalyptus grandis [rose gum]
gb|EMT05751.1|  Pre-mRNA-processing factor 40-A-like protein            215   2e-60   
gb|EMS61804.1|  Pre-mRNA-processing factor 40-like protein A            215   2e-60   Triticum urartu
ref|XP_004498955.1|  PREDICTED: pre-mRNA-processing protein 40A-like    215   3e-60   Cicer arietinum [garbanzo]
ref|XP_006406474.1|  hypothetical protein EUTSA_v10019995mg             214   3e-60   
dbj|BAJ88075.1|  predicted protein                                      214   4e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010466123.1|  PREDICTED: pre-mRNA-processing protein 40B-l...    213   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010466124.1|  PREDICTED: pre-mRNA-processing protein 40B-l...    213   9e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010507899.1|  PREDICTED: pre-mRNA-processing protein 40B-like    212   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008675546.1|  PREDICTED: pre-mRNA-processing protein 40A-like    212   2e-59   Zea mays [maize]
ref|XP_002885323.1|  FF domain-containing protein                       211   7e-59   
emb|CDY24627.1|  BnaC05g33110D                                          211   8e-59   Brassica napus [oilseed rape]
ref|XP_010313079.1|  PREDICTED: pre-mRNA-processing protein 40A i...    210   2e-58   Solanum lycopersicum
ref|XP_004250825.1|  PREDICTED: pre-mRNA-processing protein 40A i...    210   2e-58   Solanum lycopersicum
ref|XP_010313077.1|  PREDICTED: pre-mRNA-processing protein 40A i...    210   2e-58   Solanum lycopersicum
ref|XP_010489948.1|  PREDICTED: pre-mRNA-processing protein 40B-like    209   3e-58   
ref|XP_009604101.1|  PREDICTED: pre-mRNA-processing protein 40A-like    207   3e-58   Nicotiana tomentosiformis
ref|XP_010557533.1|  PREDICTED: pre-mRNA-processing protein 40B i...    208   3e-58   Tarenaya hassleriana [spider flower]
ref|XP_010557531.1|  PREDICTED: pre-mRNA-processing protein 40B i...    208   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_010557530.1|  PREDICTED: pre-mRNA-processing protein 40B i...    208   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_010557525.1|  PREDICTED: pre-mRNA-processing protein 40B i...    208   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_001774266.1|  predicted protein                                  209   8e-58   
ref|XP_009796951.1|  PREDICTED: pre-mRNA-processing protein 40A-like    204   8e-57   Nicotiana sylvestris
ref|XP_009145759.1|  PREDICTED: pre-mRNA-processing protein 40B i...    205   1e-56   Brassica rapa
ref|XP_006352104.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    205   1e-56   Solanum tuberosum [potatoes]
ref|XP_006352103.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    205   1e-56   Solanum tuberosum [potatoes]
emb|CDY51697.1|  BnaA05g36840D                                          204   1e-56   Brassica napus [oilseed rape]
ref|NP_188601.4|  pre-mRNA-processing protein 40B                       203   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49546.1|  hypothetical protein CISIN_1g001687mg                   202   5e-56   Citrus sinensis [apfelsine]
gb|KFK39295.1|  hypothetical protein AALP_AA3G226000                    199   3e-55   Arabis alpina [alpine rockcress]
gb|KJB63970.1|  hypothetical protein B456_010G027200                    198   7e-55   Gossypium raimondii
ref|XP_007018439.1|  Pre-mRNA-processing protein 40A isoform 4          198   9e-55   
ref|XP_002966973.1|  hypothetical protein SELMODRAFT_439841             197   2e-54   
ref|XP_006299213.1|  hypothetical protein CARUB_v10015361mg             198   3e-54   Capsella rubella
ref|XP_010691544.1|  PREDICTED: pre-mRNA-processing protein 40A-like    195   4e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011092488.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    194   9e-53   
gb|EYU39080.1|  hypothetical protein MIMGU_mgv1a000980mg                193   1e-52   Erythranthe guttata [common monkey flower]
emb|CDO97301.1|  unnamed protein product                                189   2e-51   Coffea canephora [robusta coffee]
dbj|BAB02553.1|  formin binding protein-like                            188   5e-51   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71108.1|  hypothetical protein M569_03648                         186   8e-51   Genlisea aurea
ref|XP_009145760.1|  PREDICTED: pre-mRNA-processing protein 40B i...    185   4e-50   Brassica rapa
gb|KFK39294.1|  hypothetical protein AALP_AA3G226000                    177   2e-47   Arabis alpina [alpine rockcress]
ref|XP_002961039.1|  hypothetical protein SELMODRAFT_402621             171   3e-45   
ref|XP_001768159.1|  predicted protein                                  167   2e-44   
gb|EEC70813.1|  hypothetical protein OsI_02277                          159   2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_007018441.1|  Pre-mRNA-processing protein 40A isoform 6          152   3e-38   
ref|XP_008338016.1|  PREDICTED: pre-mRNA-processing protein 40A-like    138   3e-37   
ref|XP_007018442.1|  Pre-mRNA-processing protein 40A isoform 7          133   1e-31   
gb|AAF78276.1|AC020576_20  Contains similarity to formin binding ...    129   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018443.1|  Pre-mRNA-processing protein 40A isoform 8          129   5e-30   
ref|XP_005647286.1|  hypothetical protein COCSUDRAFT_47676              123   3e-28   Coccomyxa subellipsoidea C-169
ref|XP_005845731.1|  hypothetical protein CHLNCDRAFT_136322             104   1e-21   Chlorella variabilis
ref|XP_004334590.1|  hypothetical protein ACA1_309660                 98.6    1e-19   Acanthamoeba castellanii str. Neff
ref|XP_011396721.1|  Pre-mRNA-processing factor 40-like protein A     96.7    9e-19   Auxenochlorella protothecoides
ref|XP_002950379.1|  hypothetical protein VOLCADRAFT_104642           94.0    5e-18   Volvox carteri f. nagariensis
ref|XP_003713617.1|  pre-mRNA-processing protein prp40                92.0    2e-17   Magnaporthe oryzae 70-15
gb|ELQ37082.1|  pre-mRNA-processing protein prp40                     91.7    3e-17   Magnaporthe oryzae Y34
ref|XP_003294183.1|  hypothetical protein DICPUDRAFT_159144           90.5    4e-17   Dictyostelium purpureum
ref|XP_008728394.1|  hypothetical protein G647_05846                  90.5    5e-17   Cladophialophora carrionii CBS 160.54
ref|XP_007758887.1|  hypothetical protein A1O7_06696                  90.5    6e-17   Cladophialophora yegresii CBS 114405
ref|XP_007797302.1|  putative pre-mrna-processing protein prp40 p...  90.5    6e-17   
ref|XP_002848304.1|  pre-mRNA-processing protein prp40                89.4    2e-16   Microsporum canis CBS 113480
gb|ERS98440.1|  hypothetical protein HMPREF1624_05224                 89.0    2e-16   Sporothrix schenckii ATCC 58251
gb|EZF35286.1|  hypothetical protein H101_01197                       89.0    2e-16   Trichophyton interdigitale H6
ref|XP_003021969.1|  hypothetical protein TRV_03917                   88.6    3e-16   Trichophyton verrucosum HKI 0517
gb|EGE00238.1|  formin binding protein                                88.6    3e-16   Trichophyton tonsurans CBS 112818
ref|XP_003010493.1|  hypothetical protein ARB_03194                   88.6    3e-16   Trichophyton benhamiae CBS 112371
ref|XP_009649389.1|  pre-mRNA-processing protein prp40                88.2    4e-16   Verticillium dahliae VdLs.17
gb|EZF23484.1|  hypothetical protein H100_03934                       87.4    5e-16   Trichophyton rubrum MR850
ref|XP_007737848.1|  hypothetical protein A1O3_09564                  87.4    6e-16   Capronia epimyces CBS 606.96
ref|XP_003175896.1|  pre-mRNA-processing protein prp40                87.4    7e-16   Nannizzia gypsea CBS 118893
gb|KHJ46570.1|  FF domain protein                                     87.0    7e-16   Trichuris suis
ref|XP_003234662.1|  formin binding protein                           87.0    7e-16   Trichophyton rubrum CBS 118892
gb|KIW99709.1|  hypothetical protein Z518_11122                       87.0    8e-16   Rhinocladiella mackenziei CBS 650.93
gb|KIH87644.1|  pre-mRNA-processing factor 40                         87.0    9e-16   Sporothrix brasiliensis 5110
ref|XP_008721419.1|  hypothetical protein HMPREF1541_08879            86.3    2e-15   Cyphellophora europaea CBS 101466
ref|XP_001825324.1|  formin binding protein (FNB3)                    85.9    2e-15   Aspergillus oryzae RIB40
gb|EIT74743.1|  spliceosomal protein FBP11/Splicing factor PRP40      85.9    2e-15   Aspergillus oryzae 3.042
gb|KIW01312.1|  hypothetical protein PV09_07348                       85.9    2e-15   Verruconis gallopava
gb|KIW67875.1|  hypothetical protein, variant                         85.1    2e-15   Phialophora americana
ref|XP_004361782.1|  WW domain-containing protein                     85.5    2e-15   Cavenderia fasciculata
ref|XP_008080559.1|  FF                                               85.5    2e-15   Glarea lozoyensis ATCC 20868
gb|KEZ44644.1|  hypothetical protein SAPIO_CDS3688                    85.1    4e-15   Scedosporium apiospermum
gb|KIX95128.1|  hypothetical protein Z520_09044                       85.1    4e-15   Fonsecaea multimorphosa CBS 102226
gb|KIW82700.1|  hypothetical protein Z517_05727                       85.1    4e-15   Fonsecaea pedrosoi CBS 271.37
gb|KIW67874.1|  hypothetical protein PV04_07090                       84.7    5e-15   Phialophora americana
gb|ERL88888.1|  hypothetical protein D910_06270                       84.3    5e-15   Dendroctonus ponderosae
gb|KIW36962.1|  hypothetical protein, variant 2                       84.0    6e-15   Exophiala oligosperma
gb|ETN61619.1|  U1 small nuclear ribonucleoprotein                    84.3    7e-15   Anopheles darlingi [American malaria mosquito]
gb|ERL88889.1|  hypothetical protein D910_06270                       84.0    8e-15   Dendroctonus ponderosae
gb|KIW91040.1|  hypothetical protein Z519_07934                       84.0    9e-15   Cladophialophora bantiana CBS 173.52
gb|ENN74007.1|  hypothetical protein YQE_09397                        84.0    9e-15   Dendroctonus ponderosae
ref|XP_007743836.1|  hypothetical protein A1O5_05043                  84.0    9e-15   Cladophialophora psammophila CBS 110553
ref|XP_007918326.1|  putative pre-mrna-processing protein prp40 p...  83.6    1e-14   Phaeoacremonium minimum UCRPA7
gb|KIW36960.1|  hypothetical protein PV06_10861                       83.6    1e-14   Exophiala oligosperma
gb|ESA04877.1|  hypothetical protein GLOINDRAFT_230931                79.7    1e-14   
gb|KIV88433.1|  hypothetical protein, variant                         82.8    1e-14   Exophiala mesophila
gb|KIW31252.1|  hypothetical protein, variant                         82.8    1e-14   Cladophialophora immunda
gb|KFH71285.1|  hypothetical protein MVEG_01585                       83.2    2e-14   Mortierella verticillata NRRL 6337
gb|KIW31251.1|  hypothetical protein PV07_02915                       82.4    2e-14   Cladophialophora immunda
gb|EEH21098.2|  hypothetical protein PABG_03329                       82.4    3e-14   Paracoccidioides brasiliensis Pb03
ref|XP_010757115.1|  hypothetical protein PADG_01892                  82.4    3e-14   Paracoccidioides brasiliensis Pb18
gb|KIV88432.1|  hypothetical protein PV10_08116                       82.0    3e-14   Exophiala mesophila
gb|EPS32195.1|  hypothetical protein PDE_07155                        82.0    4e-14   Penicillium oxalicum 114-2
ref|XP_001961789.1|  GF15141                                          82.0    4e-14   Drosophila ananassae
gb|EGZ77588.1|  hypothetical protein NEUTE2DRAFT_147079               81.6    6e-14   Neurospora tetrasperma FGSC 2509
ref|XP_963870.1|  formin binding protein                              81.6    6e-14   Neurospora crassa OR74A
ref|XP_009226284.1|  pre-mRNA-processing protein prp40                81.3    7e-14   Gaeumannomyces tritici R3-111a-1
gb|EPE05590.1|  pre-mrna-processing protein prp40                     81.3    7e-14   Ophiostoma piceae UAMH 11346
ref|XP_003348296.1|  hypothetical protein SMAC_02793                  81.3    8e-14   Sordaria macrospora k-hell
ref|XP_002795390.1|  conserved hypothetical protein                   80.9    9e-14   
ref|XP_009856394.1|  hypothetical protein NEUTE1DRAFT_126217          80.9    9e-14   Neurospora tetrasperma FGSC 2508
gb|EEH40890.2|  hypothetical protein PAAG_02866                       80.9    1e-13   Paracoccidioides lutzii Pb01
ref|XP_002370384.1|  formin binding protein, putative                 80.5    1e-13   
emb|CEG69924.1|  hypothetical protein RMATCC62417_05912               79.7    1e-13   Rhizopus microsporus
gb|KIW52072.1|  hypothetical protein, variant                         80.1    1e-13   Exophiala xenobiotica
ref|XP_007782780.1|  hypothetical protein W97_06717                   80.5    1e-13   Coniosporium apollinis CBS 100218
gb|KFG30308.1|  putative WW domain protein                            80.5    1e-13   Toxoplasma gondii p89
ref|XP_003072222.1|  FF domain containing protein                     80.5    1e-13   Coccidioides posadasii C735 delta SOWgp
gb|EFW19200.1|  formin binding protein FNB3                           80.5    1e-13   Coccidioides posadasii str. Silveira
gb|EPB83551.1|  hypothetical protein HMPREF1544_09712                 80.1    1e-13   Mucor circinelloides f. circinelloides 1006PhL
gb|EAS27710.3|  formin binding protein                                80.5    1e-13   Coccidioides immitis RS
gb|EPR57485.1|  hypothetical protein TGGT1_306220                     80.1    1e-13   Toxoplasma gondii GT1
ref|XP_002076098.1|  GD12006                                          79.3    1e-13   
ref|XP_001650202.1|  AAEL005025-PA                                    80.1    1e-13   Aedes aegypti
gb|KIW12802.1|  hypothetical protein PV08_07989                       80.1    2e-13   Exophiala spinifera
ref|XP_004925557.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  80.1    2e-13   
gb|EXM36214.1|  hypothetical protein FOTG_00453                       80.1    2e-13   
ref|XP_004925558.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  79.7    2e-13   
gb|EWZ98041.1|  hypothetical protein FOWG_02303                       79.7    2e-13   
gb|EWZ45075.1|  hypothetical protein FOZG_05577                       79.7    2e-13   
gb|EWY99000.1|  hypothetical protein FOYG_03239                       79.7    2e-13   
ref|XP_002064895.1|  GK14962                                          79.7    2e-13   
ref|XP_006680779.1|  hypothetical protein BATDEDRAFT_35649            79.7    2e-13   
gb|KIW52071.1|  hypothetical protein PV05_07742                       79.3    3e-13   
gb|EGU74917.1|  hypothetical protein FOXB_14558                       79.3    3e-13   
ref|XP_009254075.1|  hypothetical protein FPSE_02681                  79.3    3e-13   
gb|KIV78572.1|  hypothetical protein, variant                         78.6    3e-13   
ref|NP_608738.1|  CG3542                                              79.0    4e-13   
ref|XP_011326802.1|  hypothetical protein FGSG_07100                  79.0    4e-13   
ref|XP_002543906.1|  conserved hypothetical protein                   79.0    4e-13   
ref|XP_002087770.1|  GE18202                                          79.0    4e-13   
ref|XP_008884869.1|  hypothetical protein HHA_306220                  78.6    4e-13   
ref|XP_002051692.1|  GJ16908                                          78.6    4e-13   
ref|XP_002001916.1|  GI14524                                          78.6    4e-13   
ref|XP_001988867.1|  GH11396                                          78.6    5e-13   
ref|XP_004534590.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  78.6    5e-13   
ref|XP_007702765.1|  hypothetical protein COCSADRAFT_183449           78.6    5e-13   
gb|EWG48213.1|  hypothetical protein FVEG_08069                       78.6    5e-13   
ref|XP_004534591.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  78.6    5e-13   
dbj|GAD96594.1|  formin binding protein (FNB3), putative              78.6    5e-13   
gb|KIV78571.1|  hypothetical protein PV11_06215                       78.2    5e-13   
gb|EWG48214.1|  hypothetical protein FVEG_08069                       78.2    6e-13   
gb|EWG48212.1|  hypothetical protein FVEG_08069                       78.2    6e-13   
ref|XP_002560828.1|  Pc16g04770                                       78.2    6e-13   
ref|XP_001210307.1|  hypothetical protein ATEG_00221                  78.2    6e-13   
emb|CEG69923.1|  hypothetical protein RMATCC62417_05912               77.8    6e-13   
gb|EWG48215.1|  hypothetical protein FVEG_08069                       78.2    7e-13   
gb|EKG19451.1|  hypothetical protein MPH_03314                        77.8    7e-13   
emb|CCT65775.1|  related to U1 snRNP protein                          78.2    7e-13   
ref|XP_004925559.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  77.8    7e-13   
gb|EMT65258.1|  Pre-mRNA-processing protein prp40                     77.8    8e-13   
ref|XP_007272505.1|  formin binding protein                           77.8    8e-13   
ref|XP_009156692.1|  hypothetical protein HMPREF1120_04321            77.8    8e-13   
emb|CCE33377.1|  related to U1 snRNP protein                          77.4    9e-13   
ref|XP_011209121.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  77.8    9e-13   
gb|KIE03456.1|  pre-mRNA-processing protein prp40                     77.8    9e-13   
dbj|GAN10902.1|  formin binding protein                               77.4    1e-12   
ref|XP_001356833.1|  GA17512                                          77.4    1e-12   
ref|XP_001866441.1|  conserved hypothetical protein                   77.4    1e-12   
ref|XP_002015198.1|  GL18543                                          77.4    1e-12   
ref|XP_008030497.1|  hypothetical protein SETTUDRAFT_142296           77.4    1e-12   
ref|XP_639002.1|  WW domain-containing protein                        77.0    1e-12   
ref|XP_011187924.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  77.0    1e-12   
emb|CDS06491.1|  hypothetical protein LRAMOSA09019                    77.0    1e-12   
gb|KFM82393.1|  Pre-mRNA-processing factor 40-like protein            76.3    1e-12   
ref|XP_001968509.1|  GG24911                                          77.0    1e-12   
gb|EFX69363.1|  hypothetical protein DAPPUDRAFT_329118                77.0    1e-12   
gb|KEY70633.1|  hypothetical protein S7711_02236                      77.0    2e-12   
gb|EXA50354.1|  hypothetical protein FOVG_03111                       77.0    2e-12   
emb|CDH54775.1|  formin binding protein                               76.6    2e-12   
gb|EGE80735.1|  formin binding protein                                76.6    2e-12   
gb|EQK98826.1|  pre-mRNA-processing protein prp40                     76.6    2e-12   
gb|EQL30490.1|  hypothetical protein BDFG_07073                       76.6    2e-12   
ref|XP_009495629.1|  hypothetical protein H696_03490                  76.6    2e-12   
gb|KID90355.1|  pre-mRNA-processing protein prp40                     76.3    2e-12   
ref|XP_001264740.1|  formin binding protein (FNB3), putative          76.3    2e-12   
gb|EQB58224.1|  FF domain-containing protein                          76.3    2e-12   
ref|XP_317209.4|  AGAP008263-PA                                       76.3    2e-12   
gb|EXV03129.1|  FF and WW domain protein                              76.3    3e-12   
emb|CCA30114.1|  hypothetical protein NCLIV_070050                    75.9    3e-12   
ref|XP_007820586.1|  FF domain-containing protein                     76.3    3e-12   
gb|EXK42454.1|  hypothetical protein FOMG_05413                       75.9    3e-12   
gb|EUN25046.1|  hypothetical protein COCVIDRAFT_28329                 75.9    3e-12   
ref|XP_007708069.1|  hypothetical protein COCCADRAFT_33180            75.9    4e-12   
gb|EIE80222.1|  hypothetical protein RO3G_04927                       75.1    4e-12   
dbj|GAA89536.1|  formin binding protein                               75.5    4e-12   
emb|CCX34295.1|  Similar to Pre-mRNA-processing protein prp40; ac...  75.5    5e-12   
emb|CDM30324.1|  WW/Rsp5/WWP                                          75.1    5e-12   
ref|XP_752398.1|  formin binding protein (FNB3)                       75.1    5e-12   
gb|EWC48375.1|  hypothetical protein DRE_02144                        75.5    5e-12   
emb|CEP12610.1|  hypothetical protein                                 75.1    6e-12   
ref|XP_007580476.1|  putative formin binding protein                  75.1    6e-12   
gb|KDR11070.1|  Pre-mRNA-processing factor 40-like protein A          74.7    8e-12   
ref|XP_003485563.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  74.7    8e-12   
gb|KFA62550.1|  hypothetical protein S40285_05690                     74.7    9e-12   
ref|XP_001269232.1|  formin binding protein (FNB3), putative          74.7    9e-12   
gb|KEF52747.1|  hypothetical protein A1O9_11164                       74.3    9e-12   
emb|CEJ95090.1|  hypothetical protein VHEMI10592                      74.3    1e-11   
ref|XP_003699523.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  74.3    1e-11   
emb|CAK45268.1|  unnamed protein product                              74.3    1e-11   
ref|XP_007828257.1|  hypothetical protein PFICI_01485                 73.9    1e-11   
ref|XP_007683323.1|  hypothetical protein COCMIDRAFT_82575            73.9    1e-11   
gb|EMD91723.1|  hypothetical protein COCHEDRAFT_1194475               73.9    1e-11   
ref|XP_001392339.2|  formin binding protein (FNB3)                    73.9    1e-11   
gb|KFB45236.1|  AGAP008263-PA-like protein                            73.9    2e-11   
gb|KEY76223.1|  formin binding protein FNB3                           73.6    2e-11   
ref|XP_006566315.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  73.6    2e-11   
ref|XP_006615163.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  73.6    2e-11   
ref|XP_006566314.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  73.6    2e-11   
gb|EUB64788.1|  Pre-mRNA-processing factor A                          73.2    2e-11   
ref|XP_006615161.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  73.2    2e-11   
ref|XP_001541285.1|  conserved hypothetical protein                   73.2    2e-11   
ref|XP_009027503.1|  hypothetical protein HELRODRAFT_107767           73.2    2e-11   
ref|XP_006696314.1|  hypothetical protein CTHT_0059960                73.2    2e-11   
gb|EHK15683.1|  hypothetical protein TRIVIDRAFT_38587                 73.2    3e-11   
gb|EYE91198.1|  hypothetical protein EURHEDRAFT_465369                73.2    3e-11   
ref|XP_002341464.1|  formin binding protein (FNB3), putative          73.2    3e-11   
gb|EGC42993.1|  pre-mRNA-processing protein prp40                     73.2    3e-11   
emb|CDJ03219.1|  pre mRNA processing factor 40 A                      73.2    3e-11   
gb|ENH77046.1|  formin binding protein                                73.2    3e-11   
gb|EER42922.1|  pre-mRNA-processing protein prp40                     72.8    3e-11   
gb|KFY47455.1|  hypothetical protein V496_10655                       72.8    3e-11   
gb|KGO78101.1|  WW/Rsp5/WWP                                           72.8    3e-11   
ref|NP_001265608.1|  pre-mRNA-processing factor 40 homolog A-like     72.8    3e-11   
ref|XP_006615162.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  72.8    3e-11   
emb|CDS15683.1|  pre mRNA processing factor 40 A                      72.8    4e-11   
gb|KGO60717.1|  WW/Rsp5/WWP                                           72.8    4e-11   
gb|ELU44290.1|  pre-mRNA-processing protein prp40                     72.8    4e-11   
gb|EEH07955.1|  pre-mRNA-processing protein prp40                     72.4    5e-11   
gb|KFG80921.1|  pre-mRNA-processing protein prp40                     72.0    5e-11   
ref|XP_011255403.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  72.0    5e-11   
ref|XP_003835795.1|  hypothetical protein LEMA_P051360.1              72.0    5e-11   
gb|KID76817.1|  pre-mRNA-processing protein prp40                     72.0    6e-11   
ref|XP_011255401.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  72.0    6e-11   
gb|KGO54732.1|  WW/Rsp5/WWP                                           71.6    7e-11   
ref|XP_007812520.1|  pre-mRNA-processing protein prp40                71.6    7e-11   
ref|XP_001931166.1|  U1 snRNP-associated protein Usp104               71.6    7e-11   
gb|EKV12755.1|  Formin binding protein (FNB3), putative               71.6    8e-11   
gb|KGO47621.1|  WW/Rsp5/WWP                                           71.6    8e-11   
ref|XP_011117795.1|  hypothetical protein AOL_s00006g184              71.6    8e-11   
ref|XP_011062749.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  71.2    9e-11   
ref|XP_007786598.1|  hypothetical protein EPUS_01466                  71.2    9e-11   
gb|KIA75716.1|  formin binding protein                                71.6    9e-11   
gb|KDQ19637.1|  hypothetical protein BOTBODRAFT_126520                71.2    9e-11   
ref|XP_001797314.1|  hypothetical protein SNOG_06957                  71.2    9e-11   
gb|KGQ10398.1|  Pre-mRNA-processing protein prp40                     71.2    1e-10   
emb|CDS30206.1|  pre mRNA processing factor 40 B                      71.2    1e-10   
ref|XP_658853.1|  hypothetical protein AN1249.2                       70.9    1e-10   
ref|XP_011351709.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.9    1e-10   
emb|CCD79720.1|  huntingtin interacting protein-related               70.9    1e-10   
gb|ELR07756.1|  hypothetical protein GMDG_00379                       70.9    1e-10   
gb|EFZ18647.1|  hypothetical protein SINV_13895                       70.9    1e-10   
ref|XP_011062746.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.9    2e-10   
gb|KFY39067.1|  hypothetical protein V495_06183                       70.5    2e-10   
gb|KFX90038.1|  hypothetical protein V490_06682                       70.5    2e-10   
ref|XP_011159083.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.5    2e-10   
ref|XP_008594496.1|  FF domain-containing protein                     70.5    2e-10   
gb|KFX92751.1|  hypothetical protein O988_07143                       70.5    2e-10   
ref|XP_001950893.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.5    2e-10   
ref|XP_003652203.1|  hypothetical protein THITE_2113423               70.1    2e-10   
ref|XP_011111268.1|  hypothetical protein H072_5388                   70.1    2e-10   
ref|XP_004778982.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.1    2e-10   
ref|XP_002432295.1|  conserved hypothetical protein                   70.1    2e-10   
ref|XP_011062744.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.1    3e-10   
gb|KFY14129.1|  hypothetical protein V492_02840                       70.1    3e-10   
ref|XP_792657.3|  PREDICTED: uncharacterized protein LOC587854        70.1    3e-10   
gb|KFY36002.1|  hypothetical protein V494_05395                       69.7    3e-10   
gb|KGB33978.1|  WW domain-containing protein                          69.7    3e-10   
ref|XP_008195028.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  69.3    4e-10   
gb|KEQ58499.1|  hypothetical protein M437DRAFT_88470                  69.3    4e-10   
gb|EYC32254.1|  hypothetical protein Y032_0003g1479                   69.3    5e-10   
gb|KFH47980.1|  Pre-mRNA-processing protein-like protein              68.9    5e-10   
ref|XP_007107595.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.9    6e-10   
gb|EYC32256.1|  hypothetical protein Y032_0003g1479                   68.9    6e-10   
ref|XP_011494653.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.9    6e-10   
emb|CCD52272.1|  similar to formin binding protein (FNB3)             68.6    7e-10   
ref|XP_003298603.1|  hypothetical protein PTT_09365                   68.6    7e-10   
ref|XP_010621932.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    9e-10   
ref|XP_010621931.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    9e-10   
gb|EFN80756.1|  CDK5 regulatory subunit-associated protein 1          68.6    9e-10   
ref|XP_008209232.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-09   
ref|XP_001601251.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-09   
gb|ESZ92215.1|  hypothetical protein SBOR_7402                        67.8    1e-09   
ref|XP_003245176.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    1e-09   
ref|XP_011145174.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-09   
ref|XP_008846968.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-09   
ref|XP_011145173.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-09   
gb|KDQ26918.1|  hypothetical protein PLEOSDRAFT_1042742               67.4    2e-09   
ref|XP_008846971.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-09   
ref|XP_008846969.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-09   
ref|XP_008846970.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-09   
ref|XP_005877386.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-09   
ref|XP_006974462.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-09   
ref|XP_011305297.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-09   
ref|XP_005102248.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  66.6    3e-09   
ref|XP_005102247.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  66.6    4e-09   
ref|XP_008557971.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  66.2    4e-09   
ref|XP_005180340.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  66.2    4e-09   
ref|XP_005986419.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  65.9    6e-09   
ref|XP_004863080.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  65.9    6e-09   
ref|XP_004863082.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  65.9    6e-09   
emb|CAB70747.1|  hypothetical protein                                 65.1    9e-09   
ref|XP_006521254.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  64.7    1e-08   
ref|XP_006257434.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  64.7    1e-08   
ref|XP_006521248.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  64.3    2e-08   
ref|XP_008763989.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  64.3    2e-08   
gb|ERE81197.1|  putative pre-mRNA-processing factor 40                64.3    2e-08   
gb|AAH50398.1|  PRPF40B protein                                       64.3    2e-08   
dbj|GAM22720.1|  hypothetical protein SAMD00019534_058950             63.9    2e-08   
sp|Q80W14.2|PR40B_MOUSE  RecName: Full=Pre-mRNA-processing factor...  64.3    2e-08   
ref|XP_004274406.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
ref|NP_061256.1|  pre-mRNA-processing factor 40 homolog B             63.9    2e-08   
ref|XP_008581013.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
gb|AAH51961.1|  Prpf40b protein                                       63.9    2e-08   
ref|XP_006521252.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
ref|XP_006521251.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
ref|XP_006521249.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
ref|XP_005067274.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
ref|XP_001101626.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    2e-08   
ref|XP_006521253.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_007727274.1|  hypothetical protein A1O1_08222                  63.9    3e-08   
ref|XP_005067272.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
gb|ERE81198.1|  putative pre-mRNA-processing factor 40                63.9    3e-08   
ref|XP_006521246.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
gb|ERE81196.1|  putative pre-mRNA-processing factor 40                63.9    3e-08   
ref|XP_006257428.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_006521244.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_006257427.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_003513544.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_008581020.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_006257429.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_005067273.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_007651966.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_006257426.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|XP_006521243.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  63.9    3e-08   
ref|NP_001128055.1|  pre-mRNA-processing factor 40 homolog B          63.9    3e-08   



>ref|XP_009606233.1| PREDICTED: pre-mRNA-processing protein 40A isoform X4 [Nicotiana 
tomentosiformis]
Length=1032

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 208/233 (89%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ IAA
Sbjct  605  DDERCSRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQIAA  664

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  665  GTLTAKTSWRDYCQMVKEYVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  724

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKAAILE IG+PSI +VNLQLIFED++ERAK+KEEKE+KKRQRLA
Sbjct  725  KSEKITISSTWTFEDFKAAILEGIGSPSIHDVNLQLIFEDIIERAKEKEEKESKKRQRLA  784

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  785  KDFTDKLSTIKEITASSSWEECKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  837



>ref|XP_009606231.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Nicotiana 
tomentosiformis]
Length=1042

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 208/233 (89%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ IAA
Sbjct  615  DDERCSRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQIAA  674

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  675  GTLTAKTSWRDYCQMVKEYVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  734

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKAAILE IG+PSI +VNLQLIFED++ERAK+KEEKE+KKRQRLA
Sbjct  735  KSEKITISSTWTFEDFKAAILEGIGSPSIHDVNLQLIFEDIIERAKEKEEKESKKRQRLA  794

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  795  KDFTDKLSTIKEITASSSWEECKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  847



>ref|XP_009606232.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Nicotiana 
tomentosiformis]
Length=1042

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 208/233 (89%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ IAA
Sbjct  615  DDERCSRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQIAA  674

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  675  GTLTAKTSWRDYCQMVKEYVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  734

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKAAILE IG+PSI +VNLQLIFED++ERAK+KEEKE+KKRQRLA
Sbjct  735  KSEKITISSTWTFEDFKAAILEGIGSPSIHDVNLQLIFEDIIERAKEKEEKESKKRQRLA  794

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  795  KDFTDKLSTIKEITASSSWEECKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  847



>ref|XP_009606230.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Nicotiana 
tomentosiformis]
Length=1050

 Score =   313 bits (801),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 208/233 (89%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ IAA
Sbjct  623  DDERCSRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQIAA  682

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  683  GTLTAKTSWRDYCQMVKEYVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  742

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKAAILE IG+PSI +VNLQLIFED++ERAK+KEEKE+KKRQRLA
Sbjct  743  KSEKITISSTWTFEDFKAAILEGIGSPSIHDVNLQLIFEDIIERAKEKEEKESKKRQRLA  802

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  803  KDFTDKLSTIKEITASSSWEECKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  855



>ref|XP_009765765.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Nicotiana 
sylvestris]
Length=1044

 Score =   308 bits (790),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 205/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ I A
Sbjct  616  DDERCLRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQITA  675

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKESVAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  676  GTLTAKTSWRDYCQMVKESVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  735

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKA ILE IG+PSI +VNLQLIFEDL+ERAK+KEEKE KKRQRLA
Sbjct  736  KSEKITISSTWTFEDFKATILEGIGSPSIHDVNLQLIFEDLIERAKEKEEKETKKRQRLA  795

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVED+SE++AIGEET  R +FEEYV  LQ
Sbjct  796  KDFTDKLSTIKEITASSSWEECKELVEDTSEFRAIGEETISRAVFEEYVAWLQ  848



>ref|XP_009765767.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Nicotiana 
sylvestris]
Length=1034

 Score =   308 bits (789),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 205/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ I A
Sbjct  606  DDERCLRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQITA  665

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKESVAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  666  GTLTAKTSWRDYCQMVKESVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  725

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKA ILE IG+PSI +VNLQLIFEDL+ERAK+KEEKE KKRQRLA
Sbjct  726  KSEKITISSTWTFEDFKATILEGIGSPSIHDVNLQLIFEDLIERAKEKEEKETKKRQRLA  785

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVED+SE++AIGEET  R +FEEYV  LQ
Sbjct  786  KDFTDKLSTIKEITASSSWEECKELVEDTSEFRAIGEETISRAVFEEYVAWLQ  838



>ref|XP_009765764.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Nicotiana 
sylvestris]
Length=1052

 Score =   308 bits (790),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 205/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL KIDRL++FQEYIRDLEKE+EEQRK QKEQLRR ERKNRDAFR MME+ I A
Sbjct  624  DDERCLRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQITA  683

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC MVKESVAYQAVASNTSGSTPKDLFEDVVEELE QYHEDK RVK+V+
Sbjct  684  GTLTAKTSWRDYCQMVKESVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVV  743

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFKA ILE IG+PSI +VNLQLIFEDL+ERAK+KEEKE KKRQRLA
Sbjct  744  KSEKITISSTWTFEDFKATILEGIGSPSIHDVNLQLIFEDLIERAKEKEEKETKKRQRLA  803

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EITA+SSWEECKELVED+SE++AIGEET  R +FEEYV  LQ
Sbjct  804  KDFTDKLSTIKEITASSSWEECKELVEDTSEFRAIGEETISRAVFEEYVAWLQ  856



>ref|XP_006343435.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Solanum 
tuberosum]
Length=864

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 204/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRLE+FQEYIRDLEKE+EEQRK QKEQLRRAERKNRDAFR M+E+HIAA
Sbjct  605  DDERCSRLEKLDRLEIFQEYIRDLEKEDEEQRKLQKEQLRRAERKNRDAFRKMIEEHIAA  664

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDV EELE QYHEDK RVK+V+
Sbjct  665  GMLTAKTSWRDYCQMVKEFVAYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKIRVKDVV  724

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFK AI E IG+PSI +VNLQLIFEDL+ERAK+KEEKEAKK QRLA
Sbjct  725  KSEKITISSTWTFEDFKVAIFEGIGSPSIHDVNLQLIFEDLVERAKEKEEKEAKKHQRLA  784

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS+  EIT +SSWEE KELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  785  KDFTDKLSSIKEITDSSSWEESKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  837



>ref|XP_006343434.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Solanum 
tuberosum]
Length=872

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 204/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRLE+FQEYIRDLEKE+EEQRK QKEQLRRAERKNRDAFR M+E+HIAA
Sbjct  605  DDERCSRLEKLDRLEIFQEYIRDLEKEDEEQRKLQKEQLRRAERKNRDAFRKMIEEHIAA  664

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDV EELE QYHEDK RVK+V+
Sbjct  665  GMLTAKTSWRDYCQMVKEFVAYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKIRVKDVV  724

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFK AI E IG+PSI +VNLQLIFEDL+ERAK+KEEKEAKK QRLA
Sbjct  725  KSEKITISSTWTFEDFKVAIFEGIGSPSIHDVNLQLIFEDLVERAKEKEEKEAKKHQRLA  784

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS+  EIT +SSWEE KELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  785  KDFTDKLSSIKEITDSSSWEESKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  837



>ref|XP_006343433.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Solanum 
tuberosum]
Length=1031

 Score =   303 bits (775),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 204/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRLE+FQEYIRDLEKE+EEQRK QKEQLRRAERKNRDAFR M+E+HIAA
Sbjct  605  DDERCSRLEKLDRLEIFQEYIRDLEKEDEEQRKLQKEQLRRAERKNRDAFRKMIEEHIAA  664

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC MVKE VAYQAVASNTSGSTPKDLFEDV EELE QYHEDK RVK+V+
Sbjct  665  GMLTAKTSWRDYCQMVKEFVAYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKIRVKDVV  724

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT S  W+FEDFK AI E IG+PSI +VNLQLIFEDL+ERAK+KEEKEAKK QRLA
Sbjct  725  KSEKITISSTWTFEDFKVAIFEGIGSPSIHDVNLQLIFEDLVERAKEKEEKEAKKHQRLA  784

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS+  EIT +SSWEE KELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  785  KDFTDKLSSIKEITDSSSWEESKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  837



>ref|XP_010323429.1| PREDICTED: pre-mRNA-processing protein 40A [Solanum lycopersicum]
Length=1027

 Score =   295 bits (755),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 204/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRL++FQEYIRDLEKE+EEQRK QKEQLRRAERKNRDAFR M+E+HIAA
Sbjct  605  DDERCSRLEKLDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRAERKNRDAFRKMIEEHIAA  664

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDY  MVKESVAYQAVASNTSGSTPKDLFEDV EELE QYHEDK  VK+V+
Sbjct  665  GMLTAKTYWRDYWQMVKESVAYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKIHVKDVV  724

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KSEKIT SP  +FEDFK AILE I +PSI +VNLQLIFEDL+ERAK+KEEKEAKKRQRLA
Sbjct  725  KSEKITISPTCTFEDFKVAILEGISSPSIQDVNLQLIFEDLVERAKEKEEKEAKKRQRLA  784

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS+  EIT +SSWEE KELVEDSSE++AIGEET  R +FEEYV  LQ
Sbjct  785  KDFTDKLSSIKEITDSSSWEESKELVEDSSEFRAIGEETISRAVFEEYVAWLQ  837



>ref|XP_011074334.1| PREDICTED: pre-mRNA-processing protein 40A [Sesamum indicum]
 ref|XP_011074335.1| PREDICTED: pre-mRNA-processing protein 40A [Sesamum indicum]
 ref|XP_011074336.1| PREDICTED: pre-mRNA-processing protein 40A [Sesamum indicum]
Length=1028

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 204/233 (88%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC+RL K+DRLE+FQ+YIRDLEKEE+EQ+K QKEQLRR ERKNRDAFR MME+HIAA
Sbjct  627  DDERCTRLDKLDRLEIFQDYIRDLEKEEDEQKKRQKEQLRRVERKNRDAFRKMMEEHIAA  686

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+S AY+AVASNTSGSTPKDLFEDV EELE +Y EDK R+K+ L
Sbjct  687  GTLTAKTHWRDYCQKVKDSEAYEAVASNTSGSTPKDLFEDVTEELERKYDEDKARIKDAL  746

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K EKIT +  W+FEDFK +I E+IG+P+IS++NLQL++EDL++RAK+KEEKEAKKR+RLA
Sbjct  747  KQEKITITSTWTFEDFKFSIKESIGSPAISDINLQLVYEDLIDRAKEKEEKEAKKRKRLA  806

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EI A S+WEECK+LVEDSSEY++IGEE   REIF+EYV+RLQ
Sbjct  807  KDFTDKLSTIKEINALSTWEECKQLVEDSSEYRSIGEENLCREIFDEYVSRLQ  859



>emb|CDP01015.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 205/233 (88%), Gaps = 1/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLE+EEEEQ+K +KEQLRRAERKNRDAFR +ME+HIAA
Sbjct  396  DDERCSRLDKIDRLEIFQEYIRDLEREEEEQKKKEKEQLRRAERKNRDAFRKLMEEHIAA  455

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + AKTLWRDYC  VK++ AYQAVA NTSGSTP DLFEDV+EELENQYH+DKTR+K+ +
Sbjct  456  GILNAKTLWRDYCQKVKDTEAYQAVALNTSGSTPMDLFEDVLEELENQYHDDKTRIKDAV  515

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K EKI+  P+W+ EDFKAAI E+I +  +S++NLQL+FEDL+ERAK+KEEKEAKKRQRLA
Sbjct  516  KLEKISVLPMWTLEDFKAAIKESISS-EVSDINLQLVFEDLLERAKEKEEKEAKKRQRLA  574

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF ++LS   EITA S+WEE KEL+EDSSEY++IGEE + +EIFEEY+ RLQ
Sbjct  575  KDFSDLLSTIKEITATSNWEESKELLEDSSEYRSIGEENSCKEIFEEYIARLQ  627



>ref|XP_010664484.1| PREDICTED: pre-mRNA-processing protein 40A [Vitis vinifera]
 emb|CBI19367.3| unnamed protein product [Vitis vinifera]
Length=1030

 Score =   278 bits (710),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 199/233 (85%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLE+EEEEQRK QKEQLRRAERKNRD FR +ME+H+AA
Sbjct  637  DDERCSRLEKIDRLEIFQEYIRDLEREEEEQRKIQKEQLRRAERKNRDEFRKLMEEHVAA  696

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDV EELE QYHEDK R+K+ +
Sbjct  697  GTLTAKTHWRDYCMKVKDSSPYLAVASNTSGSTPKDLFEDVAEELEKQYHEDKARIKDAM  756

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  K+T +  W+F DFKAAIL+ +G+P+IS+VNL+L+FE+L++R K+KEEKEAKKRQRLA
Sbjct  757  KLSKVTIASTWTFGDFKAAILDDVGSPNISDVNLKLVFEELLDRIKEKEEKEAKKRQRLA  816

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L +  EITA+S+WE+CK L E+S EY++IGEE+  REIFEEY+  LQ
Sbjct  817  DDFNDLLRSKKEITASSNWEDCKPLFEESQEYRSIGEESFGREIFEEYIAHLQ  869



>ref|XP_010273523.1| PREDICTED: pre-mRNA-processing protein 40A [Nelumbo nucifera]
 ref|XP_010273530.1| PREDICTED: pre-mRNA-processing protein 40A [Nelumbo nucifera]
Length=1046

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 162/233 (70%), Positives = 193/233 (83%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLEKEEEEQRK QKEQLRRAERKNRD FR +ME+H+ A
Sbjct  643  DDERCSRLEKIDRLEIFQEYIRDLEKEEEEQRKIQKEQLRRAERKNRDEFRKLMEEHVTA  702

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+  AY AV+SNTSGSTPKDLFEDV EELE QYH+DKTR+K+ +
Sbjct  703  GTLTAKTHWRDYCMKVKDLPAYVAVSSNTSGSTPKDLFEDVSEELEKQYHDDKTRIKDAI  762

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI+ +  W+ EDFKAAI E +G+PSIS++N +L+F++L+ER K+KEEKEAKKRQRLA
Sbjct  763  KLGKISMASTWTIEDFKAAIAEHVGSPSISDINFKLVFDELLERIKEKEEKEAKKRQRLA  822

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF E+L +  EITA+S WEE K L EDS EY++I +E   REIFEEY+  LQ
Sbjct  823  DDFSELLHSIKEITASSKWEESKPLFEDSQEYRSISDENFRREIFEEYIIHLQ  875



>ref|XP_010061631.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Eucalyptus 
grandis]
Length=1001

 Score =   264 bits (675),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 193/233 (83%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL ++Q+Y+RDLEKEEEEQ+K QKEQLRR+ERKNRDAFR +ME+HIAA
Sbjct  610  DDERCSRLEKIDRLLIYQDYVRDLEKEEEEQKKIQKEQLRRSERKNRDAFRKLMEEHIAA  669

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AKTLW DYC  VK+   YQAVASNTSGSTPK+LFEDV+EELE QYH+DKTRVK+ +
Sbjct  670  GTLNAKTLWHDYCLKVKDMSEYQAVASNTSGSTPKELFEDVMEELEKQYHDDKTRVKDAM  729

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+ +  W+FEDFKA+ILE IG P IS+VN +L++E+L+ERAK+KEEKEAKKR+ LA
Sbjct  730  KSGKISMASTWTFEDFKASILEDIGAPLISDVNSKLVYEELLERAKEKEEKEAKKRRHLA  789

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF E+L    EIT  S WEECK L EDS E+K +G+E+  REIFEEY   LQ
Sbjct  790  DDFTELLYTIKEITTTSDWEECKPLFEDSHEFKLMGDESFSREIFEEYKAYLQ  842



>gb|KCW68619.1| hypothetical protein EUGRSUZ_F02226 [Eucalyptus grandis]
Length=1008

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 193/233 (83%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL ++Q+Y+RDLEKEEEEQ+K QKEQLRR+ERKNRDAFR +ME+HIAA
Sbjct  617  DDERCSRLEKIDRLLIYQDYVRDLEKEEEEQKKIQKEQLRRSERKNRDAFRKLMEEHIAA  676

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AKTLW DYC  VK+   YQAVASNTSGSTPK+LFEDV+EELE QYH+DKTRVK+ +
Sbjct  677  GTLNAKTLWHDYCLKVKDMSEYQAVASNTSGSTPKELFEDVMEELEKQYHDDKTRVKDAM  736

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+ +  W+FEDFKA+ILE IG P IS+VN +L++E+L+ERAK+KEEKEAKKR+ LA
Sbjct  737  KSGKISMASTWTFEDFKASILEDIGAPLISDVNSKLVYEELLERAKEKEEKEAKKRRHLA  796

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF E+L    EIT  S WEECK L EDS E+K +G+E+  REIFEEY   LQ
Sbjct  797  DDFTELLYTIKEITTTSDWEECKPLFEDSHEFKLMGDESFSREIFEEYKAYLQ  849



>ref|XP_010110128.1| hypothetical protein L484_003757 [Morus notabilis]
 gb|EXC25269.1| hypothetical protein L484_003757 [Morus notabilis]
Length=586

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL +FQ+YIRDLEKEEEEQ+K QKEQLRR ERKNRD FR +ME+HI A
Sbjct  194  DDERCLRLEKLDRLLIFQDYIRDLEKEEEEQKKIQKEQLRRVERKNRDEFRKLMEEHIDA  253

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
              +TAKT WRDYC  VK+   Y+AVASNTSGSTPKDLFEDV EELE QYH+DK RVK+ L
Sbjct  254  AALTAKTPWRDYCLKVKDLPQYEAVASNTSGSTPKDLFEDVTEELEKQYHDDKARVKDTL  313

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  K++F   W+F+DFKAAILE IG+P I E+NL+L++E+L+ERAK+KEEKE KKRQRLA
Sbjct  314  KLGKVSFESSWTFDDFKAAILEDIGSPPILEINLKLVYEELLERAKEKEEKETKKRQRLA  373

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L +  EIT  S+WE+C++L E+  EY+AIGEE+  R+IFEEY+T LQ
Sbjct  374  DDFTKLLHSKKEITTTSNWEDCRQLFEECQEYRAIGEESVTRDIFEEYITHLQ  426



>gb|KDP41586.1| hypothetical protein JCGZ_15993 [Jatropha curcas]
Length=1008

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 195/233 (84%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL VFQ+YIRDLEKEEE+Q+  QKEQ RRAERKNRDAFR ++EDH+A 
Sbjct  613  DDERCLRLEKVDRLVVFQDYIRDLEKEEEKQKMIQKEQRRRAERKNRDAFRKLLEDHVAD  672

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G++TAKT W DYC  VK+   Y AVA+NTSGSTPKDLFEDV EELE QYH+DKTR+K+ +
Sbjct  673  GSLTAKTHWLDYCLKVKDLPQYHAVATNTSGSTPKDLFEDVAEELEKQYHDDKTRIKDAM  732

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KIT +  W+FEDFKAAI + IG+P IS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  733  KSGKITMTSAWTFEDFKAAISDDIGSPPISDINLKLLYDELLERAKEKEEKEAKKRQRLA  792

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             D  ++L +  EITA+S+WE+ K+L+E+S EY++IGEE+  REIFEEYV  LQ
Sbjct  793  DDLTKLLHSFKEITASSTWEDSKQLIEESQEYRSIGEESVSREIFEEYVAHLQ  845



>gb|KJB63963.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=654

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  261  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  320

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  321  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  380

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  381  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  440

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITA+S WEE K L E+S EY++I EE+  REIFEEY+T LQ
Sbjct  441  DDFTRLLHTYKEITASSDWEESKPLFEESQEYRSIAEESFRREIFEEYITHLQ  493



>gb|KCW68618.1| hypothetical protein EUGRSUZ_F02226 [Eucalyptus grandis]
Length=1010

 Score =   259 bits (661),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 193/235 (82%), Gaps = 2/235 (1%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL ++Q+Y+RDLEKEEEEQ+K QKEQLRR+ERKNRDAFR +ME+HIAA
Sbjct  617  DDERCSRLEKIDRLLIYQDYVRDLEKEEEEQKKIQKEQLRRSERKNRDAFRKLMEEHIAA  676

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AKTLW DYC  VK+   YQAVASNTSGSTPK+LFEDV+EELE QYH+DKTRVK+ +
Sbjct  677  GTLNAKTLWHDYCLKVKDMSEYQAVASNTSGSTPKELFEDVMEELEKQYHDDKTRVKDAM  736

Query  384  KSE--KITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqr  211
            KS   KI+ +  W+FEDFKA+ILE IG P IS+VN +L++E+L+ERAK+KEEKEAKKR+ 
Sbjct  737  KSGKVKISMASTWTFEDFKASILEDIGAPLISDVNSKLVYEELLERAKEKEEKEAKKRRH  796

Query  210  laKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            LA DF E+L    EIT  S WEECK L EDS E+K +G+E+  REIFEEY   LQ
Sbjct  797  LADDFTELLYTIKEITTTSDWEECKPLFEDSHEFKLMGDESFSREIFEEYKAYLQ  851



>ref|XP_010105833.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
 gb|EXC51391.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
Length=994

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL +FQ+YIRDLEKEEEEQ+K QKEQLRR ERKNRD FR +ME+HI A
Sbjct  602  DDERCLRLEKLDRLLIFQDYIRDLEKEEEEQKKIQKEQLRRVERKNRDEFRKLMEEHIDA  661

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
              +TAKT WRDYC  VK+   Y+AVASNTSGSTPKDLFEDV EELE QYH+DK RVK+ L
Sbjct  662  AALTAKTPWRDYCLKVKDLPQYEAVASNTSGSTPKDLFEDVTEELEKQYHDDKARVKDTL  721

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  K++F   W+F+DFKAAILE IG+P I E+NL+L++E+L+ERAK+KEEKE KKRQRLA
Sbjct  722  KLGKVSFESSWTFDDFKAAILEDIGSPPILEINLKLVYEELLERAKEKEEKETKKRQRLA  781

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L +  EIT  S+WE+C++L E+  EY+AIGEE+  R+IFEEY+T LQ
Sbjct  782  DDFTKLLHSKKEITTTSNWEDCRQLFEECQEYRAIGEESVTRDIFEEYITHLQ  834



>gb|KJB63964.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=802

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  409  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  468

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  469  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  528

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  529  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  588

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITA+S WEE K L E+S EY++I EE+  REIFEEY+T LQ
Sbjct  589  DDFTRLLHTYKEITASSDWEESKPLFEESQEYRSIAEESFRREIFEEYITHLQ  641



>gb|KJB63969.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=1026

 Score =   257 bits (656),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  633  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  692

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  693  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  752

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  753  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  812

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITA+S WEE K L E+S EY++I EE+  REIFEEY+T LQ
Sbjct  813  DDFTRLLHTYKEITASSDWEESKPLFEESQEYRSIAEESFRREIFEEYITHLQ  865



>gb|KJB63968.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=984

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  591  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  650

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  651  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  710

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  711  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  770

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITA+S WEE K L E+S EY++I EE+  REIFEEY+T LQ
Sbjct  771  DDFTRLLHTYKEITASSDWEESKPLFEESQEYRSIAEESFRREIFEEYITHLQ  823



>gb|KJB63966.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=983

 Score =   256 bits (654),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  590  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  649

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  650  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  709

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  710  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  769

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITA+S WEE K L E+S EY++I EE+  REIFEEY+T LQ
Sbjct  770  DDFTRLLHTYKEITASSDWEESKPLFEESQEYRSIAEESFRREIFEEYITHLQ  822



>ref|XP_010061630.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Eucalyptus 
grandis]
Length=1013

 Score =   256 bits (653),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 12/245 (5%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL ++Q+Y+RDLEKEEEEQ+K QKEQLRR+ERKNRDAFR +ME+HIAA
Sbjct  610  DDERCSRLEKIDRLLIYQDYVRDLEKEEEEQKKIQKEQLRRSERKNRDAFRKLMEEHIAA  669

Query  564  GTVTAKTLWRDYCP------------MVKESVAYQAVASNTSGSTPKDLFEDVVEELENQ  421
            GT+ AKTLW DYC              VK+   YQAVASNTSGSTPK+LFEDV+EELE Q
Sbjct  670  GTLNAKTLWHDYCLKASSVLQQFFGLQVKDMSEYQAVASNTSGSTPKELFEDVMEELEKQ  729

Query  420  YHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdk  241
            YH+DKTRVK+ +KS KI+ +  W+FEDFKA+ILE IG P IS+VN +L++E+L+ERAK+K
Sbjct  730  YHDDKTRVKDAMKSGKISMASTWTFEDFKASILEDIGAPLISDVNSKLVYEELLERAKEK  789

Query  240  eekeakkrqrlaKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEY  61
            EEKEAKKR+ LA DF E+L    EIT  S WEECK L EDS E+K +G+E+  REIFEEY
Sbjct  790  EEKEAKKRRHLADDFTELLYTIKEITTTSDWEECKPLFEDSHEFKLMGDESFSREIFEEY  849

Query  60   VTRLQ  46
               LQ
Sbjct  850  KAYLQ  854



>gb|EYU36395.1| hypothetical protein MIMGU_mgv1a000784mg [Erythranthe guttata]
Length=987

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 194/233 (83%), Gaps = 4/233 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC+RL K+DRL+VFQ+YIRDLEKE++EQ+K QKEQLRR ERKNRDAFR MME+HIA 
Sbjct  590  DDERCTRLDKLDRLDVFQDYIRDLEKEDDEQKKRQKEQLRRTERKNRDAFREMMEEHIAT  649

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+S  Y AVA NTSGSTPKDLFEDV EEL  +Y EDK R+K+ L
Sbjct  650  GTLTAKTYWRDYCQKVKDSEPYAAVALNTSGSTPKDLFEDVAEELVKKYDEDKARIKDAL  709

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K EK+T +   +F+DFK++I E+IG+PSIS++NLQ    DL++RAKDKEEKEAKK +RLA
Sbjct  710  KHEKVTIASTTTFDDFKSSIEESIGSPSISDINLQ----DLIDRAKDKEEKEAKKLKRLA  765

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            KDF + LS   EI   S+WEECK LVEDSSEY+++G+E++ +EIF+EY++RLQ
Sbjct  766  KDFTDKLSTIKEINVLSTWEECKHLVEDSSEYRSVGDESSCKEIFDEYISRLQ  818



>gb|KHG26690.1| Pre-mRNA-processing factor 40 A [Gossypium arboreum]
Length=960

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+++A 
Sbjct  567  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEENVAD  626

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHEDKTR+K  +
Sbjct  627  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEDKTRIKEAM  686

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFK AI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  687  KTGKVTMVYSWTFEDFKTAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  746

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITA+S+WEE K L E+S EY++I EE+  REIFEEY+T LQ
Sbjct  747  DDFTRLLHTYKEITASSNWEESKPLFEESQEYRSIAEESFRREIFEEYITHLQ  799



>ref|XP_004169188.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like, 
partial [Cucumis sativus]
Length=803

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 198/233 (85%), Gaps = 1/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRL +FQ+YIRDLEKEEE+Q+K QKE++RR ERKNRD FR +ME+HIAA
Sbjct  415  DDERCSRLEKLDRLLIFQDYIRDLEKEEEDQKKIQKERVRRIERKNRDEFRKLMEEHIAA  474

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G  TAKT WRDYC  VKE   YQAVASNTSGSTPKDLFEDV+E+LEN+YHE+KT++K+V+
Sbjct  475  GVFTAKTFWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVLEDLENKYHEEKTQIKDVV  534

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ KIT +  W+F+DFKAAI E+ G+ ++S++N +L++EDL+ERAK+KEEKEAK+RQRLA
Sbjct  535  KAAKITITSSWTFDDFKAAIEES-GSLAVSDINFKLVYEDLLERAKEKEEKEAKRRQRLA  593

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L +  EIT +S+WE+ K+L E+S EY++IGEE+  +E+FEE++T LQ
Sbjct  594  DDFSGLLQSLKEITTSSNWEDSKQLFEESEEYRSIGEESFAKEVFEEHITHLQ  646



>ref|XP_006422754.1| hypothetical protein CICLE_v100277412mg, partial [Citrus clementina]
 gb|ESR35994.1| hypothetical protein CICLE_v100277412mg, partial [Citrus clementina]
 gb|KDO49540.1| hypothetical protein CISIN_1g0018782mg, partial [Citrus sinensis]
Length=864

 Score =   251 bits (642),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+F+EYI DLEKEEEEQRK QKE LRRAERKNRD FR ++E  +A+G
Sbjct  619  DERCSRLEKIDRLEIFKEYIIDLEKEEEEQRKIQKEVLRRAERKNRDEFRKLLEGDVASG  678

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+  AY AVASNTSGSTPKDLFEDV EEL+ QY EDKTR+K+ +K
Sbjct  679  TLTAKTHWRDYCMKVKDLHAYMAVASNTSGSTPKDLFEDVAEELQKQYQEDKTRIKDAVK  738

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +KI+ S  W+FEDFKA+ILE + +P IS+VN++L+F+DL+ER K+KEEKEAKKR+RLA 
Sbjct  739  LKKISLSSTWTFEDFKASILEDVTSPPISDVNIKLVFDDLLERVKEKEEKEAKKRKRLAD  798

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  EI+A+S+WE+C +L E S E+ +IGEE+  REIF+EYVT+L+
Sbjct  799  DFFALLCSIKEISASSAWEDCIQLFEGSREFSSIGEESICREIFDEYVTQLK  850



>ref|XP_008452677.1| PREDICTED: pre-mRNA-processing protein 40A [Cucumis melo]
Length=985

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 198/233 (85%), Gaps = 1/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRL +FQ+YIRDLEKEEE+Q+K QKE++RR ERKNRD FR +ME+HIAA
Sbjct  597  DDERCSRLEKLDRLLIFQDYIRDLEKEEEDQKKIQKERVRRIERKNRDEFRKLMEEHIAA  656

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G  TAKT WRDYC  VKE   YQAVASNTSGSTPKDLFEDV+EELEN+YHE+KT++K+V+
Sbjct  657  GVFTAKTFWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVLEELENKYHEEKTQIKDVV  716

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ KIT +  W+F+DFKAAI E+ G+ ++S++N +L++EDL+ERAK+KEEKEAK+RQRLA
Sbjct  717  KAAKITITSSWTFDDFKAAIEES-GSLAVSDINFKLVYEDLLERAKEKEEKEAKRRQRLA  775

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L +  EIT +S+WE+ K+L E+S EY++IGEE+  +E+FEE++T LQ
Sbjct  776  DDFSGLLQSFKEITTSSNWEDSKQLFEESEEYRSIGEESFAKEVFEEHITHLQ  828



>ref|XP_007227030.1| hypothetical protein PRUPE_ppa000697mg [Prunus persica]
 gb|EMJ28229.1| hypothetical protein PRUPE_ppa000697mg [Prunus persica]
Length=1031

 Score =   253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL +FQ+YIRDLEKEEEEQ+K QKEQLRR ERKNRD FR +ME+H+A 
Sbjct  641  DDERCLRLEKLDRLLIFQDYIRDLEKEEEEQKKIQKEQLRRVERKNRDEFRKLMEEHVAD  700

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+  +Y+AVASNTSGSTPK+LFEDV EELE QYHEDK R+K+ +
Sbjct  701  GTLTAKTYWRDYCMKVKDLSSYEAVASNTSGSTPKELFEDVAEELEKQYHEDKARIKDAM  760

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  K+T +   +FE+FK AILE IG PSIS++N +L++E+L+ERAK+KEEKEAKKRQRL 
Sbjct  761  KLGKVTLASTLTFEEFKVAILEDIGFPSISDINFKLVYEELLERAKEKEEKEAKKRQRLG  820

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    EITA+S+WE+CK L E++ EY++IGEE   RE+FEEY+T LQ
Sbjct  821  DDFNKLLHTFKEITASSNWEDCKHLFEETQEYRSIGEENFSREVFEEYITNLQ  873



>ref|XP_008220399.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Prunus 
mume]
Length=1031

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL +FQ+YIRDLEKEEEEQ+K  KEQLRR ERKNRD FR +ME+H+A 
Sbjct  641  DDERCLRLEKLDRLLIFQDYIRDLEKEEEEQKKILKEQLRRVERKNRDEFRKLMEEHVAD  700

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+  +Y+AVASNTSGSTPK+LFEDV EELE QYHEDK R+K+ +
Sbjct  701  GTLTAKTHWRDYCMKVKDLSSYEAVASNTSGSTPKELFEDVAEELEKQYHEDKARIKDAM  760

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  K+T +   +FE+FK AILE IG PSIS++N +L++E+L+ERAK+KEEKEAKKRQRL 
Sbjct  761  KLGKVTLASTLAFEEFKVAILEDIGFPSISDINFKLVYEELLERAKEKEEKEAKKRQRLG  820

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    EITA+S+WE+CK L E++ EY++IGEE   RE+FEEY+T LQ
Sbjct  821  DDFNKLLHTFKEITASSNWEDCKHLFEETQEYRSIGEENFSREVFEEYITNLQ  873



>ref|XP_008220401.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Prunus 
mume]
Length=988

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL +FQ+YIRDLEKEEEEQ+K  KEQLRR ERKNRD FR +ME+H+A 
Sbjct  641  DDERCLRLEKLDRLLIFQDYIRDLEKEEEEQKKILKEQLRRVERKNRDEFRKLMEEHVAD  700

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+  +Y+AVASNTSGSTPK+LFEDV EELE QYHEDK R+K+ +
Sbjct  701  GTLTAKTHWRDYCMKVKDLSSYEAVASNTSGSTPKELFEDVAEELEKQYHEDKARIKDAM  760

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  K+T +   +FE+FK AILE IG PSIS++N +L++E+L+ERAK+KEEKEAKKRQRL 
Sbjct  761  KLGKVTLASTLAFEEFKVAILEDIGFPSISDINFKLVYEELLERAKEKEEKEAKKRQRLG  820

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    EITA+S+WE+CK L E++ EY++IGEE   RE+FEEY+T LQ
Sbjct  821  DDFNKLLHTFKEITASSNWEDCKHLFEETQEYRSIGEENFSREVFEEYITNLQ  873



>gb|KJB77626.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
Length=764

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEYIRDLEKEEEEQR+ QKE+LR+ ERKNRD FR ++E H+AAG
Sbjct  378  DERCSRLDKIDRLEIFQEYIRDLEKEEEEQRRIQKEELRKTERKNRDEFRKLVEGHVAAG  437

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC MVK+S  + AVASNTSG TPKDLFEDV EEL+ QY +DK RVK+ +K
Sbjct  438  TLTAKTHWRDYCMMVKDSPPFLAVASNTSGPTPKDLFEDVAEELQKQYDDDKARVKDAVK  497

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KI  +  W+ ED KAAILE I +P IS+VNL+LIFE+L+ER K+KEEKEAKKR+RLA 
Sbjct  498  LRKICLASTWTLEDLKAAILEDISSPPISDVNLKLIFEELLERVKEKEEKEAKKRKRLAD  557

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF ++L +  EIT++S+WE+CK L+E S E+ +IG+E   + IF+EYV +L+
Sbjct  558  DFFDLLHSMKEITSSSAWEDCKHLLESSQEFSSIGDEDICKGIFDEYVKQLK  609



>ref|XP_006486888.1| PREDICTED: pre-mRNA-processing protein 40A-like [Citrus sinensis]
Length=1001

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 193/232 (83%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+F+EYI DLEKEEEEQRK QKE LRRAERKNRD FR ++E  +A+G
Sbjct  619  DERCSRLEKIDRLEIFKEYIIDLEKEEEEQRKIQKEVLRRAERKNRDEFRKLLEGDVASG  678

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+  AY AVASNTSGSTPKDLFEDV EEL+ QY EDKTR+K+ +K
Sbjct  679  TLTAKTHWRDYCMKVKDLHAYMAVASNTSGSTPKDLFEDVAEELQKQYQEDKTRIKDAVK  738

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +KI+ S  W+FEDFKA+ILE + +P IS+VN++L+F+DL+ER K+KEEKEAKKR+RLA 
Sbjct  739  LKKISLSSTWTFEDFKASILEDVTSPPISDVNIKLVFDDLLERVKEKEEKEAKKRKRLAD  798

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  EI+A+S+WE+C +L E S E+ +IGEE+  REIF+EYVT+L+
Sbjct  799  DFFALLCSIKEISASSAWEDCIQLFEGSREFSSIGEESICREIFDEYVTQLK  850



>ref|XP_004141297.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cucumis sativus]
 gb|KGN55293.1| hypothetical protein Csa_4G644700 [Cucumis sativus]
Length=985

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 198/233 (85%), Gaps = 1/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRL +FQ+YIRDLEKEEE+Q+K QKE++RR ERKNRD FR +ME+HIAA
Sbjct  597  DDERCSRLEKLDRLLIFQDYIRDLEKEEEDQKKIQKERVRRIERKNRDEFRKLMEEHIAA  656

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G  TAKT WRDYC  VKE   YQAVASNTSGSTPKDLFEDV+E+LEN+YHE+KT++K+V+
Sbjct  657  GVFTAKTFWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVLEDLENKYHEEKTQIKDVV  716

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ KIT +  W+F+DFKAAI E+ G+ ++S++N +L++EDL+ERAK+KEEKEAK+RQRLA
Sbjct  717  KAAKITITSSWTFDDFKAAIEES-GSLAVSDINFKLVYEDLLERAKEKEEKEAKRRQRLA  775

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L +  EIT +S+WE+ K+L E+S EY++IGEE+  +E+FEE++T LQ
Sbjct  776  DDFSGLLQSLKEITTSSNWEDSKQLFEESEEYRSIGEESFAKEVFEEHITHLQ  828



>ref|XP_010918636.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Elaeis 
guineensis]
Length=791

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRR ERKNRD FR +ME+H+AA
Sbjct  394  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRQERKNRDEFRKLMEEHVAA  453

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+  +Y AV+SNTSGSTPKDLFEDV EELE QYHEDK ++K  +
Sbjct  454  GILTAKTHWRDYCMQVKDLPSYIAVSSNTSGSTPKDLFEDVAEELEKQYHEDKAQIKEAI  513

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FEDFKAA L       ISE N++L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  514  KIRKIALASSWTFEDFKAATLGDDSLKGISETNMKLVFDELLERLREKEEKEAKKRQRLA  573

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA+S WE+CK L EDS EY++IG+E  +REIFEE+VTRLQ
Sbjct  574  DNFSDLLYSIKEITASSRWEDCKSLFEDSQEYRSIGDENVVREIFEEHVTRLQ  626



>gb|KJB77624.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
Length=1003

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEYIRDLEKEEEEQR+ QKE+LR+ ERKNRD FR ++E H+AAG
Sbjct  608  DERCSRLDKIDRLEIFQEYIRDLEKEEEEQRRIQKEELRKTERKNRDEFRKLVEGHVAAG  667

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC MVK+S  + AVASNTSG TPKDLFEDV EEL+ QY +DK RVK+ +K
Sbjct  668  TLTAKTHWRDYCMMVKDSPPFLAVASNTSGPTPKDLFEDVAEELQKQYDDDKARVKDAVK  727

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KI  +  W+ ED KAAILE I +P IS+VNL+LIFE+L+ER K+KEEKEAKKR+RLA 
Sbjct  728  LRKICLASTWTLEDLKAAILEDISSPPISDVNLKLIFEELLERVKEKEEKEAKKRKRLAD  787

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF ++L +  EIT++S+WE+CK L+E S E+ +IG+E   + IF+EYV +L+
Sbjct  788  DFFDLLHSMKEITSSSAWEDCKHLLESSQEFSSIGDEDICKGIFDEYVKQLK  839



>gb|KJB77621.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
 gb|KJB77622.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
 gb|KJB77623.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
 gb|KJB77625.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
Length=994

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEYIRDLEKEEEEQR+ QKE+LR+ ERKNRD FR ++E H+AAG
Sbjct  608  DERCSRLDKIDRLEIFQEYIRDLEKEEEEQRRIQKEELRKTERKNRDEFRKLVEGHVAAG  667

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC MVK+S  + AVASNTSG TPKDLFEDV EEL+ QY +DK RVK+ +K
Sbjct  668  TLTAKTHWRDYCMMVKDSPPFLAVASNTSGPTPKDLFEDVAEELQKQYDDDKARVKDAVK  727

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KI  +  W+ ED KAAILE I +P IS+VNL+LIFE+L+ER K+KEEKEAKKR+RLA 
Sbjct  728  LRKICLASTWTLEDLKAAILEDISSPPISDVNLKLIFEELLERVKEKEEKEAKKRKRLAD  787

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF ++L +  EIT++S+WE+CK L+E S E+ +IG+E   + IF+EYV +L+
Sbjct  788  DFFDLLHSMKEITSSSAWEDCKHLLESSQEFSSIGDEDICKGIFDEYVKQLK  839



>ref|XP_002320019.2| FF domain-containing family protein [Populus trichocarpa]
 gb|EEE98334.2| FF domain-containing family protein [Populus trichocarpa]
Length=1019

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC  L K+DRL +FQ+YIRDLEKEEEEQ+K QKEQLRRAERKNRD FR ++E+H+A+
Sbjct  612  DDERCLCLEKLDRLLIFQDYIRDLEKEEEEQKKIQKEQLRRAERKNRDEFRKLLEEHVAS  671

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G++TAKT W DYC  VK+   YQAVA+NTSGS PKDLFEDV EELE QYH+DKTR+K+ +
Sbjct  672  GSLTAKTHWLDYCLKVKDLPPYQAVATNTSGSKPKDLFEDVSEELEKQYHDDKTRIKDAM  731

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KIT    W+FEDFK A+ + IG+P IS++NL+L++E+L+ERAK+KEEKEAKK+QRLA
Sbjct  732  KLGKITMVSTWTFEDFKGAVADDIGSPPISDINLKLLYEELVERAKEKEEKEAKKQQRLA  791

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    E+T +S+WE+CK L E+S EY++IGEE+  +EIFEEYVT LQ
Sbjct  792  DDFTKLLYTLKEVTPSSNWEDCKPLFEESQEYRSIGEESLSKEIFEEYVTHLQ  844



>ref|XP_010918635.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Elaeis 
guineensis]
Length=1048

 Score =   248 bits (634),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRR ERKNRD FR +ME+H+AA
Sbjct  651  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRQERKNRDEFRKLMEEHVAA  710

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+  +Y AV+SNTSGSTPKDLFEDV EELE QYHEDK ++K  +
Sbjct  711  GILTAKTHWRDYCMQVKDLPSYIAVSSNTSGSTPKDLFEDVAEELEKQYHEDKAQIKEAI  770

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FEDFKAA L       ISE N++L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  771  KIRKIALASSWTFEDFKAATLGDDSLKGISETNMKLVFDELLERLREKEEKEAKKRQRLA  830

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA+S WE+CK L EDS EY++IG+E  +REIFEE+VTRLQ
Sbjct  831  DNFSDLLYSIKEITASSRWEDCKSLFEDSQEYRSIGDENVVREIFEEHVTRLQ  883



>ref|XP_007042685.1| Pre-mRNA-processing protein 40B, putative [Theobroma cacao]
 gb|EOX98516.1| Pre-mRNA-processing protein 40B, putative [Theobroma cacao]
Length=1025

 Score =   248 bits (633),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 187/234 (80%), Gaps = 3/234 (1%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQRK QKE+LR+AERKNRD FR +ME H+AAG
Sbjct  635  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRKIQKEELRKAERKNRDEFRKLMEGHVAAG  694

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC MVKES  + AVASNTSGSTPKDLFEDV EEL+ QYH+DK RVK+ +K
Sbjct  695  TLTAKTHWRDYCMMVKESPPFMAVASNTSGSTPKDLFEDVAEELQKQYHDDKARVKDAVK  754

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KI+ +  W+ ED K AI E I +P IS+VNL+L+FE+L++R ++KEEKEAKKR+ LA 
Sbjct  755  LRKISLASTWTLEDLKVAIAEDISSPPISDVNLKLVFEELLQRVREKEEKEAKKRKHLAD  814

Query  201  DFVEMLSNADE---ITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
            DF ++L +  E   IT++S+WE+CK   E S E+ +IG+E   + IFEEY+T L
Sbjct  815  DFYDLLRSIKEDEKITSSSTWEDCKYHFESSQEFSSIGDEGFCKGIFEEYITEL  868



>ref|XP_002510055.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52242.1| protein binding protein, putative [Ricinus communis]
Length=970

 Score =   248 bits (633),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 189/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+DRL VFQ+YIRDLEKEEEEQ+K QKEQLRRAERKNRD FR ++E+H+A 
Sbjct  577  DDERCLRLEKLDRLLVFQDYIRDLEKEEEEQKKIQKEQLRRAERKNRDGFRKLLEEHVAD  636

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G++TAK  W DYC  VK+   Y AVA+NTSGSTPKDLFEDV EELE QY +DK RVK+ +
Sbjct  637  GSLTAKAHWLDYCLKVKDLPQYHAVATNTSGSTPKDLFEDVAEELEKQYRDDKARVKDAI  696

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W FEDFKAAIL+ + +P +S++NLQLI+++L+ERAK+KEEKEAKKRQRLA
Sbjct  697  KSGKIIMTSTWIFEDFKAAILDDVSSPPVSDINLQLIYDELLERAKEKEEKEAKKRQRLA  756

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             D  ++L    EI A+SSWE+C+ L E+S EY+AIGEE+ ++EIFEEY+  LQ
Sbjct  757  DDLTKLLHTYKEIMASSSWEDCRPLFEESQEYRAIGEESVIKEIFEEYIAHLQ  809



>ref|XP_002300284.2| hypothetical protein POPTR_0001s29710g [Populus trichocarpa]
 gb|EEE85089.2| hypothetical protein POPTR_0001s29710g [Populus trichocarpa]
Length=972

 Score =   248 bits (632),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDR+E+FQ+Y+ DLEKEEEEQRK  KE+LR+AERKNRD FR ++E+H+AAG
Sbjct  586  DERCSRLEKIDRIEIFQDYLHDLEKEEEEQRKIHKEELRKAERKNRDEFRKLLEEHVAAG  645

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKTR+K+V+K
Sbjct  646  TLTAKTNWRDYHLKVKDLPAYVAVASNNSGSTPKDLFEDVAEELQKQYHEDKTRIKDVVK  705

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+  +  W+ ED K AI+E +G+P IS+VNL+++F++L+ERA++KEEKEA+KR+RL  
Sbjct  706  LKKVPLASTWTLEDLKVAIIEDVGSPHISDVNLKMVFDELLERAREKEEKEARKRKRLED  765

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE CKE+ + S EY +IGEE   REIFEEYV++L+
Sbjct  766  DFLILLQSIKDITASSKWESCKEIFDGSREYSSIGEEGFCREIFEEYVSQLK  817



>ref|XP_002522113.1| protein binding protein, putative [Ricinus communis]
 gb|EEF40313.1| protein binding protein, putative [Ricinus communis]
Length=956

 Score =   248 bits (632),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+RDLEKEEEEQRK QKE+ R+AERKNRD FR ++E+H+AAG
Sbjct  568  DERCSRLEKIDRLEIFQDYLRDLEKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEHVAAG  627

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV+EELE QYHEDK+R+K+ +K
Sbjct  628  TMTAKTHWRDYYLKVKDLPAYLAVASNTSGSTPKDLFEDVLEELEKQYHEDKSRIKDAVK  687

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+  +  W+ +D KAAI+E I +PSIS++NL+++F++L+ERAK+KEEK+AKKR+RLA 
Sbjct  688  LKKVAMASTWTLDDLKAAIVEDISSPSISDMNLKIVFDELLERAKEKEEKDAKKRKRLAD  747

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE CKEL E S E+ +I EE+  ++IFEEY+ +L+
Sbjct  748  DFLNLLHSTKDITASSKWESCKELFEGSREFSSINEESICQDIFEEYIAQLK  799



>ref|XP_011030297.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like 
[Populus euphratica]
Length=1032

 Score =   248 bits (632),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDR+E+FQ+Y+ DLEKEEEEQRK  KE+LR+AERKNRD FR ++E+H+AAG
Sbjct  646  DERCSRLEKIDRIEIFQDYLHDLEKEEEEQRKIHKEELRKAERKNRDEFRKLLEEHVAAG  705

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKTR+K+V+K
Sbjct  706  TLTAKTNWRDYHLKVKDLPAYVAVASNNSGSTPKDLFEDVAEELQKQYHEDKTRIKDVVK  765

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+  +  W+ ED K AI+E +G+P IS+VNL+++F++L+ERA++KEEKEA+KR+RL  
Sbjct  766  LKKVPLASTWTLEDLKVAIVEDVGSPHISDVNLKMVFDELLERAREKEEKEARKRKRLED  825

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE CKE+ + S EY +IGEE   REIFEEYV++L+
Sbjct  826  DFLILLQSIKDITASSKWESCKEIFDGSREYSSIGEEGFCREIFEEYVSQLK  877



>gb|KDO49545.1| hypothetical protein CISIN_1g001687mg [Citrus sinensis]
Length=996

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQEY+ DLEKEEEEQRK QKE+L + ERKNRD FR +ME  +A G
Sbjct  613  DERCSRLDKMDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEADVALG  672

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDVVEEL+ Q+ EDKTR+K+ +K
Sbjct  673  TLTAKTNWRDYCIKVKDSPPYMAVASNTSGSTPKDLFEDVVEELQKQFQEDKTRIKDAVK  732

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFKA++LE   +P IS+VNL+LIF+DL+ + K+KEEKEAKKR+RL  
Sbjct  733  LRKITLSSTWTFEDFKASVLEDATSPPISDVNLKLIFDDLLIKVKEKEEKEAKKRKRLED  792

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EI+A S+WE C++L+E S E+ +IG+E+  R +F+E+VT+L+
Sbjct  793  EFFDLLCSVKEISATSTWENCRQLLEGSQEFSSIGDESICRGVFDEFVTQLK  844



>ref|XP_006422756.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
 gb|ESR35996.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
Length=996

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQEY+ DLEKEEEEQRK QKE+L + ERKNRD FR +ME  +A G
Sbjct  613  DERCSRLDKMDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEADVALG  672

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDVVEEL+ Q+ EDKTR+K+ +K
Sbjct  673  TLTAKTNWRDYCIKVKDSPPYMAVASNTSGSTPKDLFEDVVEELQKQFQEDKTRIKDAVK  732

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFKA++LE   +P IS+VNL+LIF+DL+ + K+KEEKEAKKR+RL  
Sbjct  733  LRKITLSSTWTFEDFKASVLEDATSPPISDVNLKLIFDDLLIKVKEKEEKEAKKRKRLED  792

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EI+A S+WE C++L+E S E+ +IG+E+  R +F+E+VT+L+
Sbjct  793  EFFDLLCSVKEISATSTWENCRQLLEGSQEFSSIGDESICRGVFDEFVTQLK  844



>ref|XP_006486884.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486885.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Citrus 
sinensis]
 ref|XP_006486886.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Citrus 
sinensis]
 ref|XP_006486887.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Citrus 
sinensis]
Length=1029

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQEY+ DLEKEEEEQRK QKE+L + ERKNRD FR +ME  +A G
Sbjct  646  DERCSRLDKMDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEADVALG  705

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDVVEEL+ Q+ EDKTR+K+ +K
Sbjct  706  TLTAKTNWRDYCIKVKDSPPYMAVASNTSGSTPKDLFEDVVEELQKQFQEDKTRIKDAVK  765

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFKA++LE   +P IS+VNL+LIF+DL+ + K+KEEKEAKKR+RL  
Sbjct  766  LRKITLSSTWTFEDFKASVLEDATSPPISDVNLKLIFDDLLIKVKEKEEKEAKKRKRLED  825

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EI+A S+WE C++L+E S E+ +IG+E+  R +F+E+VT+L+
Sbjct  826  EFFDLLCSVKEISATSTWENCRQLLEGSQEFSSIGDESICRGVFDEFVTQLK  877



>gb|KDO49541.1| hypothetical protein CISIN_1g0018782mg, partial [Citrus sinensis]
Length=863

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 193/232 (83%), Gaps = 1/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+F+EYI DLEKEEEEQRK QKE LRRAERKNRD FR ++E  +A+G
Sbjct  619  DERCSRLEKIDRLEIFKEYIIDLEKEEEEQRKIQKEVLRRAERKNRDEFRKLLEGDVASG  678

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+  AY AVASNTSGSTPKDLFEDV EEL+ QY EDKTR+K+ +K
Sbjct  679  TLTAKTHWRDYCMKVKDLHAYMAVASNTSGSTPKDLFEDVAEELQKQYQEDKTRIKDAVK  738

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +KI+ S  W+FEDFKA+ILE + +P IS+VN++L+F+DL+ER K+KEEKEAKKR+RLA 
Sbjct  739  LKKISLSSTWTFEDFKASILEDVTSPPISDVNIKLVFDDLLERVKEKEEKEAKKRKRLAD  798

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +I+A+S+WE+C +L E S E+ +IGEE+  REIF+EYVT+L+
Sbjct  799  DFFALLCSI-KISASSAWEDCIQLFEGSREFSSIGEESICREIFDEYVTQLK  849



>gb|KDO49544.1| hypothetical protein CISIN_1g001687mg [Citrus sinensis]
Length=1029

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQEY+ DLEKEEEEQRK QKE+L + ERKNRD FR +ME  +A G
Sbjct  646  DERCSRLDKMDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEADVALG  705

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDVVEEL+ Q+ EDKTR+K+ +K
Sbjct  706  TLTAKTNWRDYCIKVKDSPPYMAVASNTSGSTPKDLFEDVVEELQKQFQEDKTRIKDAVK  765

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFKA++LE   +P IS+VNL+LIF+DL+ + K+KEEKEAKKR+RL  
Sbjct  766  LRKITLSSTWTFEDFKASVLEDATSPPISDVNLKLIFDDLLIKVKEKEEKEAKKRKRLED  825

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EI+A S+WE C++L+E S E+ +IG+E+  R +F+E+VT+L+
Sbjct  826  EFFDLLCSVKEISATSTWENCRQLLEGSQEFSSIGDESICRGVFDEFVTQLK  877



>ref|XP_006422757.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
 gb|ESR35997.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
Length=1029

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQEY+ DLEKEEEEQRK QKE+L + ERKNRD FR +ME  +A G
Sbjct  646  DERCSRLDKMDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEADVALG  705

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDVVEEL+ Q+ EDKTR+K+ +K
Sbjct  706  TLTAKTNWRDYCIKVKDSPPYMAVASNTSGSTPKDLFEDVVEELQKQFQEDKTRIKDAVK  765

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFKA++LE   +P IS+VNL+LIF+DL+ + K+KEEKEAKKR+RL  
Sbjct  766  LRKITLSSTWTFEDFKASVLEDATSPPISDVNLKLIFDDLLIKVKEKEEKEAKKRKRLED  825

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EI+A S+WE C++L+E S E+ +IG+E+  R +F+E+VT+L+
Sbjct  826  EFFDLLCSVKEISATSTWENCRQLLEGSQEFSSIGDESICRGVFDEFVTQLK  877



>ref|XP_007018440.1| Pre-mRNA-processing protein 40A isoform 5 [Theobroma cacao]
 gb|EOY15665.1| Pre-mRNA-processing protein 40A isoform 5 [Theobroma cacao]
Length=904

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +M++H+  
Sbjct  648  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMDEHVVD  707

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE QY +DKT +K+ +
Sbjct  708  GTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQYQQDKTHIKDAM  767

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W+ EDFKAAI E +G+  IS++NL+L++E+L++ AK+KEEKEAKKRQRLA
Sbjct  768  KSGKISMVSTWTVEDFKAAISEDVGSLPISDINLKLVYEELLKSAKEKEEKEAKKRQRLA  827

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    EITA+S WE+ + L E+S EY++I EE+  REIFEEY+  LQ
Sbjct  828  DDFTKLLHTYKEITASSDWEDSRPLFEESQEYRSIAEESLRREIFEEYIAYLQ  880



>ref|XP_007018438.1| Pre-mRNA-processing protein 40A isoform 3 [Theobroma cacao]
 gb|EOY15663.1| Pre-mRNA-processing protein 40A isoform 3 [Theobroma cacao]
Length=1041

 Score =   245 bits (626),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +M++H+  
Sbjct  648  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMDEHVVD  707

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE QY +DKT +K+ +
Sbjct  708  GTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQYQQDKTHIKDAM  767

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W+ EDFKAAI E +G+  IS++NL+L++E+L++ AK+KEEKEAKKRQRLA
Sbjct  768  KSGKISMVSTWTVEDFKAAISEDVGSLPISDINLKLVYEELLKSAKEKEEKEAKKRQRLA  827

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    EITA+S WE+ + L E+S EY++I EE+  REIFEEY+  LQ
Sbjct  828  DDFTKLLHTYKEITASSDWEDSRPLFEESQEYRSIAEESLRREIFEEYIAYLQ  880



>ref|XP_007018436.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
 ref|XP_007018437.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
 gb|EOY15661.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
 gb|EOY15662.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
Length=1032

 Score =   245 bits (625),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +M++H+  
Sbjct  639  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMDEHVVD  698

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE QY +DKT +K+ +
Sbjct  699  GTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQYQQDKTHIKDAM  758

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W+ EDFKAAI E +G+  IS++NL+L++E+L++ AK+KEEKEAKKRQRLA
Sbjct  759  KSGKISMVSTWTVEDFKAAISEDVGSLPISDINLKLVYEELLKSAKEKEEKEAKKRQRLA  818

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    EITA+S WE+ + L E+S EY++I EE+  REIFEEY+  LQ
Sbjct  819  DDFTKLLHTYKEITASSDWEDSRPLFEESQEYRSIAEESLRREIFEEYIAYLQ  871



>ref|XP_010248342.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Nelumbo 
nucifera]
Length=1034

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEY+RDLEKEEEEQ+K  KEQLR AERKNR+ FR ++E+H+AA
Sbjct  634  DDERCSRLEKIDRLEIFQEYVRDLEKEEEEQKKIHKEQLRWAERKNREEFRKLLEEHVAA  693

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AK  WRDYC  VK+  AY AVASN+SGSTPKDLFEDV EELE QY EDKTR+K+ +
Sbjct  694  GTLIAKIHWRDYCMKVKDLPAYLAVASNSSGSTPKDLFEDVAEELEKQYREDKTRIKDAM  753

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+ +DFK+AI + +G+P IS+VNL+LIF +L+ER K+KEEKEAKKRQ LA
Sbjct  754  KLGKINMASTWTLDDFKSAIADDVGSPPISDVNLKLIFAELLERIKEKEEKEAKKRQCLA  813

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF E+L +   ITA+S W++ K L EDS EY++I E +  REIFEEY+  LQ
Sbjct  814  DDFSELLYSIKGITASSKWKDSKSLFEDSQEYRSILEGSFRREIFEEYIMHLQ  866



>ref|XP_010248344.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Nelumbo 
nucifera]
Length=1033

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEY+RDLEKEEEEQ+K  KEQLR AERKNR+ FR ++E+H+AA
Sbjct  634  DDERCSRLEKIDRLEIFQEYVRDLEKEEEEQKKIHKEQLRWAERKNREEFRKLLEEHVAA  693

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AK  WRDYC  VK+  AY AVASN+SGSTPKDLFEDV EELE QY EDKTR+K+ +
Sbjct  694  GTLIAKIHWRDYCMKVKDLPAYLAVASNSSGSTPKDLFEDVAEELEKQYREDKTRIKDAM  753

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+ +DFK+AI + +G+P IS+VNL+LIF +L+ER K+KEEKEAKKRQ LA
Sbjct  754  KLGKINMASTWTLDDFKSAIADDVGSPPISDVNLKLIFAELLERIKEKEEKEAKKRQCLA  813

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF E+L +   ITA+S W++ K L EDS EY++I E +  REIFEEY+  LQ
Sbjct  814  DDFSELLYSIKGITASSKWKDSKSLFEDSQEYRSILEGSFRREIFEEYIMHLQ  866



>ref|XP_010999910.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Populus 
euphratica]
Length=861

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 189/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC  L K+DRL +FQ+YIRDLEKEEEEQ+K QKEQLRRAERKNRD FR ++E+H+A+
Sbjct  612  DDERCLCLEKLDRLLIFQDYIRDLEKEEEEQKKIQKEQLRRAERKNRDEFRKLLEEHVAS  671

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  VK+   YQA+A+NTSGS PKDLFEDV EELE QYH+DKTR+K+ +
Sbjct  672  GFLTAKTHWLDYCLKVKDLPQYQAIATNTSGSKPKDLFEDVSEELEKQYHDDKTRIKDAM  731

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KIT    W+FEDFK A+ + IG+  IS++NL+L++E+L+ERAK+KEEKEAKK+QRL 
Sbjct  732  KLGKITMVSTWTFEDFKGAVADDIGSSPISDINLKLLYEELVERAKEKEEKEAKKQQRLV  791

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    E+T +S+WE+CK L E+S EY++IGEE+  +EIFEEYVT LQ
Sbjct  792  DDFTKLLYTLKEVTPSSNWEDCKPLFEESQEYRSIGEESLSKEIFEEYVTHLQ  844



>ref|XP_011457824.1| PREDICTED: pre-mRNA-processing protein 40A-like [Fragaria vesca 
subsp. vesca]
Length=1031

 Score =   243 bits (619),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 189/250 (76%), Gaps = 18/250 (7%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQR+ QKE++R+AERKNRD FR +ME+HIAAG
Sbjct  625  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRRIQKEEIRKAERKNRDEFRKVMEEHIAAG  684

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA T WRDY  MVK+  AY AVASN+SGSTPKDLFEDV+EELE QY  D+ R+K+V+K
Sbjct  685  ALTATTHWRDYILMVKDLPAYMAVASNSSGSTPKDLFEDVIEELEKQYQSDRVRIKDVVK  744

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNL------------------QLIFEDLMe  256
            S KI  S  W  E FK A+   IG+PSIS+ NL                  Q++FE+LME
Sbjct  745  SGKIVLSSTWDLEAFKTAVSNDIGSPSISDANLMFSGQAMIRDIGWLTQHFQVVFEELME  804

Query  255  rakdkeekeakkrqrlaKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLRE  76
            R ++KEEKEAK+R+RLA DF   LS+  EIT +S WE CK L+E SSEY AIGEE++ +E
Sbjct  805  RVREKEEKEAKRRKRLADDFFHFLSSFKEITPSSKWENCKSLLEVSSEYSAIGEESSCKE  864

Query  75   IFEEYVTRLQ  46
            IF++++T+L+
Sbjct  865  IFDKHITQLK  874



>ref|XP_010999909.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
Length=1019

 Score =   242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 189/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC  L K+DRL +FQ+YIRDLEKEEEEQ+K QKEQLRRAERKNRD FR ++E+H+A+
Sbjct  612  DDERCLCLEKLDRLLIFQDYIRDLEKEEEEQKKIQKEQLRRAERKNRDEFRKLLEEHVAS  671

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  VK+   YQA+A+NTSGS PKDLFEDV EELE QYH+DKTR+K+ +
Sbjct  672  GFLTAKTHWLDYCLKVKDLPQYQAIATNTSGSKPKDLFEDVSEELEKQYHDDKTRIKDAM  731

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KIT    W+FEDFK A+ + IG+  IS++NL+L++E+L+ERAK+KEEKEAKK+QRL 
Sbjct  732  KLGKITMVSTWTFEDFKGAVADDIGSSPISDINLKLLYEELVERAKEKEEKEAKKQQRLV  791

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    E+T +S+WE+CK L E+S EY++IGEE+  +EIFEEYVT LQ
Sbjct  792  DDFTKLLYTLKEVTPSSNWEDCKPLFEESQEYRSIGEESLSKEIFEEYVTHLQ  844



>ref|XP_007201807.1| hypothetical protein PRUPE_ppa000966mg [Prunus persica]
 gb|EMJ03006.1| hypothetical protein PRUPE_ppa000966mg [Prunus persica]
Length=947

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 186/232 (80%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQR+ QKE+LR+ ERKNRD FR +ME+H+AAG
Sbjct  558  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRRIQKEELRKTERKNRDDFRKLMEEHLAAG  617

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAK+ WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEEL+ QYHEDKTR+K+ +K
Sbjct  618  TLTAKSHWRDYCMKVKDLPTYLAVASNTSGSTPKDLFEDVVEELQKQYHEDKTRIKDAVK  677

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  +  W  EDFK  I   IG+P IS+ NL+L+F++L+ER K+KEEKEAKKR+RLA 
Sbjct  678  LGKVMLTSTWKLEDFKTVISNDIGSPPISDANLKLVFDELLERVKEKEEKEAKKRKRLAD  737

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +LS+  EIT +S WE+ K L+E S E  AIGEE+  +EIF+++V +L+
Sbjct  738  DFSHLLSSIKEITPSSKWEDYKSLLEGSQECSAIGEESFCKEIFDKHVMQLK  789



>ref|XP_008380122.1| PREDICTED: pre-mRNA-processing protein 40A-like [Malus domestica]
Length=1031

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+ RL +FQ+YIRDLEK EEEQ+K QKEQLRR ERKNRD FR +ME+H+A 
Sbjct  614  DDERCLRLEKLARLLIFQDYIRDLEKVEEEQKKLQKEQLRRVERKNRDEFRKLMEEHVAD  673

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKTLWRDYC  VK+   Y+AVA NTSGSTPK+LF+DV EELE QYH+DK R+K+ +
Sbjct  674  GTLTAKTLWRDYCLKVKDLPPYEAVALNTSGSTPKELFDDVFEELEKQYHDDKARIKDAM  733

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K+  +   +FE+FK  ILE IG+P IS++N +L++E+L+ERAK+KEEKEAKK QRLA
Sbjct  734  KSGKVAMASTLAFEEFKVPILEEIGSPPISDINFKLVYEELLERAKEKEEKEAKKXQRLA  793

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF + L    EITA+S+WE+ K+L E++ EY++IGE++  REIFEEY+T LQ
Sbjct  794  DDFNKXLHTIKEITASSNWEDSKQLFEETQEYRSIGEDSVSREIFEEYITNLQ  846



>ref|XP_006589615.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Glycine 
max]
Length=770

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+ DLEKEEEEQ+K QKE+LR+ ERKNR+ FR +ME+HIA+G
Sbjct  392  DERCSRLEKIDRLEIFQDYLHDLEKEEEEQKKIQKEELRKTERKNREEFRKLMEEHIASG  451

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV EELE QYHE+K+R+K+ +K
Sbjct  452  ILTAKTHWRDYYTKVKDLHAYVAVASNTSGSTPKDLFEDVAEELEKQYHEEKSRIKDTVK  511

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFK+A+ + I TP IS+ NL+L+F++L+ERAK+KEEKEAKKR+RL+ 
Sbjct  512  LAKITLSSTWAFEDFKSALSKAISTPPISDFNLKLVFDELLERAKEKEEKEAKKRKRLSD  571

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +  WE+C+  VEDS E+++IG+E+  +E+FEEY+ +L+
Sbjct  572  DFFHLLHSTKDITVSLKWEDCRPHVEDSQEFRSIGDESLCKEVFEEYIAQLK  623



>ref|XP_010095738.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
 gb|EXB62121.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
Length=964

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 185/232 (80%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC  L KIDRLE FQEY+ DLE+EEEEQRK QKE+LR+AERKNRD FR +MEDH+AAG
Sbjct  572  DERCYCLEKIDRLEHFQEYLNDLEREEEEQRKIQKEELRKAERKNRDEFRKLMEDHVAAG  631

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VKE   YQAVASNTSGST KDLFEDVVEEL+ QYH+DK+RVK+ +K
Sbjct  632  TLTAKTHWRDYCVKVKELPEYQAVASNTSGSTSKDLFEDVVEELQKQYHDDKSRVKDAVK  691

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+ +DFK AI   IG+P + +VNL+L+F++L+ER ++KEEKEAKKR+RL  
Sbjct  692  LGKITLSSTWTLDDFKNAITNDIGSPPVRDVNLKLVFDELLERVREKEEKEAKKRKRLVD  751

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +LS+  EI A+S WE+CK L + S EY +IG E+  ++IFE+YV +L+
Sbjct  752  DFSYLLSSIKEINASSEWEDCKSLFDKSHEYSSIGLESLCQQIFEKYVMQLK  803



>ref|XP_008337025.1| PREDICTED: pre-mRNA-processing protein 40A-like [Malus domestica]
Length=1085

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+ RL +FQ+YIRDLEK EEEQ+K QKEQLRR ERKNRD FR +ME+H+A 
Sbjct  668  DDERCLRLEKLARLLIFQDYIRDLEKVEEEQKKLQKEQLRRVERKNRDEFRKLMEEHVAD  727

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKTLWRDYC  VK+   Y+AVA NTSGSTPK+LF+DV EELE QYH+DK R+K+ +
Sbjct  728  GTLTAKTLWRDYCLKVKDLPPYEAVALNTSGSTPKELFDDVFEELEKQYHDDKARIKDAM  787

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K+  +   +FE+FK  ILE IG+P IS++N +L++E+L+ERAK+KEEKEAKK QRLA
Sbjct  788  KSGKVXMASTLAFEEFKVPILEXIGSPPISDINFKLVYEELLERAKEKEEKEAKKXQRLA  847

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF + L    EITA+S+WE+ K+L E++ EY++IGE++  REIFEEY+T LQ
Sbjct  848  DDFNKXLHTIKEITASSNWEDSKQLFEETQEYRSIGEDSVSREIFEEYITNLQ  900



>ref|XP_008236261.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like 
[Prunus mume]
Length=1009

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 186/232 (80%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQR+ QKE+LR+ ERKNRD FR +ME+H+AAG
Sbjct  620  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRRIQKEELRKTERKNRDDFRKLMEEHLAAG  679

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAK+ WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEEL+ QYHEDKTR+K+ +K
Sbjct  680  TLTAKSHWRDYCMKVKDLPTYLAVASNTSGSTPKDLFEDVVEELQKQYHEDKTRIKDAVK  739

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  +  W  EDFK  I   IG+P IS+ NL+L+F++L+ER K+KEEKEAKKR+RLA 
Sbjct  740  LGKVMLTSTWKLEDFKTVISNDIGSPPISDANLKLVFDELLERVKEKEEKEAKKRKRLAD  799

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +LS+  E+T +S WE+ K L+E S E  AIGEE+  +EIF+++V +L+
Sbjct  800  DFSHLLSSIKEMTPSSKWEDYKSLLEGSQECSAIGEESFCKEIFDKHVMQLK  851



>ref|XP_006589614.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Glycine 
max]
Length=1017

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+ DLEKEEEEQ+K QKE+LR+ ERKNR+ FR +ME+HIA+G
Sbjct  639  DERCSRLEKIDRLEIFQDYLHDLEKEEEEQKKIQKEELRKTERKNREEFRKLMEEHIASG  698

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV EELE QYHE+K+R+K+ +K
Sbjct  699  ILTAKTHWRDYYTKVKDLHAYVAVASNTSGSTPKDLFEDVAEELEKQYHEEKSRIKDTVK  758

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFK+A+ + I TP IS+ NL+L+F++L+ERAK+KEEKEAKKR+RL+ 
Sbjct  759  LAKITLSSTWAFEDFKSALSKAISTPPISDFNLKLVFDELLERAKEKEEKEAKKRKRLSD  818

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +  WE+C+  VEDS E+++IG+E+  +E+FEEY+ +L+
Sbjct  819  DFFHLLHSTKDITVSLKWEDCRPHVEDSQEFRSIGDESLCKEVFEEYIAQLK  870



>ref|XP_003535678.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Glycine 
max]
Length=1017

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+ DLEKEEEEQ+K QKE+LR+ ERKNR+ FR +ME+HIA+G
Sbjct  639  DERCSRLEKIDRLEIFQDYLHDLEKEEEEQKKIQKEELRKTERKNREEFRKLMEEHIASG  698

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV EELE QYHE+K+R+K+ +K
Sbjct  699  ILTAKTHWRDYYTKVKDLHAYVAVASNTSGSTPKDLFEDVAEELEKQYHEEKSRIKDTVK  758

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S  W+FEDFK+A+ + I TP IS+ NL+L+F++L+ERAK+KEEKEAKKR+RL+ 
Sbjct  759  LAKITLSSTWAFEDFKSALSKAISTPPISDFNLKLVFDELLERAKEKEEKEAKKRKRLSD  818

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +  WE+C+  VEDS E+++IG+E+  +E+FEEY+ +L+
Sbjct  819  DFFHLLHSTKDITVSLKWEDCRPHVEDSQEFRSIGDESLCKEVFEEYIAQLK  870



>ref|XP_009361094.1| PREDICTED: pre-mRNA-processing protein 40A [Pyrus x bretschneideri]
Length=1023

 Score =   239 bits (610),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+ RL +FQ+YIRDLEK EEEQ+K QKEQLRR ERKNRD FR +ME+H+A 
Sbjct  633  DDERCLRLEKLARLLIFQDYIRDLEKVEEEQKKLQKEQLRRVERKNRDEFRKLMEEHVAD  692

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKTLWRDYC  VK+   Y+AVA NTSGSTPK+LF+DV EELE QYH+DK R+K+ +
Sbjct  693  GTLTAKTLWRDYCMKVKDLPPYEAVALNTSGSTPKELFDDVFEELEKQYHDDKARIKDAM  752

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K T +   +FE+FK  ILE IG+P IS++N +L++E+L+ERAK+KE+KEAKKRQRLA
Sbjct  753  KSGKFTMTSTLAFEEFKVPILEDIGSPPISDINFKLVYEELLERAKEKEDKEAKKRQRLA  812

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
             DF ++L    EITA+S+W++ K+L E++ EY+++GE++  REIFEEY+T L
Sbjct  813  DDFNKLLHTIKEITASSNWDDSKQLFEETQEYRSVGEDSVSREIFEEYITSL  864



>ref|XP_007143139.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15133.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
Length=772

 Score =   237 bits (604),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCS L KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE+LR+ ERKNRD FR +MEDHIA+G
Sbjct  393  DERCSCLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEELRKTERKNRDEFRKLMEDHIASG  452

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDL+EDV EELE QYHE+K+R+K+ +K
Sbjct  453  ILTAKTHWRDYYTKVKDLPAYVAVASNTSGSTPKDLYEDVAEELEKQYHEEKSRIKDAVK  512

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT    W+FEDFK+A+ + IGT  IS+ NL+L+F++L+ER K+KEEKEAKKR+R A 
Sbjct  513  LAKITLLSTWTFEDFKSALSKDIGTFPISDFNLKLVFDELLERVKEKEEKEAKKRKRFAD  572

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +S WE+C  L+EDS E+++IG+E+  RE+FEEY+ +L+
Sbjct  573  DFFHLLYSIKDITVSSKWEDCIPLLEDSQEFRSIGDESLCREVFEEYIAQLK  624



>ref|XP_006393692.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
 gb|ESQ30978.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
Length=957

 Score =   238 bits (608),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  561  DDERCSCLEKIDRLIGFEDYILDLEKEEEEMKRVEKEHVRRAERKNRDAFRTLLEEHVAA  620

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK+ +
Sbjct  621  GILTAKTYWSEYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKDAM  680

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E + T  ISE+NL+LI+ DL+ER K+KEEKE +K QRLA
Sbjct  681  KSRKISMVSSWMFEDFKSAISEDLSTQPISEINLKLIYNDLVERMKEKEEKETRKLQRLA  740

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    +I+AAS+WE+ K+LVE+S EY++IG+++  R +FEEY+T L 
Sbjct  741  EEFTNLLRTFKDISAASNWEDVKQLVEESQEYRSIGDDSVSRGLFEEYITSLH  793



>ref|XP_006393693.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
 gb|ESQ30979.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
Length=958

 Score =   238 bits (608),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  562  DDERCSCLEKIDRLIGFEDYILDLEKEEEEMKRVEKEHVRRAERKNRDAFRTLLEEHVAA  621

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK+ +
Sbjct  622  GILTAKTYWSEYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKDAM  681

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E + T  ISE+NL+LI+ DL+ER K+KEEKE +K QRLA
Sbjct  682  KSRKISMVSSWMFEDFKSAISEDLSTQPISEINLKLIYNDLVERMKEKEEKETRKLQRLA  741

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    +I+AAS+WE+ K+LVE+S EY++IG+++  R +FEEY+T L 
Sbjct  742  EEFTNLLRTFKDISAASNWEDVKQLVEESQEYRSIGDDSVSRGLFEEYITSLH  794



>ref|XP_008808873.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X5 [Phoenix 
dactylifera]
Length=685

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRR ERKNRD FR +ME+H+AA
Sbjct  284  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRLERKNRDEFRKLMEEHVAA  343

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y AV+SNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  344  GILTAKTHWRDYCMQVKDLPPYIAVSSNTSGSTPKDLFEDVAEELDKQYHEDKAQIKEAI  403

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FEDFKAA         ISE N++L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  404  KIRKIALASSWTFEDFKAATSGDDSLQGISETNMKLVFDELLERLREKEEKEAKKRQRLA  463

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA++ WE+CK L ED+ EY++IG+E  ++EIFEE+V  LQ
Sbjct  464  DNFSDLLYSIKEITASARWEDCKSLFEDTQEYRSIGDENFVKEIFEEHVAHLQ  516



>ref|XP_006606005.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Glycine 
max]
 ref|XP_006606006.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Glycine 
max]
Length=1008

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE++R+ ERKNR+ FR +M +HIA+G
Sbjct  640  DERCSRLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEEVRKTERKNREEFRKLMGEHIASG  699

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV EELE QYHE+K+R+K+ +K
Sbjct  700  ILTAKTHWRDYYTKVKDLHAYVAVASNTSGSTPKDLFEDVAEELEKQYHEEKSRIKDAVK  759

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S   +FEDFK+ +L+ I TP IS+ NL+L+F++L+ER K+KEEKEAKKR+RLA 
Sbjct  760  LTKITLSSTLTFEDFKSVLLKDISTPPISDFNLKLVFDELLERVKEKEEKEAKKRKRLAD  819

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  + T +S WE+C+ LVEDS E+++IG+E+  +E+FEEY+ +L+
Sbjct  820  DFFHLLHSTKDFTVSSKWEDCRPLVEDSQEFRSIGDESLCKEVFEEYIAQLK  871



>ref|XP_011002339.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Populus 
euphratica]
Length=1034

 Score =   239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI RLE+FQ+Y+ DL KEEEEQRK QKE+ R+AERKNRD FR ++E+H+A+G
Sbjct  644  DERCSRLEKIYRLEIFQDYLHDLVKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEHVASG  703

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKTR+K+V+K
Sbjct  704  TLTAKTNWRDYHLKVKDLPAYVAVASNASGSTPKDLFEDVSEELQKQYHEDKTRIKDVVK  763

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+T +  W+ +D K AI+E + +P IS+VNL+++F++L+ERA++KEEKEAKKR+RLA 
Sbjct  764  LKKVTLASNWTLQDMKVAIIEDVNSPPISDVNLKMVFDELLERAREKEEKEAKKRKRLAD  823

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE  KE+ E S EY +IGEE   RE+FEEY+++L+
Sbjct  824  DFLNLLQSIKDITASSKWESFKEIFEGSQEYSSIGEEAFCREMFEEYISQLK  875



>ref|XP_011002329.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Populus 
euphratica]
Length=1035

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI RLE+FQ+Y+ DL KEEEEQRK QKE+ R+AERKNRD FR ++E+H+A+G
Sbjct  644  DERCSRLEKIYRLEIFQDYLHDLVKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEHVASG  703

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKTR+K+V+K
Sbjct  704  TLTAKTNWRDYHLKVKDLPAYVAVASNASGSTPKDLFEDVSEELQKQYHEDKTRIKDVVK  763

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+T +  W+ +D K AI+E + +P IS+VNL+++F++L+ERA++KEEKEAKKR+RLA 
Sbjct  764  LKKVTLASNWTLQDMKVAIIEDVNSPPISDVNLKMVFDELLERAREKEEKEAKKRKRLAD  823

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE  KE+ E S EY +IGEE   RE+FEEY+++L+
Sbjct  824  DFLNLLQSIKDITASSKWESFKEIFEGSQEYSSIGEEAFCREMFEEYISQLK  875



>ref|XP_011002323.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Populus 
euphratica]
Length=1035

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI RLE+FQ+Y+ DL KEEEEQRK QKE+ R+AERKNRD FR ++E+H+A+G
Sbjct  644  DERCSRLEKIYRLEIFQDYLHDLVKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEHVASG  703

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKTR+K+V+K
Sbjct  704  TLTAKTNWRDYHLKVKDLPAYVAVASNASGSTPKDLFEDVSEELQKQYHEDKTRIKDVVK  763

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+T +  W+ +D K AI+E + +P IS+VNL+++F++L+ERA++KEEKEAKKR+RLA 
Sbjct  764  LKKVTLASNWTLQDMKVAIIEDVNSPPISDVNLKMVFDELLERAREKEEKEAKKRKRLAD  823

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE  KE+ E S EY +IGEE   RE+FEEY+++L+
Sbjct  824  DFLNLLQSIKDITASSKWESFKEIFEGSQEYSSIGEEAFCREMFEEYISQLK  875



>ref|XP_011002294.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
 ref|XP_011002303.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
 ref|XP_011002313.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
Length=1053

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI RLE+FQ+Y+ DL KEEEEQRK QKE+ R+AERKNRD FR ++E+H+A+G
Sbjct  644  DERCSRLEKIYRLEIFQDYLHDLVKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEHVASG  703

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKTR+K+V+K
Sbjct  704  TLTAKTNWRDYHLKVKDLPAYVAVASNASGSTPKDLFEDVSEELQKQYHEDKTRIKDVVK  763

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+T +  W+ +D K AI+E + +P IS+VNL+++F++L+ERA++KEEKEAKKR+RLA 
Sbjct  764  LKKVTLASNWTLQDMKVAIIEDVNSPPISDVNLKMVFDELLERAREKEEKEAKKRKRLAD  823

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE  KE+ E S EY +IGEE   RE+FEEY+++L+
Sbjct  824  DFLNLLQSIKDITASSKWESFKEIFEGSQEYSSIGEEAFCREMFEEYISQLK  875



>ref|XP_010520792.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A 
[Tarenaya hassleriana]
Length=957

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL KIDRL  ++EY+ DLEKEEEE ++ +KEQ+RRAERKNRDAFR +M+DH+AA
Sbjct  574  DDERCLRLEKIDRLIGYEEYVFDLEKEEEEHKRVEKEQIRRAERKNRDAFRTLMQDHVAA  633

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   YQAVASNTSGSTPKDLFEDV+EELE QYH+DK+ +K+ +
Sbjct  634  GILTAKTYWRDYCMKVKDLPQYQAVASNTSGSTPKDLFEDVIEELEKQYHDDKSCIKDAM  693

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W+FEDFK+A+ E +G+  +S++NL+L+++DL ERAK+KEEKEA+KRQRL+
Sbjct  694  KSRKISIGCSWTFEDFKSALSEDLGSQPVSDINLKLVYDDLFERAKEKEEKEARKRQRLS  753

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +DF ++L    EI+A S+WE+   L E+S EY +IG+E T + IFEEY+  LQ
Sbjct  754  EDFTKLLHTIKEISATSNWEDSISLFEESQEYISIGDENTCKGIFEEYIAALQ  806



>ref|XP_009418171.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1037

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRRAERKNRD FR +ME+H+A 
Sbjct  646  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRAERKNRDEFRKLMEEHVAE  705

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y AVASN SGSTPKDLFEDV EEL+ QYHEDKT++K+ +
Sbjct  706  GILTAKTHWRDYCIQVKDLPPYLAVASNASGSTPKDLFEDVAEELQKQYHEDKTQIKDAM  765

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI+ +  W+FEDFKA++        ISE+NL+L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  766  KIGKISLASSWTFEDFKASVAGIDSLKGISEINLKLVFDELLERLREKEEKEAKKRQRLA  825

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA+S WEECK L EDS EY++I ++T  +EIFE YV  LQ
Sbjct  826  DNFSDLLYSIKEITASSKWEECKLLFEDSQEYRSIDDDTFGKEIFEGYVAHLQ  878



>ref|XP_009418172.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1013

 Score =   238 bits (606),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRRAERKNRD FR +ME+H+A 
Sbjct  618  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRAERKNRDEFRKLMEEHVAE  677

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y AVASN SGSTPKDLFEDV EEL+ QYHEDKT++K+ +
Sbjct  678  GILTAKTHWRDYCIQVKDLPPYLAVASNASGSTPKDLFEDVAEELQKQYHEDKTQIKDAM  737

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI+ +  W+FEDFKA++        ISE+NL+L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  738  KIGKISLASSWTFEDFKASVAGIDSLKGISEINLKLVFDELLERLREKEEKEAKKRQRLA  797

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA+S WEECK L EDS EY++I ++T  +EIFE YV  LQ
Sbjct  798  DNFSDLLYSIKEITASSKWEECKLLFEDSQEYRSIDDDTFGKEIFEGYVAHLQ  850



>ref|XP_007143137.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 ref|XP_007143138.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15131.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15132.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
Length=1019

 Score =   238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCS L KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE+LR+ ERKNRD FR +MEDHIA+G
Sbjct  640  DERCSCLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEELRKTERKNRDEFRKLMEDHIASG  699

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDL+EDV EELE QYHE+K+R+K+ +K
Sbjct  700  ILTAKTHWRDYYTKVKDLPAYVAVASNTSGSTPKDLYEDVAEELEKQYHEEKSRIKDAVK  759

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT    W+FEDFK+A+ + IGT  IS+ NL+L+F++L+ER K+KEEKEAKKR+R A 
Sbjct  760  LAKITLLSTWTFEDFKSALSKDIGTFPISDFNLKLVFDELLERVKEKEEKEAKKRKRFAD  819

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +S WE+C  L+EDS E+++IG+E+  RE+FEEY+ +L+
Sbjct  820  DFFHLLYSIKDITVSSKWEDCIPLLEDSQEFRSIGDESLCREVFEEYIAQLK  871



>ref|XP_007143140.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15134.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
Length=1020

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCS L KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE+LR+ ERKNRD FR +MEDHIA+G
Sbjct  640  DERCSCLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEELRKTERKNRDEFRKLMEDHIASG  699

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDL+EDV EELE QYHE+K+R+K+ +K
Sbjct  700  ILTAKTHWRDYYTKVKDLPAYVAVASNTSGSTPKDLYEDVAEELEKQYHEEKSRIKDAVK  759

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT    W+FEDFK+A+ + IGT  IS+ NL+L+F++L+ER K+KEEKEAKKR+R A 
Sbjct  760  LAKITLLSTWTFEDFKSALSKDIGTFPISDFNLKLVFDELLERVKEKEEKEAKKRKRFAD  819

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +S WE+C  L+EDS E+++IG+E+  RE+FEEY+ +L+
Sbjct  820  DFFHLLYSIKDITVSSKWEDCIPLLEDSQEFRSIGDESLCREVFEEYIAQLK  871



>ref|XP_010530462.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Tarenaya 
hassleriana]
Length=969

 Score =   237 bits (604),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  ++EYI DLEKEEEE ++ +KEQ+RRAERKNRDAFR++ME+H+A+
Sbjct  571  DDERCSCLEKIDRLIGYEEYILDLEKEEEEHKRVEKEQIRRAERKNRDAFRSIMEEHVAS  630

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G  TAKT WRDYC  VK+   YQAVASNTSGSTPKDLFEDV+EELE QYH+DK R K+ +
Sbjct  631  GDFTAKTYWRDYCMKVKDLPQYQAVASNTSGSTPKDLFEDVIEELEKQYHDDKNRTKDAM  690

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS+KI+     +FEDFK+++LE + +  IS++NL+L+++DL+ERAK+KEEKEA+KRQ LA
Sbjct  691  KSKKISMVSSRTFEDFKSSVLEDLSSQPISDINLKLVYDDLLERAKEKEEKEARKRQNLA  750

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +DF ++L+   EITA S+WE+ K L E+S EY+ IG+E   R IFEEY+  LQ
Sbjct  751  EDFTKLLNTFKEITATSTWEDSKSLFEESEEYRLIGDENACRGIFEEYILTLQ  803



>gb|KHN01575.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1018

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE++R+ ERKNR+ FR +M +HIA+G
Sbjct  640  DERCSRLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEEVRKTERKNREEFRKLMGEHIASG  699

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV EELE QYHE+K+R+K+ +K
Sbjct  700  ILTAKTHWRDYYTKVKDLHAYVAVASNTSGSTPKDLFEDVAEELEKQYHEEKSRIKDAVK  759

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S   +FEDFK+ +L+ I TP IS+ NL+++F++L+ER K+KEEKEAKKR+RLA 
Sbjct  760  LTKITLSSTLTFEDFKSVLLKDISTPPISDFNLKVVFDELLERVKEKEEKEAKKRKRLAD  819

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  + T +S WE+C+ LVEDS E+++IG+E+  +E+FEEY+ +L+
Sbjct  820  DFFHLLHSTKDFTVSSKWEDCRPLVEDSQEFRSIGDESLCKEVFEEYIAQLK  871



>ref|XP_010530434.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530440.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530448.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530454.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
Length=975

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  ++EYI DLEKEEEE ++ +KEQ+RRAERKNRDAFR++ME+H+A+
Sbjct  571  DDERCSCLEKIDRLIGYEEYILDLEKEEEEHKRVEKEQIRRAERKNRDAFRSIMEEHVAS  630

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G  TAKT WRDYC  VK+   YQAVASNTSGSTPKDLFEDV+EELE QYH+DK R K+ +
Sbjct  631  GDFTAKTYWRDYCMKVKDLPQYQAVASNTSGSTPKDLFEDVIEELEKQYHDDKNRTKDAM  690

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS+KI+     +FEDFK+++LE + +  IS++NL+L+++DL+ERAK+KEEKEA+KRQ LA
Sbjct  691  KSKKISMVSSRTFEDFKSSVLEDLSSQPISDINLKLVYDDLLERAKEKEEKEARKRQNLA  750

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +DF ++L+   EITA S+WE+ K L E+S EY+ IG+E   R IFEEY+  LQ
Sbjct  751  EDFTKLLNTFKEITATSTWEDSKSLFEESEEYRLIGDENACRGIFEEYILTLQ  803



>ref|XP_002313923.2| hypothetical protein POPTR_0009s08880g [Populus trichocarpa]
 gb|EEE87878.2| hypothetical protein POPTR_0009s08880g [Populus trichocarpa]
Length=888

 Score =   236 bits (601),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+ DL KEEEEQRK QKE+ R+AERKNRD FR ++E+H+A+G
Sbjct  498  DERCSRLEKIDRLEIFQDYLHDLVKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEHVASG  557

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   VK+  AY AVASN SGSTPKDLFEDV EEL+ QYHEDKT +K+V+K
Sbjct  558  TLTAKTNWRDYHLKVKDLHAYVAVASNASGSTPKDLFEDVSEELQKQYHEDKTWIKDVVK  617

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+  +  W+ +D K AI+E + +P IS+VNL+++F++L+ERA++KEEKEAKKR+RLA 
Sbjct  618  LKKVPLASNWTLQDMKVAIIEDVNSPPISDVNLKMVFDELLERAREKEEKEAKKRKRLAD  677

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE  KE+ E S EY +IGEE   RE+FEEY+++L+
Sbjct  678  DFLNLLQSIKDITASSKWESFKEIFEGSQEYSSIGEEAFCREMFEEYISQLK  729



>gb|KCW63559.1| hypothetical protein EUGRSUZ_G01189 [Eucalyptus grandis]
Length=989

 Score =   236 bits (601),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 189/233 (81%), Gaps = 2/233 (1%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQ+Y+ DLEKEEEEQRK QKE++R+AERKNRD FR +ME+H+AAG
Sbjct  642  DERCSRLEKMDRLEIFQDYLHDLEKEEEEQRKIQKEEMRKAERKNRDEFRKLMEEHVAAG  701

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKTLWRDY  MVK+  AY AVASNT+GSTPKDLFEDV EEL+ QY EDK++V + +K
Sbjct  702  TLTAKTLWRDYYMMVKDLPAYMAVASNTAGSTPKDLFEDVAEELQKQYEEDKSQVDDAVK  761

Query  381  SEKITFSPLWSFEDFKAAILETI-GTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              KI+ +  W+ E  KA+I + I GTP IS++N +L+F+DL+ERA+ KEE+  KKR+RL 
Sbjct  762  IRKISLTSTWTVEGLKASIADDIRGTP-ISDINFKLVFDDLLERARKKEERVVKKRKRLG  820

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              F ++L+   EIT +S+W+ECK+LVE+S EY +IG++   ++IFEEY+T+L+
Sbjct  821  DKFFDLLTTIREITPSSTWDECKQLVENSHEYSSIGDDIYCQDIFEEYITKLK  873



>ref|XP_010065860.1| PREDICTED: pre-mRNA-processing protein 40A-like [Eucalyptus grandis]
 gb|KCW63558.1| hypothetical protein EUGRSUZ_G01189 [Eucalyptus grandis]
Length=1026

 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 189/233 (81%), Gaps = 2/233 (1%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQ+Y+ DLEKEEEEQRK QKE++R+AERKNRD FR +ME+H+AAG
Sbjct  642  DERCSRLEKMDRLEIFQDYLHDLEKEEEEQRKIQKEEMRKAERKNRDEFRKLMEEHVAAG  701

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKTLWRDY  MVK+  AY AVASNT+GSTPKDLFEDV EEL+ QY EDK++V + +K
Sbjct  702  TLTAKTLWRDYYMMVKDLPAYMAVASNTAGSTPKDLFEDVAEELQKQYEEDKSQVDDAVK  761

Query  381  SEKITFSPLWSFEDFKAAILETI-GTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              KI+ +  W+ E  KA+I + I GTP IS++N +L+F+DL+ERA+ KEE+  KKR+RL 
Sbjct  762  IRKISLTSTWTVEGLKASIADDIRGTP-ISDINFKLVFDDLLERARKKEERVVKKRKRLG  820

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              F ++L+   EIT +S+W+ECK+LVE+S EY +IG++   ++IFEEY+T+L+
Sbjct  821  DKFFDLLTTIREITPSSTWDECKQLVENSHEYSSIGDDIYCQDIFEEYITKLK  873



>dbj|BAH19565.1| AT1G44910 [Arabidopsis thaliana]
Length=826

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+RCS L KIDRL  F+EYI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  571  DDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  630

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  +K+   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+ VK+ +
Sbjct  631  GILTAKTYWLDYCIELKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSYVKDAM  690

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E + T  IS++NL+LI++DL+ R K+KEEKEA+K QRLA
Sbjct  691  KSRKISMVSSWLFEDFKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLA  750

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EIT AS+WE+ K+LVE+S EY++IG+E+  + +FEEY+T LQ
Sbjct  751  EEFTNLLHTFKEITVASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ  803



>gb|EPS72133.1| hypothetical protein M569_02623, partial [Genlisea aurea]
Length=204

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  621  AERKNRDAFRNMMEDHIAAGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDV  442
            AERKNRDAFR MMEDHI+ GT TAKTLWRDYC  VK S AY+ VASN  GSTPKDLFE+V
Sbjct  6    AERKNRDAFRRMMEDHISDGTFTAKTLWRDYCQHVKNSEAYEGVASNIYGSTPKDLFEEV  65

Query  441  VEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDL  262
             EELE +Y EDK  +K+ LK EKIT +   +FE FK+ I++++   SIS+ N++L++EDL
Sbjct  66   AEELEKKYDEDKAFIKDFLKQEKITIASSLTFEVFKSDIMDSVSFASISDTNMKLVYEDL  125

Query  261  MerakdkeekeakkrqrlaKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTL  82
            ++RAK+KEEKEAKK +RLAKDF +MLS+  EI A S+WE+CKELVEDSSEY+A+GEE+  
Sbjct  126  IDRAKEKEEKEAKKLKRLAKDFTDMLSSIKEIDALSTWEDCKELVEDSSEYRAMGEESHC  185

Query  81   REIFEEYVTRLQ  46
            +EIFEEY++ +Q
Sbjct  186  KEIFEEYISWVQ  197



>ref|NP_001043246.2| Os01g0532200 [Oryza sativa Japonica Group]
 dbj|BAD87484.1| formin binding protein 3-like [Oryza sativa Japonica Group]
 dbj|BAF05160.2| Os01g0532200 [Oryza sativa Japonica Group]
Length=446

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLEKEEEE ++  KEQ+RR ERKNRD FR M+E+H+A 
Sbjct  47   DDERCSRLEKIDRLEIFQEYIRDLEKEEEEHKRIHKEQVRRQERKNRDEFRKMLEEHVAE  106

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+S  Y AVASN SGS PKDLFEDV+EELE QY +DK R+K  +
Sbjct  107  GMLTAKTRWRDYCAQVKDSSVYLAVASNISGSMPKDLFEDVMEELEKQYQDDKARIKEAV  166

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ EDF+ A+ E      I+ +N++LIF+D +ER ++KE KEAKKRQRL 
Sbjct  167  KSGKIPMTTSWTLEDFETAVTEDDTLKGITNINMKLIFDDQVERLREKEVKEAKKRQRLG  226

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K L EDS EYKA+  ET  RE+FEE V
Sbjct  227  ENFSDLLYSIKEISASSTWDDSKALFEDSQEYKALDSETYSRELFEECV  275



>ref|XP_002891304.1| hypothetical protein ARALYDRAFT_891421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67563.1| hypothetical protein ARALYDRAFT_891421 [Arabidopsis lyrata subsp. 
lyrata]
Length=967

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 187/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F+EY+ DLEKEEEEQ++ +KE +RRAERKNRDA R ++E+H+AA
Sbjct  572  DDERCSCLEKIDRLIGFEEYMLDLEKEEEEQKRVEKEHVRRAERKNRDALRTLLEEHVAA  631

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  +K+   YQAVASNTSGSTPKDLFED+ EELE QYHEDK+ VK+ +
Sbjct  632  GILTAKTYWLDYCIELKDLPQYQAVASNTSGSTPKDLFEDITEELEKQYHEDKSYVKDAM  691

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E + +  IS++NL+LI++DL+ RAK+KEEKEA+K QRLA
Sbjct  692  KSRKISMVSSWLFEDFKSAISEDLSSQPISDINLKLIYDDLVGRAKEKEEKEARKLQRLA  751

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EITAAS+WE+ K+L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  752  EEFTNLLHTFKEITAASNWEDSKQLLEESQEYRSIGDESVSRGLFEEYITSLQ  804



>ref|NP_001117438.1| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
 gb|AEE32063.1| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
Length=926

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+RCS L KIDRL  F+EYI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  571  DDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  630

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  +K+   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+ VK+ +
Sbjct  631  GILTAKTYWLDYCIELKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSYVKDAM  690

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E + T  IS++NL+LI++DL+ R K+KEEKEA+K QRLA
Sbjct  691  KSRKISMVSSWLFEDFKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLA  750

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EIT AS+WE+ K+LVE+S EY++IG+E+  + +FEEY+T LQ
Sbjct  751  EEFTNLLHTFKEITVASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ  803



>ref|NP_175113.2| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
 sp|B6EUA9.1|PR40A_ARATH RecName: Full=Pre-mRNA-processing protein 40A; AltName: Full=Mediator 
of RNA polymerase II transcription subunit 35a [Arabidopsis 
thaliana]
 gb|AEE32062.1| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
Length=958

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 185/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+RCS L KIDRL  F+EYI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  571  DDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  630

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  +K+   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+ VK+ +
Sbjct  631  GILTAKTYWLDYCIELKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSYVKDAM  690

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E + T  IS++NL+LI++DL+ R K+KEEKEA+K QRLA
Sbjct  691  KSRKISMVSSWLFEDFKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLA  750

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EIT AS+WE+ K+LVE+S EY++IG+E+  + +FEEY+T LQ
Sbjct  751  EEFTNLLHTFKEITVASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ  803



>emb|CDY47957.1| BnaA10g28290D [Brassica napus]
Length=647

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  223  DDERCSCLEKIDRLIGFEDYINDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  282

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  V++   YQAVASN SGSTPKDLFED+ EEL+ QYHEDK+RVK+ +
Sbjct  283  GILTAKTYWLEYCIEVRDLPQYQAVASNLSGSTPKDLFEDITEELDKQYHEDKSRVKDAM  342

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K++    W FEDFK+A+ E + +  IS++NL+LI+ DL+ER K+KEEKEA+K QRLA
Sbjct  343  KSRKVSMVSSWMFEDFKSALSEDLSSQPISDINLKLIYNDLVERMKEKEEKEARKFQRLA  402

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EI AAS+WE+ K+LVE+S EY++IG++   R +FEEY+T LQ
Sbjct  403  EEFTNLLRTFKEINAASNWEDVKQLVEESQEYRSIGDDNVSRGLFEEYITSLQ  455



>ref|XP_008808871.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Phoenix 
dactylifera]
Length=1021

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRR ERKNRD FR +ME+H+AA
Sbjct  620  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRLERKNRDEFRKLMEEHVAA  679

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y AV+SNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  680  GILTAKTHWRDYCMQVKDLPPYIAVSSNTSGSTPKDLFEDVAEELDKQYHEDKAQIKEAI  739

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FEDFKAA         ISE N++L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  740  KIRKIALASSWTFEDFKAATSGDDSLQGISETNMKLVFDELLERLREKEEKEAKKRQRLA  799

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA++ WE+CK L ED+ EY++IG+E  ++EIFEE+V  LQ
Sbjct  800  DNFSDLLYSIKEITASARWEDCKSLFEDTQEYRSIGDENFVKEIFEEHVAHLQ  852



>ref|XP_008808868.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008808869.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008808870.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Phoenix 
dactylifera]
Length=1051

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRR ERKNRD FR +ME+H+AA
Sbjct  650  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRLERKNRDEFRKLMEEHVAA  709

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y AV+SNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  710  GILTAKTHWRDYCMQVKDLPPYIAVSSNTSGSTPKDLFEDVAEELDKQYHEDKAQIKEAI  769

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FEDFKAA         ISE N++L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  770  KIRKIALASSWTFEDFKAATSGDDSLQGISETNMKLVFDELLERLREKEEKEAKKRQRLA  829

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA++ WE+CK L ED+ EY++IG+E  ++EIFEE+V  LQ
Sbjct  830  DNFSDLLYSIKEITASARWEDCKSLFEDTQEYRSIGDENFVKEIFEEHVAHLQ  882



>ref|XP_008365587.1| PREDICTED: pre-mRNA-processing protein 40A-like [Malus domestica]
Length=1019

 Score =   234 bits (596),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 186/233 (80%), Gaps = 3/233 (1%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+ RL +FQ+YIRDLEK EEEQ+K QKEQLRR ERKNRD FR ++E+H+A 
Sbjct  632  DDERCLRLEKLARLLIFQDYIRDLEKVEEEQKKLQKEQLRREERKNRDEFRKLLEEHVAD  691

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKTLWRDYC  VK+   Y+AVA NTSGSTPK+LF+DV EELE QYH+DK R+K+ +
Sbjct  692  GTLTAKTLWRDYCTKVKDLPPYEAVALNTSGSTPKELFDDVFEELEKQYHDDKARIKDAV  751

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K+T +   +FE+FK  ILE IG+P IS++N +L++E+L+ERAK+KEEKEAKKRQRL 
Sbjct  752  KSGKVTMTSTLAFEEFKVPILEDIGSPPISDINFKLVYEELLERAKEKEEKEAKKRQRLV  811

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EI+AAS+WE+ K L E++ EY++IG+    RE+FEEY+T LQ
Sbjct  812  DDFNNLLHTIKEISAASNWEDSKHLFEETQEYRSIGDG---REVFEEYITNLQ  861



>ref|XP_008808872.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Phoenix 
dactylifera]
Length=942

 Score =   233 bits (595),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI DLEKEEEEQRK QKEQLRR ERKNRD FR +ME+H+AA
Sbjct  650  DDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRLERKNRDEFRKLMEEHVAA  709

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y AV+SNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  710  GILTAKTHWRDYCMQVKDLPPYIAVSSNTSGSTPKDLFEDVAEELDKQYHEDKAQIKEAI  769

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FEDFKAA         ISE N++L+F++L+ER ++KEEKEAKKRQRLA
Sbjct  770  KIRKIALASSWTFEDFKAATSGDDSLQGISETNMKLVFDELLERLREKEEKEAKKRQRLA  829

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F ++L +  EITA++ WE+CK L ED+ EY++IG+E  ++EIFEE+V  LQ
Sbjct  830  DNFSDLLYSIKEITASARWEDCKSLFEDTQEYRSIGDENFVKEIFEEHVAHLQ  882



>ref|XP_009350341.1| PREDICTED: pre-mRNA-processing protein 40A-like [Pyrus x bretschneideri]
Length=1014

 Score =   233 bits (595),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 183/233 (79%), Gaps = 3/233 (1%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K+ RL +FQ+YIRDLEK EEEQ+K QKEQLRR ERKNRD FR ++E+H+A 
Sbjct  631  DDERCLRLEKLVRLLIFQDYIRDLEKVEEEQKKLQKEQLRREERKNRDEFRKLLEEHVAD  690

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKTLWRDYC  VK+   Y+AVA N SGSTPK+LF+DV EELE QYH+DK R+K+ +
Sbjct  691  GTLTAKTLWRDYCTKVKDLPPYEAVALNASGSTPKELFDDVFEELEKQYHDDKARIKDAM  750

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K+T +   +FE+FK  ILE IG+P IS++N +L++E+L+ERAK+KEEKE KKRQR  
Sbjct  751  KSGKVTMTSTLAFEEFKVPILEDIGSPPISDINFKLVYEELLERAKEKEEKETKKRQRHV  810

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    EITAAS+WE+ K L E++ EY++IG+    RE+FEEY+T LQ
Sbjct  811  DDFNNLLHTIKEITAASNWEDSKHLFEETQEYRSIGDG---REVFEEYITSLQ  860



>ref|XP_004150264.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cucumis sativus]
Length=796

 Score =   232 bits (591),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQRK QKE+LR+AERKNRD FR MME+HIAAG
Sbjct  411  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRKIQKEELRKAERKNRDEFRKMMEEHIAAG  470

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +T K  WRDYC  VKE  AY AVA+NTSGSTPKDLFEDV EEL+ QY +DKTR+K+ +K
Sbjct  471  LLTPKIHWRDYCMKVKELPAYLAVAANTSGSTPKDLFEDVAEELQKQYRDDKTRIKDAVK  530

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S  W+ +DFKAAI + IG P + + NL+L+F++L+ERA++KEE+EAKKR+RL  
Sbjct  531  LRKVAISLSWTLDDFKAAISKDIGNPPVPDTNLKLVFDELLERAREKEEREAKKRKRLGD  590

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  EI+  S+WE+ K   E S EY AI +E   +EIFEEY+ +L+
Sbjct  591  DFFNLLCSFKEISVYSNWEDSKSSFEGSQEYSAIEDEKLCKEIFEEYIAQLK  642



>gb|KGN52740.1| hypothetical protein Csa_4G000610 [Cucumis sativus]
Length=1004

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQRK QKE+LR+AERKNRD FR MME+HIAAG
Sbjct  619  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRKIQKEELRKAERKNRDEFRKMMEEHIAAG  678

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +T K  WRDYC  VKE  AY AVA+NTSGSTPKDLFEDV EEL+ QY +DKTR+K+ +K
Sbjct  679  LLTPKIHWRDYCMKVKELPAYLAVAANTSGSTPKDLFEDVAEELQKQYRDDKTRIKDAVK  738

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S  W+ +DFKAAI + IG P + + NL+L+F++L+ERA++KEE+EAKKR+RL  
Sbjct  739  LRKVAISLSWTLDDFKAAISKDIGNPPVPDTNLKLVFDELLERAREKEEREAKKRKRLGD  798

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  EI+  S+WE+ K   E S EY AI +E   +EIFEEY+ +L+
Sbjct  799  DFFNLLCSFKEISVYSNWEDSKSSFEGSQEYSAIEDEKLCKEIFEEYIAQLK  850



>emb|CDY12575.1| BnaC06g01010D [Brassica napus]
Length=610

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 183/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  223  DDERCSCLEKIDRLIGFEDYINDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  282

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  V++   YQAVASN SGSTPKDLFE++ EELE QYHEDK+RVK+ +
Sbjct  283  GILTAKTYWLEYCIEVRDLPQYQAVASNLSGSTPKDLFEEITEELEKQYHEDKSRVKDAM  342

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K++    W FEDFK+A+ E + +  IS++NL+LI+ +L+ER K+KEEKEA+K QRLA
Sbjct  343  KSRKVSMVSSWVFEDFKSALSEDLSSQPISDINLKLIYNELVERMKEKEEKEARKLQRLA  402

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EI AAS+WE+ K+LVE+S EY++IG+    R +FEEY+T LQ
Sbjct  403  EEFTNLLRTFKEINAASNWEDVKQLVEESQEYRSIGDGNVSRGLFEEYITSLQ  455



>ref|XP_008454417.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A 
[Cucumis melo]
Length=1004

 Score =   231 bits (589),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 180/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQRK QKE+LR+AERKNRD FR MME+HIAAG
Sbjct  619  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRKIQKEELRKAERKNRDEFRKMMEEHIAAG  678

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +T K  WRDYC  VKE  AY AVA+NTSGSTPKDLFEDV EEL+ QY +DKTR+K+ +K
Sbjct  679  LLTPKIHWRDYCMKVKELPAYLAVAANTSGSTPKDLFEDVAEELQKQYRDDKTRIKDAVK  738

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S  W+ +DFK AI + IG P + + NL+L+F++L+ERA++KEEKEAKKR+RL  
Sbjct  739  LRKVAISLSWTLDDFKTAISKDIGNPPVPDTNLKLVFDELLERAREKEEKEAKKRKRLGD  798

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  EI+  S+WE+ K   E S EY AI +E   +EIFEEY+ +L+
Sbjct  799  DFFNLLCSFKEISVYSNWEDSKPFFEGSPEYSAIEDERLCKEIFEEYIVQLK  850



>ref|XP_008805735.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Phoenix 
dactylifera]
Length=1023

 Score =   231 bits (589),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI +LEKEEEEQRK QKEQLRR ERKNRD FR +ME H+AA
Sbjct  619  DDERCSRLEKIDRLEIFQEYIHNLEKEEEEQRKKQKEQLRRQERKNRDEFRKLMEGHVAA  678

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y+AVASNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  679  GILTAKTHWRDYCMQVKDLPPYKAVASNTSGSTPKDLFEDVAEELDKQYHEDKVQIKEAI  738

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K +KI  +  W FED K AI        ISE+N++L+F++L+ER ++KEEKEAKK QRLA
Sbjct  739  KIQKIALASSWMFEDLKVAISADDSLKGISEINMKLVFDELLERLREKEEKEAKKHQRLA  798

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
             +F ++L +  EITA+S WE+CK L ED+ EY++IG+E  +R IFEE+V
Sbjct  799  DNFSDLLYSIKEITASSGWEDCKSLFEDTQEYRSIGDENFVRGIFEEHV  847



>ref|XP_008805734.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008805736.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Phoenix 
dactylifera]
Length=1023

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI +LEKEEEEQRK QKEQLRR ERKNRD FR +ME H+AA
Sbjct  619  DDERCSRLEKIDRLEIFQEYIHNLEKEEEEQRKKQKEQLRRQERKNRDEFRKLMEGHVAA  678

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y+AVASNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  679  GILTAKTHWRDYCMQVKDLPPYKAVASNTSGSTPKDLFEDVAEELDKQYHEDKVQIKEAI  738

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K +KI  +  W FED K AI        ISE+N++L+F++L+ER ++KEEKEAKK QRLA
Sbjct  739  KIQKIALASSWMFEDLKVAISADDSLKGISEINMKLVFDELLERLREKEEKEAKKHQRLA  798

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
             +F ++L +  EITA+S WE+CK L ED+ EY++IG+E  +R IFEE+V
Sbjct  799  DNFSDLLYSIKEITASSGWEDCKSLFEDTQEYRSIGDENFVRGIFEEHV  847



>ref|XP_008805733.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Phoenix 
dactylifera]
Length=1026

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI +LEKEEEEQRK QKEQLRR ERKNRD FR +ME H+AA
Sbjct  622  DDERCSRLEKIDRLEIFQEYIHNLEKEEEEQRKKQKEQLRRQERKNRDEFRKLMEGHVAA  681

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y+AVASNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  682  GILTAKTHWRDYCMQVKDLPPYKAVASNTSGSTPKDLFEDVAEELDKQYHEDKVQIKEAI  741

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K +KI  +  W FED K AI        ISE+N++L+F++L+ER ++KEEKEAKK QRLA
Sbjct  742  KIQKIALASSWMFEDLKVAISADDSLKGISEINMKLVFDELLERLREKEEKEAKKHQRLA  801

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
             +F ++L +  EITA+S WE+CK L ED+ EY++IG+E  +R IFEE+V
Sbjct  802  DNFSDLLYSIKEITASSGWEDCKSLFEDTQEYRSIGDENFVRGIFEEHV  850



>ref|XP_006595998.1| PREDICTED: pre-mRNA-processing protein 40A-like [Glycine max]
Length=997

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R  RL KIDRL VFQ+YIRDLEKEEEEQ++ QK+++RR ERKNRDAFR ++ +H++A
Sbjct  607  DDDRYLRLEKIDRLLVFQDYIRDLEKEEEEQKRIQKDRIRRGERKNRDAFRKLLGEHVSA  666

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  V++   YQAVASNTSGSTPKDLFEDV E+LE QYHEDKT +K+ +
Sbjct  667  GILTAKTQWREYCLKVRDLPQYQAVASNTSGSTPKDLFEDVAEDLEKQYHEDKTLIKDTV  726

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KIT      FE+FK A+LE     +ISE+NL+LIFE+L+ERAK+KEEKEAKKRQRLA
Sbjct  727  KSGKITVVTTSVFEEFKVAVLEGAACQTISEINLKLIFEELLERAKEKEEKEAKKRQRLA  786

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    +IT +S WE+CK L E++ EY++IG+E+  REIFEEY+T L+
Sbjct  787  DDFTNLLYTFKDITTSSKWEDCKSLFEETQEYRSIGDESYSREIFEEYITYLK  839



>gb|KHN17176.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1002

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R  RL KIDRL VFQ+YIRDLEKEEEEQ++ QK+++RR ERKNRDAFR ++ +H++A
Sbjct  612  DDDRYLRLEKIDRLLVFQDYIRDLEKEEEEQKRIQKDRIRRGERKNRDAFRKLLGEHVSA  671

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  V++   YQAVASNTSGSTPKDLFEDV E+LE QYHEDKT +K+ +
Sbjct  672  GILTAKTQWREYCLKVRDLPQYQAVASNTSGSTPKDLFEDVAEDLEKQYHEDKTLIKDTV  731

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KIT      FE+FK A+LE     +ISE+NL+LIFE+L+ERAK+KEEKEAKKRQRLA
Sbjct  732  KSGKITVVTTSVFEEFKVAVLEGAACQTISEINLKLIFEELLERAKEKEEKEAKKRQRLA  791

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF  +L    +IT +S WE+CK L E++ EY++IG+E+  REIFEEY+T L+
Sbjct  792  DDFTNLLYTFKDITTSSKWEDCKSLFEETQEYRSIGDESYSREIFEEYITYLK  844



>ref|XP_008805730.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805731.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805732.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
Length=1053

 Score =   231 bits (589),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYI +LEKEEEEQRK QKEQLRR ERKNRD FR +ME H+AA
Sbjct  649  DDERCSRLEKIDRLEIFQEYIHNLEKEEEEQRKKQKEQLRRQERKNRDEFRKLMEGHVAA  708

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+   Y+AVASNTSGSTPKDLFEDV EEL+ QYHEDK ++K  +
Sbjct  709  GILTAKTHWRDYCMQVKDLPPYKAVASNTSGSTPKDLFEDVAEELDKQYHEDKVQIKEAI  768

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K +KI  +  W FED K AI        ISE+N++L+F++L+ER ++KEEKEAKK QRLA
Sbjct  769  KIQKIALASSWMFEDLKVAISADDSLKGISEINMKLVFDELLERLREKEEKEAKKHQRLA  828

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
             +F ++L +  EITA+S WE+CK L ED+ EY++IG+E  +R IFEE+V
Sbjct  829  DNFSDLLYSIKEITASSGWEDCKSLFEDTQEYRSIGDENFVRGIFEEHV  877



>gb|KJB63965.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=919

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  591  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  650

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  651  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  710

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+L++++L+ERAK+KEEKEAKKRQRLA
Sbjct  711  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKLVYDELLERAKEKEEKEAKKRQRLA  770

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYK  106
             DF  +L    EITA+S WEE K L E+S EY+
Sbjct  771  DDFTRLLHTYKEITASSDWEESKPLFEESQEYR  803



>gb|KDP44546.1| hypothetical protein JCGZ_16379 [Jatropha curcas]
Length=727

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL  +DRL  F +YI DL+KEEEEQRK QKE++R+ ERKNRD FR ++E+H+A G
Sbjct  338  DERCSRLETMDRLNYFNDYIHDLQKEEEEQRKIQKEEMRKTERKNRDEFRKLLEEHVADG  397

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+T+KT WRDY   VK+  AY AVASNTSG TPKDLFEDV EEL+ QYHEDKTR+K+ +K
Sbjct  398  TLTSKTHWRDYFLKVKDLPAYLAVASNTSGPTPKDLFEDVAEELQKQYHEDKTRIKDTVK  457

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             +K+  +  W+ EDFK A+LE +  P +SEVNL++IF +L+ERAK+KE+KEAKKR+R+A+
Sbjct  458  LKKVALASTWTLEDFKVAVLEDVSHPPVSEVNLKIIFNELLERAKEKEDKEAKKRKRVAE  517

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF+ +L +  +ITA+S WE CKEL E S E+ +IG+E+  +EIFE+ V +L+
Sbjct  518  DFLNLLYSIKDITASSKWETCKELFEGSREFSSIGDESICKEIFEKCVAQLK  569



>ref|XP_008364430.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Malus 
domestica]
Length=794

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 180/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+ DL+KEEEEQ++ QKE+LR+AERKNRD FR +ME+H+  G
Sbjct  406  DERCSRLEKIDRLEIFQEYLLDLQKEEEEQKRIQKEELRKAERKNRDEFRKLMEEHLTEG  465

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+T KT WRDYC  VK+  AY AVASN SG+TPKDLF+DVVEEL  QY EDKTR+K+ +K
Sbjct  466  TLTFKTQWRDYCMKVKDLPAYLAVASNASGATPKDLFDDVVEELTKQYQEDKTRIKDAVK  525

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  +  W FEDFK  +   IG+P IS+ NL+L+F +L+ER ++KEEKEAKK +RLA+
Sbjct  526  LGKVVLASTWKFEDFKTVLSNDIGSPPISDANLKLVFNELLERVREKEEKEAKKLKRLAE  585

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +LS+  EIT +S WE+ K L+E S EY  IG+E   +EIFE++V +L+
Sbjct  586  DFSHLLSSIKEITPSSKWEDYKPLLEISQEYSGIGDENFCKEIFEKHVMQLK  637



>ref|XP_008364431.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Malus 
domestica]
Length=793

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 180/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+ DL+KEEEEQ++ QKE+LR+AERKNRD FR +ME+H+  G
Sbjct  406  DERCSRLEKIDRLEIFQEYLLDLQKEEEEQKRIQKEELRKAERKNRDEFRKLMEEHLTEG  465

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+T KT WRDYC  VK+  AY AVASN SG+TPKDLF+DVVEEL  QY EDKTR+K+ +K
Sbjct  466  TLTFKTQWRDYCMKVKDLPAYLAVASNASGATPKDLFDDVVEELTKQYQEDKTRIKDAVK  525

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  +  W FEDFK  +   IG+P IS+ NL+L+F +L+ER ++KEEKEAKK +RLA+
Sbjct  526  LGKVVLASTWKFEDFKTVLSNDIGSPPISDANLKLVFNELLERVREKEEKEAKKLKRLAE  585

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +LS+  EIT +S WE+ K L+E S EY  IG+E   +EIFE++V +L+
Sbjct  586  DFSHLLSSIKEITPSSKWEDYKPLLEISQEYSGIGDENFCKEIFEKHVMQLK  637



>ref|XP_006827042.1| hypothetical protein AMTR_s00010p00227470 [Amborella trichopoda]
 gb|ERM94279.1| hypothetical protein AMTR_s00010p00227470 [Amborella trichopoda]
Length=985

 Score =   230 bits (587),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC+RL KIDRLE+FQEYIRDLEKEEEEQRK QKE LRRAERKNRD FR +ME HIAA
Sbjct  595  DDERCARLEKIDRLEIFQEYIRDLEKEEEEQRKLQKEHLRRAERKNRDDFRKLMEGHIAA  654

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  VK+  AY AV+SNTSGSTPKDLFED  EEL+ QY ED+TR+K+ +
Sbjct  655  GILTAKTHWREYCMKVKDLPAYLAVSSNTSGSTPKDLFEDTAEELDKQYQEDRTRIKDAV  714

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  +   +  WSFE+FK AI E     SISE NL+L+F++L+ER K+KEEKEAKKRQR+A
Sbjct  715  KMARFVMTSTWSFENFKEAISEDNNLKSISETNLKLVFDELLERLKEKEEKEAKKRQRMA  774

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             D  ++L +  +I+A+S WEECK L+E++  Y++I +E+  R+IFEEYV  LQ
Sbjct  775  DDLKDLLYSIKDISASSRWEECKPLLEENQAYRSINDESFARQIFEEYVAYLQ  827



>ref|XP_009124535.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Brassica 
rapa]
Length=918

 Score =   230 bits (586),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  525  DDERCSCLEKIDRLIGFEDYINDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  584

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  V++   YQAVASN SGSTPKDLFED+ EEL+ QYHEDK+RVK+ +
Sbjct  585  GILTAKTYWLEYCIEVRDLPQYQAVASNLSGSTPKDLFEDITEELDKQYHEDKSRVKDAM  644

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K++    W FEDFK+A+ E + +  +S++NL+LI+ DL+ER K+KEEKEA+K QRLA
Sbjct  645  KSRKVSMVSSWMFEDFKSALSEDLSSQPVSDINLKLIYNDLVERMKEKEEKEARKFQRLA  704

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EI AAS+WE+ K+LVE+S EY++IG++   R +FEEY+T LQ
Sbjct  705  EEFTNLLRTFKEINAASNWEDVKQLVEESQEYRSIGDDNVSRGLFEEYITSLQ  757



>ref|XP_004156902.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cucumis sativus]
Length=983

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 180/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEY+RDLEKEEEEQRK QKE+LR+ ERKNRD FR MME+HIAAG
Sbjct  598  DERCSRLEKIDRLEIFQEYLRDLEKEEEEQRKIQKEELRKVERKNRDEFRKMMEEHIAAG  657

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +T K  WRDYC  VKE  AY AVA+NTSGSTPKDLFEDV EEL+ QY +DKTR+K+ +K
Sbjct  658  LLTPKIHWRDYCMKVKELPAYLAVAANTSGSTPKDLFEDVAEELQKQYRDDKTRIKDAVK  717

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S  W+ +DFKAAI + IG P + + NL+L+F++L+ERA++KEEKEAKKR+RL  
Sbjct  718  LRKVAISLSWTLDDFKAAISKDIGNPPVPDTNLKLVFDELLERAREKEEKEAKKRKRLGD  777

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  EI+  S+WE+ K   E S EY AI +E   +EIFEEY+ +L+
Sbjct  778  DFFNLLCSFKEISVYSNWEDSKSSFEGSQEYSAIEDEKLCKEIFEEYIAQLK  829



>ref|XP_009124533.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Brassica 
rapa]
Length=924

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  533  DDERCSCLEKIDRLIGFEDYINDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  592

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  V++   YQAVASN SGSTPKDLFED+ EEL+ QYHEDK+RVK+ +
Sbjct  593  GILTAKTYWLEYCIEVRDLPQYQAVASNLSGSTPKDLFEDITEELDKQYHEDKSRVKDAM  652

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K++    W FEDFK+A+ E + +  +S++NL+LI+ DL+ER K+KEEKEA+K QRLA
Sbjct  653  KSRKVSMVSSWMFEDFKSALSEDLSSQPVSDINLKLIYNDLVERMKEKEEKEARKFQRLA  712

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EI AAS+WE+ K+LVE+S EY++IG++   R +FEEY+T LQ
Sbjct  713  EEFTNLLRTFKEINAASNWEDVKQLVEESQEYRSIGDDNVSRGLFEEYITSLQ  765



>ref|XP_009124532.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Brassica 
rapa]
Length=926

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F++YI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  533  DDERCSCLEKIDRLIGFEDYINDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  592

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  V++   YQAVASN SGSTPKDLFED+ EEL+ QYHEDK+RVK+ +
Sbjct  593  GILTAKTYWLEYCIEVRDLPQYQAVASNLSGSTPKDLFEDITEELDKQYHEDKSRVKDAM  652

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K++    W FEDFK+A+ E + +  +S++NL+LI+ DL+ER K+KEEKEA+K QRLA
Sbjct  653  KSRKVSMVSSWMFEDFKSALSEDLSSQPVSDINLKLIYNDLVERMKEKEEKEARKFQRLA  712

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EI AAS+WE+ K+LVE+S EY++IG++   R +FEEY+T LQ
Sbjct  713  EEFTNLLRTFKEINAASNWEDVKQLVEESQEYRSIGDDNVSRGLFEEYITSLQ  765



>ref|XP_011458881.1| PREDICTED: pre-mRNA-processing protein 40A [Fragaria vesca subsp. 
vesca]
Length=994

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 186/234 (79%), Gaps = 1/234 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL K DRL +FQ++IRDLEKEEEEQ+K QKEQLRR ERKNRD FR ++E+H A 
Sbjct  601  DDERCLRLDKFDRLLIFQDHIRDLEKEEEEQKKIQKEQLRRIERKNRDEFRKILEEHAAD  660

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGS-TPKDLFEDVVEELENQYHEDKTRVKNV  388
            GT+TAKT WRDYC  VK+   Y+AVA+NT GS TPKDLFEDV E+LE Q+ EDK RVK+ 
Sbjct  661  GTLTAKTQWRDYCMKVKDLPQYEAVAANTHGSSTPKDLFEDVAEDLEKQFVEDKARVKDA  720

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +K  +IT    W+FE+FKAA++  IG PSISE+NL+L +ED++ERA++KEEKEAKKR R+
Sbjct  721  MKQGQITMVSSWTFEEFKAAVVNDIGFPSISELNLKLAYEDILERAREKEEKEAKKRLRI  780

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A DF ++L    EIT +SSWE+CK+L E++ EY+++G+E   REIFEEY+T L 
Sbjct  781  ADDFHKLLHTFKEITVSSSWEDCKQLFEETQEYRSVGDEDFGREIFEEYITSLH  834



>ref|XP_010692587.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQ+YIR LEKEEEEQ+K QKEQLRR ERKNRD FR M+E   AA
Sbjct  394  DDERCSRLEKIDRLEIFQDYIRYLEKEEEEQKKLQKEQLRRVERKNRDEFRKMLEVDTAA  453

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  VK+S AY AVA NTSGSTPKDLFEDVV+ELENQYH+DK+R+K+ +
Sbjct  454  GALTAKTSWREYCGKVKDSPAYLAVARNTSGSTPKDLFEDVVDELENQYHDDKSRIKDAM  513

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FE+FKA+I   +G+P I+++NL+L+FE+ +ER K+KEEKEAKKRQRL 
Sbjct  514  KLCKIVMTSTWTFEEFKASISLELGSPLIADINLKLVFEEQLERVKEKEEKEAKKRQRLL  573

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L +  EIT +S W++ K+L E+S EY+ I  E   +E FE+YV  LQ
Sbjct  574  DDFTDLLRSLKEITVSSLWDDSKQLFEESEEYREIDNEILAKEAFEDYVVYLQ  626



>ref|XP_003549369.2| PREDICTED: pre-mRNA-processing protein 40A-like [Glycine max]
 gb|KHN36985.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1008

 Score =   228 bits (582),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R  RL KID L VFQ+YIRDLEKEEEEQ++ QK+Q+RR ERKNRDAFR ++E+H+AA
Sbjct  616  DDDRYLRLEKIDCLLVFQDYIRDLEKEEEEQKRIQKDQIRRGERKNRDAFRKLLEEHVAA  675

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W +YC  V++   YQAVASNTSGSTPKDLFED  E+LE QYHEDKT +K+ +
Sbjct  676  GILTAKTQWHEYCLKVRDLPQYQAVASNTSGSTPKDLFEDAAEDLEKQYHEDKTLIKDTI  735

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KIT      FE+FK A+LE     +ISE+NL+LIFE+L+ERAK+KEEKEAKKRQRLA
Sbjct  736  KSGKITVVTTSVFEEFKVAVLEEAACQTISEINLKLIFEELLERAKEKEEKEAKKRQRLA  795

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
             DF  +L    +ITA+S WE+CK L E++ EY++IG+E+  REIFEEY+T L
Sbjct  796  DDFTNLLYTFKDITASSKWEDCKSLFEEAQEYRSIGDESYSREIFEEYITYL  847



>gb|KHN23176.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1016

 Score =   228 bits (581),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 190/251 (76%), Gaps = 19/251 (8%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+ DLEKEEEEQ+K QKE+LR+ ERKNR+ FR +ME+HIA+G
Sbjct  619  DERCSRLEKIDRLEIFQDYLHDLEKEEEEQKKIQKEELRKTERKNREEFRKLMEEHIASG  678

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPKDLFEDV EELE QYHE+K+R+K+ +K
Sbjct  679  ILTAKTHWRDYYTKVKDLHAYVAVASNTSGSTPKDLFEDVAEELEKQYHEEKSRIKDTVK  738

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQ-------------------LIFEDLM  259
              KIT S  W+FEDFK+A+ + I TP IS+ NL+                   L+F++L+
Sbjct  739  LAKITLSSTWAFEDFKSALSKAISTPPISDFNLKVVVAVPAWLANPYLPPDTLLVFDELL  798

Query  258  erakdkeekeakkrqrlaKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLR  79
            ERAK+KEEKEAKKR+RL+ DF  +L +  +IT +  WE+C+  VEDS E+++IG+E+  +
Sbjct  799  ERAKEKEEKEAKKRKRLSDDFFHLLHSTKDITVSLKWEDCRPHVEDSQEFRSIGDESLCK  858

Query  78   EIFEEYVTRLQ  46
            E+FEEY+ +L+
Sbjct  859  EVFEEYIAQLK  869



>ref|XP_010692586.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   228 bits (580),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQ+YIR LEKEEEEQ+K QKEQLRR ERKNRD FR M+E   AA
Sbjct  600  DDERCSRLEKIDRLEIFQDYIRYLEKEEEEQKKLQKEQLRRVERKNRDEFRKMLEVDTAA  659

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  VK+S AY AVA NTSGSTPKDLFEDVV+ELENQYH+DK+R+K+ +
Sbjct  660  GALTAKTSWREYCGKVKDSPAYLAVARNTSGSTPKDLFEDVVDELENQYHDDKSRIKDAM  719

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KI  +  W+FE+FKA+I   +G+P I+++NL+L+FE+ +ER K+KEEKEAKKRQRL 
Sbjct  720  KLCKIVMTSTWTFEEFKASISLELGSPLIADINLKLVFEEQLERVKEKEEKEAKKRQRLL  779

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L +  EIT +S W++ K+L E+S EY+ I  E   +E FE+YV  LQ
Sbjct  780  DDFTDLLRSLKEITVSSLWDDSKQLFEESEEYREIDNEILAKEAFEDYVVYLQ  832



>ref|XP_009397415.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1033

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI RLE FQEY+RDLE+EEEEQRK QKEQLRR ERKNRD FR +ME+H+AAG
Sbjct  643  DERCSRLEKIVRLENFQEYVRDLEREEEEQRKMQKEQLRRVERKNRDEFRKLMEEHVAAG  702

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+   Y A++SNTSG+TPKDLFEDV EELE QYHEDK ++K+ +K
Sbjct  703  VLTAKTHWRDYFTQVKDLSPYLAISSNTSGATPKDLFEDVTEELEKQYHEDKAQIKDAMK  762

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT +  W+FED K A+        ISE+NL+L+F++L+ER ++KE+K+AKKRQRLA 
Sbjct  763  IGKITLASSWTFEDLKTAVAGIDSLRGISEINLKLVFDELLERVREKEDKDAKKRQRLAD  822

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EITA S+WE+C+ L EDS EY++IG++   RE+F+ YV  LQ
Sbjct  823  NFSDLLYSIKEITAFSNWEQCRSLFEDSQEYRSIGDDNFGREVFDGYVAHLQ  874



>ref|XP_009397407.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1034

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI RLE FQEY+RDLE+EEEEQRK QKEQLRR ERKNRD FR +ME+H+AAG
Sbjct  644  DERCSRLEKIVRLENFQEYVRDLEREEEEQRKMQKEQLRRVERKNRDEFRKLMEEHVAAG  703

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+   Y A++SNTSG+TPKDLFEDV EELE QYHEDK ++K+ +K
Sbjct  704  VLTAKTHWRDYFTQVKDLSPYLAISSNTSGATPKDLFEDVTEELEKQYHEDKAQIKDAMK  763

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT +  W+FED K A+        ISE+NL+L+F++L+ER ++KE+K+AKKRQRLA 
Sbjct  764  IGKITLASSWTFEDLKTAVAGIDSLRGISEINLKLVFDELLERVREKEDKDAKKRQRLAD  823

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F ++L +  EITA S+WE+C+ L EDS EY++IG++   RE+F+ YV  LQ
Sbjct  824  NFSDLLYSIKEITAFSNWEQCRSLFEDSQEYRSIGDDNFGREVFDGYVAHLQ  875



>ref|XP_010479065.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Camelina 
sativa]
Length=919

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  574  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  631

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AGT+TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  632  AGTLTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  691

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AILE +    +S++NL+LI++DL+ER K+KEEKEA+K QR+
Sbjct  692  MKSRKISMVFSWLFEDFKSAILEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLQRM  751

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  752  AEEFTNLLRTLKEITAASNWEDTKPLIEESQEYRSIGDESASRGLFEEYITSLQ  805



>ref|XP_010479066.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Camelina 
sativa]
Length=828

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  434  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  491

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AGT+TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  492  AGTLTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  551

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AILE +    +S++NL+LI++DL+ER K+KEEKEA+K QR+
Sbjct  552  MKSRKISMVFSWLFEDFKSAILEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLQRM  611

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  612  AEEFTNLLRTLKEITAASNWEDTKPLIEESQEYRSIGDESASRGLFEEYITSLQ  665



>ref|XP_010479063.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Camelina 
sativa]
Length=968

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  574  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  631

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AGT+TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  632  AGTLTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  691

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AILE +    +S++NL+LI++DL+ER K+KEEKEA+K QR+
Sbjct  692  MKSRKISMVFSWLFEDFKSAILEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLQRM  751

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  752  AEEFTNLLRTLKEITAASNWEDTKPLIEESQEYRSIGDESASRGLFEEYITSLQ  805



>ref|XP_010479064.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Camelina 
sativa]
Length=967

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  573  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  630

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AGT+TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  631  AGTLTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  690

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AILE +    +S++NL+LI++DL+ER K+KEEKEA+K QR+
Sbjct  691  MKSRKISMVFSWLFEDFKSAILEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLQRM  750

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  751  AEEFTNLLRTLKEITAASNWEDTKPLIEESQEYRSIGDESASRGLFEEYITSLQ  804



>ref|XP_006306359.1| hypothetical protein CARUB_v10012256mg [Capsella rubella]
 gb|EOA39257.1| hypothetical protein CARUB_v10012256mg [Capsella rubella]
Length=966

 Score =   224 bits (572),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRL  F+EYI +LEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  571  DDERCSCLEKIDRLIGFEEYILELEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  630

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  +K+   YQAVASN SGSTPKDLFEDV EELE QYHEDK+RVK+ +
Sbjct  631  GILTAKTYWLDYCIELKDLPQYQAVASNLSGSTPKDLFEDVTEELEKQYHEDKSRVKDAM  690

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W FEDFK+AI E +    IS++NL+LI++DL+ER K+KEEKEA+K QRLA
Sbjct  691  KSRKISMVSSWLFEDFKSAISEDLIPQPISDINLKLIYDDLVERMKEKEEKEARKLQRLA  750

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  + +FEEY T LQ
Sbjct  751  EEFTNLLRTLKEITAASNWEDTKALIEESQEYRSIGDESVSKGLFEEYTTSLQ  803



>ref|XP_004496865.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE+LR+ ERKNRD FR +M++HIA+G
Sbjct  631  DERCSRLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEELRKTERKNRDEFRKLMDEHIASG  690

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPK+LFEDV EELE QY E+K+++K+ +K
Sbjct  691  ILTAKTHWRDYHFKVKDLPAYLAVASNTSGSTPKELFEDVAEELEKQYVEEKSQIKDAVK  750

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT    W+FEDFK+A+ E I +PS S+ NL+L+FE+L+ERAK+KEEKEAKKR+RLA 
Sbjct  751  LAKITLLTTWTFEDFKSALSEHISSPSTSDSNLKLVFEELLERAKEKEEKEAKKRKRLAD  810

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            DF  +L +  +IT +S WE+ + L+EDS E+++IG+ +  +++FEEYV +L+
Sbjct  811  DFFRLLFSIKDITESSKWEDSEPLLEDSQEFRSIGDASLCKQMFEEYVAQLR  862



>ref|XP_003563698.1| PREDICTED: pre-mRNA-processing protein 40A [Brachypodium distachyon]
 ref|XP_010227563.1| PREDICTED: pre-mRNA-processing protein 40A [Brachypodium distachyon]
Length=998

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 178/233 (76%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL+VFQEYIRDLEKEEEEQ++ QKE  RR ERKNRD FR M+E+H+A 
Sbjct  597  DDERCSRLEKIDRLDVFQEYIRDLEKEEEEQKRIQKEHTRRQERKNRDEFRKMLEEHVAD  656

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+S AY AVASN SGS PK+LFEDV+EEL+ QY +DKT +K+ L
Sbjct  657  GTLTAKTHWRDYCAQVKDSRAYLAVASNMSGSMPKELFEDVIEELDKQYQDDKTLIKDEL  716

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ EDF+AA+        IS +N++LI++D +ER ++K+ KEAKKRQRL 
Sbjct  717  KSGKIHMTTSWTLEDFQAAVTGDDNCKGISNINIKLIYDDQIERLREKDLKEAKKRQRLG  776

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F++ L +  EI+A S+WE+ K L EDS E +A+  ET  RE+FEE V RL+
Sbjct  777  DNFLDFLYSIKEISATSTWEDSKPLFEDSQECRALDSETYARELFEECVVRLK  829



>ref|XP_007160939.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
 gb|ESW32933.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
Length=887

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R  RL KIDRL VFQ+YIRDLEKEEEEQR+ QK+++RR ERKNRDAFR ++E+H+A 
Sbjct  610  DDDRYLRLEKIDRLLVFQDYIRDLEKEEEEQRRIQKDRVRRGERKNRDAFRKLLEEHVAT  669

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  V++   YQAVASNT GSTPKDLFE V E+LE QYHEDKT +K+ +
Sbjct  670  GILTAKTQWREYCLKVRDLPQYQAVASNTLGSTPKDLFELVAEDLEKQYHEDKTLIKDTI  729

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI       FE+FKAA+LE +   +IS++NL+LIFE+L+ERAK+KEEKEAKKRQRLA
Sbjct  730  KSGKIIVVTTSVFEEFKAAVLEDVACQTISDINLKLIFEELLERAKEKEEKEAKKRQRLA  789

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
             +F  +L    +IT +S WE+CK L E++ EY++IG+E+  REIFEEY+T L
Sbjct  790  DEFTNLLYTFKDITTSSKWEDCKSLFEETQEYRSIGDESYSREIFEEYITYL  841



>gb|EEE54732.1| hypothetical protein OsJ_02081 [Oryza sativa Japonica Group]
Length=1002

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLEKEEEE ++  KEQ+RR ERKNRD FR M+E+H+A 
Sbjct  603  DDERCSRLEKIDRLEIFQEYIRDLEKEEEEHKRIHKEQVRRQERKNRDEFRKMLEEHVAE  662

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+S  Y AVASN SGS PKDLFEDV+EELE QY +DK R+K  +
Sbjct  663  GMLTAKTRWRDYCAQVKDSSVYLAVASNISGSMPKDLFEDVMEELEKQYQDDKARIKEAV  722

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ EDF+ A+ E      I+ +N++LIF+D +ER ++KE KEAKKRQRL 
Sbjct  723  KSGKIPMTTSWTLEDFETAVTEDDTLKGITNINMKLIFDDQVERLREKEVKEAKKRQRLG  782

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K L EDS EYKA+  ET  RE+FEE V
Sbjct  783  ENFSDLLYSIKEISASSTWDDSKALFEDSQEYKALDSETYSRELFEECV  831



>ref|XP_007160940.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
 gb|ESW32934.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
Length=1000

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R  RL KIDRL VFQ+YIRDLEKEEEEQR+ QK+++RR ERKNRDAFR ++E+H+A 
Sbjct  610  DDDRYLRLEKIDRLLVFQDYIRDLEKEEEEQRRIQKDRVRRGERKNRDAFRKLLEEHVAT  669

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WR+YC  V++   YQAVASNT GSTPKDLFE V E+LE QYHEDKT +K+ +
Sbjct  670  GILTAKTQWREYCLKVRDLPQYQAVASNTLGSTPKDLFELVAEDLEKQYHEDKTLIKDTI  729

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI       FE+FKAA+LE +   +IS++NL+LIFE+L+ERAK+KEEKEAKKRQRLA
Sbjct  730  KSGKIIVVTTSVFEEFKAAVLEDVACQTISDINLKLIFEELLERAKEKEEKEAKKRQRLA  789

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
             +F  +L    +IT +S WE+CK L E++ EY++IG+E+  REIFEEY+T L
Sbjct  790  DEFTNLLYTFKDITTSSKWEDCKSLFEETQEYRSIGDESYSREIFEEYITYL  841



>ref|XP_010461464.1| PREDICTED: pre-mRNA-processing protein 40A-like [Camelina sativa]
Length=964

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 183/234 (78%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  570  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  627

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AG +TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  628  AGILTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  687

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AI E +    +S++NL+LI++DL+ER K+KEEKEA+K  R+
Sbjct  688  MKSRKISMVSSWLFEDFKSAISEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLHRM  747

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  748  AEEFTNLLRTLKEITAASNWEDTKPLIEESQEYRSIGDESVSRGLFEEYITSLQ  801



>ref|XP_010500169.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Camelina 
sativa]
Length=967

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 183/234 (78%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  573  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  630

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AG +TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  631  AGILTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  690

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AI E +    +S++NL+LI++DL+ER K+KEEKEA+K  R+
Sbjct  691  MKSRKISMVSSWLFEDFKSAISEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLHRM  750

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ K L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  751  AEEFTNLLRTLKEITAASNWEDTKPLIEESQEYRSIGDESVSRGLFEEYITSLQ  804



>ref|XP_010500168.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Camelina 
sativa]
Length=968

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 183/234 (78%), Gaps = 3/234 (1%)
 Frame = -2

Query  744  DDER-CSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIA  568
            DDER C  L KIDRL  F+EYI +LEKEEEE +K +KE +RRAERKNRDAFR ++E+H+A
Sbjct  574  DDERFC--LEKIDRLIGFEEYILELEKEEEELKKVEKEHVRRAERKNRDAFRTLLEEHVA  631

Query  567  AGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNV  388
            AG +TAKT W DYC  +KE   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+RVK  
Sbjct  632  AGILTAKTYWLDYCIELKELPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSRVKEA  691

Query  387  LKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +KS KI+    W FEDFK+AI E +    +S++NL+LI++DL+ER K+KEEKEA+K  R+
Sbjct  692  MKSRKISMVSSWLFEDFKSAISEDLSPQPVSDINLKLIYDDLVERMKEKEEKEARKLHRM  751

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            A++F  +L    EITAAS+WE+ + L+E+S EY++IG+E+  R +FEEY+T LQ
Sbjct  752  AEEFTNLLRTLKEITAASNWEDTRPLIEESQEYRSIGDESVSRGLFEEYITSLQ  805



>ref|XP_004956604.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Setaria 
italica]
 ref|XP_004956605.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Setaria 
italica]
 ref|XP_004956606.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Setaria 
italica]
 ref|XP_004956607.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Setaria 
italica]
Length=983

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL VFQ+YIR LEKEEEEQ++ QKE +RR ERKNRD FR M+E+H+  
Sbjct  590  DDERCSRLEKIDRLNVFQDYIRYLEKEEEEQKRIQKEHVRRQERKNRDGFRKMLEEHVND  649

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  +KES AY AVASNTSGSTPK+LF+DV+EEL+ QY +DKT +K V+
Sbjct  650  GTLTAKTRWRDYCSQIKESQAYLAVASNTSGSTPKELFDDVIEELDKQYLDDKTCIKEVV  709

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ E+F+ AILE      IS +N++LI++D +ER ++KE+K+AKKRQRL 
Sbjct  710  KSGKIPMTTSWTLEEFQTAILEDDALKGISTINIKLIYDDQIERLREKEQKDAKKRQRLG  769

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+AAS+W++ K+L EDS E++A+  ET  RE+FEE V
Sbjct  770  ENFSDLLYSITEISAASTWDDSKQLFEDSQEFRALDSETYARELFEECV  818



>gb|KEH44000.1| pre-mRNA-processing 40A-like protein [Medicago truncatula]
Length=1008

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCS+L KIDRLE+FQ+Y+RDLEKEEEEQ+K QKE+LR+ ERKNRD FR +M++H  +G
Sbjct  631  DERCSQLEKIDRLEIFQDYLRDLEKEEEEQKKIQKEELRKTERKNRDEFRKLMDEHSTSG  690

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+  AY AVASNTSGSTPK+LFEDVVEELE QY E+K+++K+ +K
Sbjct  691  ILTAKTHWRDYHSQVKDLPAYLAVASNTSGSTPKELFEDVVEELEKQYQEEKSQIKDAVK  750

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
            S KIT S  W+FEDFK+A+ E I +P IS+ NL+L+F++++ERA++KEEKEAKKR+RLA 
Sbjct  751  SAKITLSSTWTFEDFKSALSEHISSPPISDSNLKLVFDEVLERAREKEEKEAKKRKRLAD  810

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             F  +L +  +IT +S WE+ ++L+EDS E++++G+ +  +++FE YV +L+
Sbjct  811  AFFHLLYSTKDITESSKWEDFRQLLEDSQEFRSVGDVSLSKQMFEVYVAQLK  862



>ref|XP_011092479.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092480.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092481.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092482.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092483.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092484.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092485.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092486.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092487.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
Length=1065

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 179/232 (77%), Gaps = 4/232 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI+RLE+FQEYIRDLE EEEEQRK + E+ R+AERKNRD FR +ME+H+A G
Sbjct  678  DERCSRLEKIERLEIFQEYIRDLEMEEEEQRKLRMEEQRKAERKNRDEFRKLMEEHVAGG  737

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA + WRDYC  VK++ AY AV+SNTSGST KDLF+DV+++LE QY EDK R++  +K
Sbjct  738  ILTANSHWRDYCMKVKDAPAYLAVSSNTSGSTAKDLFDDVIDDLEKQYMEDKERIEETIK  797

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
            S KI+ S  W+FEDFK A+ + I    IS++NL+LIFE+L+E  K+K EKEAKKR+RLA+
Sbjct  798  SVKISLSMNWTFEDFKGALPKEISPKPISDINLKLIFEELLEITKEKGEKEAKKRKRLAE  857

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            D  E L  + EIT++S WE+CK LVE+    + IGEE+  REIF++ +  L+
Sbjct  858  DIYEFLFTSKEITSSSKWEDCKPLVEE----RFIGEESFFREIFDKVIIELK  905



>gb|AAF69150.1|AC007915_2 F27F5.2 [Arabidopsis thaliana]
Length=937

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 180/233 (77%), Gaps = 9/233 (4%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+RCS L KIDRL  F+EYI DLEKEEEE ++ +KE +RRAERKNRDAFR ++E+H+AA
Sbjct  559  DDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA  618

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT W DYC  +K+   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+ VK+ +
Sbjct  619  GILTAKTYWLDYCIELKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSYVKDAM  678

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS K          +FK+AI E + T  IS++NL+LI++DL+ R K+KEEKEA+K QRLA
Sbjct  679  KSRKA---------NFKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLA  729

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L    EIT AS+WE+ K+LVE+S EY++IG+E+  + +FEEY+T LQ
Sbjct  730  EEFTNLLHTFKEITVASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ  782



>gb|KEH40000.1| pre-mRNA-processing 40A-like protein [Medicago truncatula]
Length=1048

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R S L KIDRL VFQ+YIRDLEKEEEEQ++ QKE++RR ERKNRDAFR ++E+HIA 
Sbjct  654  DDDRYSLLEKIDRLLVFQDYIRDLEKEEEEQKRIQKERVRRGERKNRDAFRKLLEEHIAD  713

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VKE   YQAVASNTSGSTPKDLFEDV E LE QYHEDKT +K++L
Sbjct  714  GVLTAKTQWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVFENLEKQYHEDKTLIKDIL  773

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KIT +    FEDFK+A+ E     +ISE+NL+L+FE+L+ERAK+KEEKEAKKRQRLA
Sbjct  774  KSGKITVATTSVFEDFKSAVSEEATCKTISEINLKLLFEELLERAKEKEEKEAKKRQRLA  833

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
             DF  +L    +I  +S+WEECK L ED+ EY +IG E+  +EIFEEY+T L
Sbjct  834  DDFTNLLYTLKDIITSSTWEECKALFEDTQEYISIGNESYSKEIFEEYITYL  885



>ref|XP_006644254.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Oryza 
brachyantha]
Length=865

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 174/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLEKEEEE ++  KE++RR ERKNRD FR M+E+H A 
Sbjct  472  DDERCSRLEKIDRLEIFQEYIRDLEKEEEEHKRIHKEKIRRQERKNRDEFRKMLEEHAAE  531

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + AKT WRDYC  VK+S  Y AVASNTSGS PK+LFEDV+EE+E QY +DK R+K  +
Sbjct  532  GMLNAKTRWRDYCAQVKDSHVYMAVASNTSGSMPKELFEDVMEEVEKQYQDDKARIKEAV  591

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI     W+ EDF+ A++E      I+ +N++LI++D +ER ++KE KEAKKRQRL 
Sbjct  592  KSGKIPMVASWTLEDFQTAVMEDDTFKGITNINMKLIYDDQVERLREKEVKEAKKRQRLG  651

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K L EDS EYKA+  ++  RE+FEE V
Sbjct  652  ENFSDLLYSIKEISASSTWDDSKALFEDSQEYKALDSDSYARELFEECV  700



>ref|XP_008675544.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Zea 
mays]
Length=977

 Score =   218 bits (554),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 182/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER SRL K DRL++FQEYIR LEKEEEEQ++ QK+Q+RR ERKNRD FR M+E+H+A 
Sbjct  577  DDERYSRLEKFDRLDIFQEYIRHLEKEEEEQKRVQKDQVRRQERKNRDGFRKMLEEHVAD  636

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ A+T WRDYC  +K+S +Y AVASNTSGSTPK+LF+DV+EEL+ QY EDKT++K V+
Sbjct  637  GTLNARTRWRDYCAQIKDSQSYLAVASNTSGSTPKELFDDVIEELDKQYQEDKTQIKEVV  696

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ E+F+ AILE      IS +N++LI++D +ER K+KE+KEAKKRQRL 
Sbjct  697  KSGKIPMTTSWTLEEFQTAILEDDALKGISTINIKLIYDDQLERLKEKEQKEAKKRQRLG  756

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K+L EDS E++A+  ET  RE+FEE V
Sbjct  757  ENFSDLLYSIKEISASSTWDDSKQLFEDSQEFRALDSETYARELFEECV  805



>ref|XP_006644255.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Oryza 
brachyantha]
Length=840

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 174/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLEKEEEE ++  KE++RR ERKNRD FR M+E+H A 
Sbjct  447  DDERCSRLEKIDRLEIFQEYIRDLEKEEEEHKRIHKEKIRRQERKNRDEFRKMLEEHAAE  506

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + AKT WRDYC  VK+S  Y AVASNTSGS PK+LFEDV+EE+E QY +DK R+K  +
Sbjct  507  GMLNAKTRWRDYCAQVKDSHVYMAVASNTSGSMPKELFEDVMEEVEKQYQDDKARIKEAV  566

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI     W+ EDF+ A++E      I+ +N++LI++D +ER ++KE KEAKKRQRL 
Sbjct  567  KSGKIPMVASWTLEDFQTAVMEDDTFKGITNINMKLIYDDQVERLREKEVKEAKKRQRLG  626

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K L EDS EYKA+  ++  RE+FEE V
Sbjct  627  ENFSDLLYSIKEISASSTWDDSKALFEDSQEYKALDSDSYARELFEECV  675



>ref|XP_008675538.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675539.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675540.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675541.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675542.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675543.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
Length=994

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 182/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER SRL K DRL++FQEYIR LEKEEEEQ++ QK+Q+RR ERKNRD FR M+E+H+A 
Sbjct  594  DDERYSRLEKFDRLDIFQEYIRHLEKEEEEQKRVQKDQVRRQERKNRDGFRKMLEEHVAD  653

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ A+T WRDYC  +K+S +Y AVASNTSGSTPK+LF+DV+EEL+ QY EDKT++K V+
Sbjct  654  GTLNARTRWRDYCAQIKDSQSYLAVASNTSGSTPKELFDDVIEELDKQYQEDKTQIKEVV  713

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ E+F+ AILE      IS +N++LI++D +ER K+KE+KEAKKRQRL 
Sbjct  714  KSGKIPMTTSWTLEEFQTAILEDDALKGISTINIKLIYDDQLERLKEKEQKEAKKRQRLG  773

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K+L EDS E++A+  ET  RE+FEE V
Sbjct  774  ENFSDLLYSIKEISASSTWDDSKQLFEDSQEFRALDSETYARELFEECV  822



>ref|XP_006644253.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Oryza 
brachyantha]
Length=866

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 174/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRLE+FQEYIRDLEKEEEE ++  KE++RR ERKNRD FR M+E+H A 
Sbjct  473  DDERCSRLEKIDRLEIFQEYIRDLEKEEEEHKRIHKEKIRRQERKNRDEFRKMLEEHAAE  532

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + AKT WRDYC  VK+S  Y AVASNTSGS PK+LFEDV+EE+E QY +DK R+K  +
Sbjct  533  GMLNAKTRWRDYCAQVKDSHVYMAVASNTSGSMPKELFEDVMEEVEKQYQDDKARIKEAV  592

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI     W+ EDF+ A++E      I+ +N++LI++D +ER ++KE KEAKKRQRL 
Sbjct  593  KSGKIPMVASWTLEDFQTAVMEDDTFKGITNINMKLIYDDQVERLREKEVKEAKKRQRLG  652

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K L EDS EYKA+  ++  RE+FEE V
Sbjct  653  ENFSDLLYSIKEISASSTWDDSKALFEDSQEYKALDSDSYARELFEECV  701



>ref|XP_011017521.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A 
[Populus euphratica]
Length=734

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 174/233 (75%), Gaps = 3/233 (1%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC  L K+DRL +FQ+YI +LEKEEEEQ+K Q+EQLR    KNRD FR ++E+H+A+
Sbjct  403  DDERCLCLEKLDRLLIFQDYIHNLEKEEEEQKKIQREQLR--RXKNRDKFRKLLEEHVAS  460

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G++TAKT W DYC  VK    Y AVA+NTSGS PKDLFEDV EEL+ +Y +DKTR+K+ +
Sbjct  461  GSLTAKTHWLDYCLKVKYLPQYHAVATNTSGSKPKDLFEDVSEELQKRYQDDKTRIKDAM  520

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KIT    W+FEDFKA I +  G+P IS++N +L+ E+ +     +E +EA+K Q L 
Sbjct  521  KLGKITMVSTWTFEDFKATISDGAGSPPISDINFKLLCEEPV-ERAKEEGREAEKXQHLT  579

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             DF ++L    E+ A+S+WE+CK+L E+S EY++IGEE+ ++EIFEEYVTRLQ
Sbjct  580  DDFTKLLYTFKEVIASSNWEDCKQLFEESQEYRSIGEESLIKEIFEEYVTRLQ  632



>gb|KCW63560.1| hypothetical protein EUGRSUZ_G01189 [Eucalyptus grandis]
Length=859

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 173/213 (81%), Gaps = 2/213 (1%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQ+Y+ DLEKEEEEQRK QKE++R+AERKNRD FR +ME+H+AAG
Sbjct  642  DERCSRLEKMDRLEIFQDYLHDLEKEEEEQRKIQKEEMRKAERKNRDEFRKLMEEHVAAG  701

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKTLWRDY  MVK+  AY AVASNT+GSTPKDLFEDV EEL+ QY EDK++V + +K
Sbjct  702  TLTAKTLWRDYYMMVKDLPAYMAVASNTAGSTPKDLFEDVAEELQKQYEEDKSQVDDAVK  761

Query  381  SEKITFSPLWSFEDFKAAILETI-GTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              KI+ +  W+ E  KA+I + I GTP IS++N +L+F+DL+ERA+ KEE+  KKR+RL 
Sbjct  762  IRKISLTSTWTVEGLKASIADDIRGTP-ISDINFKLVFDDLLERARKKEERVVKKRKRLG  820

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYK  106
              F ++L+   EIT +S+W+ECK+LVE+S EY+
Sbjct  821  DKFFDLLTTIREITPSSTWDECKQLVENSHEYR  853



>gb|EMT05751.1| Pre-mRNA-processing factor 40-A-like protein [Aegilops tauschii]
Length=975

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 180/233 (77%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER +RL KIDRL+VFQ+YIR LEKEEEEQ++ +KEQLRR ERKNRD FR MME+H+A 
Sbjct  578  DDERYARLEKIDRLDVFQDYIRHLEKEEEEQKRIRKEQLRRQERKNRDEFRKMMEEHVAD  637

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AKT WRDYC  +K+S AY AVASN SGS PK+LF+DV+EEL+ QY +D+  +K+ +
Sbjct  638  GTLNAKTYWRDYCSQIKDSRAYLAVASNLSGSMPKELFDDVMEELDKQYQDDRALIKDEV  697

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI     W+ EDF+AA+ E      +S +N++LI+ED +ER K+K+ KEAKKRQRL 
Sbjct  698  KSGKIPMLASWTLEDFQAAVTEDEKYKGVSNINIKLIYEDQIERLKEKDLKEAKKRQRLG  757

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F+++L +  EITAAS+W++ K L +D+ EY+ +G ET  +E+FEEY+ RL+
Sbjct  758  DNFLDLLYSIKEITAASTWDDSKSLFDDTQEYRDLGGETYAKELFEEYIARLK  810



>gb|EMS61804.1| Pre-mRNA-processing factor 40-like protein A [Triticum urartu]
Length=971

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 180/233 (77%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER +RL KIDRL+VFQ+YIR LEKEEEEQ++ +KEQLRR ERKNRD FR MME+H+A 
Sbjct  574  DDERYARLEKIDRLDVFQDYIRHLEKEEEEQKRIRKEQLRRQERKNRDEFRKMMEEHVAD  633

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ AKT WRDYC  +K+S AY AVASN SGS PK+LF+DV+EEL+ QY +D+  +K+ +
Sbjct  634  GTLNAKTYWRDYCSQIKDSRAYLAVASNLSGSMPKELFDDVMEELDKQYQDDRALIKDEV  693

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI     W+ EDF+AA+ E      +S +N++LI+ED +ER K+K+ KEAKKRQRL 
Sbjct  694  KSGKIPMLASWTLEDFQAAVTEDEKYKGVSNINIKLIYEDQIERLKEKDLKEAKKRQRLG  753

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F+++L +  EITAAS+W++ K L +D+ EY+ +G ET  +E+FEEY+ RL+
Sbjct  754  DNFLDLLYSIKEITAASTWDDSKSLFDDTQEYRDLGGETYAKELFEEYIARLK  806



>ref|XP_004498955.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cicer arietinum]
Length=1000

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 183/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+R  +L KIDRL VFQ+YIRDLEKEEEEQ+K QKE+LRR ERKNRDAFR ++E+H+A 
Sbjct  608  DDDRYLQLEKIDRLLVFQDYIRDLEKEEEEQKKIQKERLRRGERKNRDAFRKLLEEHVAD  667

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VKE   YQAVASNTSGSTPKDLFEDV E+LE QYHEDK+ +K+ L
Sbjct  668  GVLTAKTQWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVFEDLEKQYHEDKSLIKDTL  727

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KIT      FEDFK+ +LE      ISE+NL+L++E+L+ERAK+KEEKEAKKRQRLA
Sbjct  728  KSGKITVVTTSVFEDFKSVVLEEAACQKISEINLKLLYEELLERAKEKEEKEAKKRQRLA  787

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
             DF  +L    +IT  S WE+CK L E++ EY++IG+E+  REIFEEY+T L
Sbjct  788  DDFTNVLYTLKDITTTSEWEDCKPLFEETQEYRSIGDESYSREIFEEYITYL  839



>ref|XP_006406474.1| hypothetical protein EUTSA_v10019995mg [Eutrema salsugineum]
 gb|ESQ47927.1| hypothetical protein EUTSA_v10019995mg [Eutrema salsugineum]
Length=978

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 182/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+ ++AERK+RD FR ++++HIA G
Sbjct  623  DERCSRLEKIDQLEIFQEYLRDLEREEEEKKKIQKEEQKKAERKHRDEFRGLIDEHIAKG  682

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   V++   Y A+ASN+SG+TPKDLFED VE+L+ +YH+ K+++K+VLK
Sbjct  683  ELTAKTSWRDYLTKVRDLPVYSAIASNSSGATPKDLFEDAVEDLKRKYHDLKSQIKDVLK  742

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T     +F++FK +I E IG P I +  L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  743  LRKVTIHAGSTFDEFKVSIPEGIGFPPIPDCKLKLVFDDLLERAKEKEEKEARKQTRHTE  802

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +  EITA+SSWEE K LVE S +++ IG+E+  ++ FE+YV+ L+
Sbjct  803  KLVDMLRSFKEITASSSWEESKHLVEGSEKFRTIGDESFRKQTFEDYVSHLK  854



>dbj|BAJ88075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=987

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 181/233 (78%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER +RL KIDRL+VFQ+YIR LEKEEEEQ++ QKEQLRR ERKNRD FR MME+H+A 
Sbjct  590  DDERYTRLEKIDRLDVFQDYIRHLEKEEEEQKRIQKEQLRRQERKNRDDFRKMMEEHVAD  649

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
             T+ AKT WRDYC  VK+S AY AVASN SGS PK+LF+DV+EEL+ QY +D+  +K+ +
Sbjct  650  CTLNAKTYWRDYCSQVKDSRAYLAVASNLSGSMPKELFDDVMEELDKQYQDDRALIKDEV  709

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI     W+ EDF+AA+ E      +S++N++LI+EDL+ER K+K+ KEAKKRQRL 
Sbjct  710  KSGKIPMMSSWTLEDFQAAVTEHEKCKGVSKINIKLIYEDLIERLKEKDLKEAKKRQRLG  769

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             +F+++L +  EITAAS+W++ K L +D+ EY+ +G ET  +E+FEEY+ RL+
Sbjct  770  DNFLDLLYSIKEITAASTWDDSKSLFDDTQEYRDLGGETYAKELFEEYIVRLK  822



>ref|XP_010466123.1| PREDICTED: pre-mRNA-processing protein 40B-like isoform X1 [Camelina 
sativa]
Length=872

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HI  G
Sbjct  498  DERCSRLEKIDQLEIFQEYLRDLEREEEERQKIQKEELKKAERKHRDEFRGLIDEHIGTG  557

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+   Y A+ SN+SG+TPKDLFED VE+L+ +YH+ K+++K+VLK
Sbjct  558  ELTAKTSWRDYLVKVKDLPVYSAITSNSSGATPKDLFEDAVEDLKRKYHDLKSQIKDVLK  617

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FKA+I E I  P IS++ L+L+F+DL+ER K+KEEKEA+K+ R  +
Sbjct  618  LRKVTLSGGSTFDEFKASISEDISVPPISDLKLKLVFDDLLEREKEKEEKEARKQTRQTE  677

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +  +ITA+SSWEE K LVE S   +AIG+E+  +  FE+YV+ L+
Sbjct  678  KLVDMLRSFKDITASSSWEESKHLVEGSERCRAIGDESFRKHTFEDYVSHLK  729



>ref|XP_010466124.1| PREDICTED: pre-mRNA-processing protein 40B-like isoform X2 [Camelina 
sativa]
Length=990

 Score =   213 bits (543),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HI  G
Sbjct  616  DERCSRLEKIDQLEIFQEYLRDLEREEEERQKIQKEELKKAERKHRDEFRGLIDEHIGTG  675

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+   Y A+ SN+SG+TPKDLFED VE+L+ +YH+ K+++K+VLK
Sbjct  676  ELTAKTSWRDYLVKVKDLPVYSAITSNSSGATPKDLFEDAVEDLKRKYHDLKSQIKDVLK  735

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FKA+I E I  P IS++ L+L+F+DL+ER K+KEEKEA+K+ R  +
Sbjct  736  LRKVTLSGGSTFDEFKASISEDISVPPISDLKLKLVFDDLLEREKEKEEKEARKQTRQTE  795

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +  +ITA+SSWEE K LVE S   +AIG+E+  +  FE+YV+ L+
Sbjct  796  KLVDMLRSFKDITASSSWEESKHLVEGSERCRAIGDESFRKHTFEDYVSHLK  847



>ref|XP_010507899.1| PREDICTED: pre-mRNA-processing protein 40B-like [Camelina sativa]
Length=974

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 182/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HI  G
Sbjct  600  DERCSRLEKIDQLEIFQEYLRDLEREEEERQKIQKEELKKAERKHRDEFRGLIDEHIGTG  659

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+   Y A+ SN+SG+TPKDLFED VE+L+ +YH+ K+++K+VLK
Sbjct  660  ELTAKTSWRDYLVKVKDLPVYSAITSNSSGATPKDLFEDAVEDLKRKYHDLKSQIKDVLK  719

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FK +I E I  P IS++ L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  720  LRKVTLSGGSTFDEFKVSISEDISVPPISDLKLKLVFDDLLERAKEKEEKEARKQTRQTE  779

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            + V+ML +  +ITA+SSWEE K LVE S   +AIG+E+  +  FE+YV+ L+
Sbjct  780  NLVDMLRSFKDITASSSWEESKHLVEGSERCRAIGDESFRKHTFEDYVSHLK  831



>ref|XP_008675546.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675547.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675548.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675549.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675550.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675551.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675552.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
Length=991

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 179/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER SRL K DRL++FQEYIR LEKEEEEQ++ QK+Q+RR ERKNRD FR M+E+H+A 
Sbjct  594  DDERYSRLEKFDRLDIFQEYIRHLEKEEEEQKRVQKDQVRRQERKNRDGFRKMLEEHVAD  653

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ A+T WRDYC  +K+S +Y AVASNTSGSTPK+LF+DV+EEL  QY EDK ++K V+
Sbjct  654  GTLNARTRWRDYCAQIKDSQSYLAVASNTSGSTPKELFDDVIEELGKQYQEDKIQIKEVV  713

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI  +  W+ E+F+ A LE      IS +N++L+++D +ER K+KE+K+AKKRQRL 
Sbjct  714  KSGKIPMTTSWTLEEFQTATLEDDALKGISTINIKLVYDDQLERLKEKEQKDAKKRQRLG  773

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            ++F ++L +  EI+A+S+W++ K+L EDS E++A+  ET  RE+FEE V
Sbjct  774  ENFSDLLYSIKEISASSTWDDSKQLFEDSQEFRALDSETYARELFEECV  822



>ref|XP_002885323.1| FF domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61582.1| FF domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=960

 Score =   211 bits (536),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 182/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+ DLE+EEEE++K QKE+L++AERK+RD FR ++E+HIA G
Sbjct  586  DERCSRLEKIDQLEIFQEYLGDLEREEEEKKKIQKEELKKAERKHRDEFRGLIEEHIATG  645

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKTLWRDY   VK+   Y  +ASN+SG+TPKDLFED VE+L+ +YHE K+++K+VLK
Sbjct  646  ELTAKTLWRDYLMKVKDLPVYSTIASNSSGATPKDLFEDAVEDLKKRYHELKSQIKDVLK  705

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S   +F++FK +I E IG P I +V L+++F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  706  LRKVNLSAGSAFDEFKVSISEDIGFPPIPDVRLKVVFDDLLERAKEKEEKEARKQTRQTE  765

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +  +ITA+SSWEE K LVE S + + IG+E+  ++ FE+YV+ L+
Sbjct  766  KLVDMLRSFKDITASSSWEESKHLVEGSEKCRTIGDESFRKQTFEDYVSLLK  817



>emb|CDY24627.1| BnaC05g33110D [Brassica napus]
Length=994

 Score =   211 bits (536),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 185/232 (80%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  618  DERCSRLEKIDQLEIFQEYLRDLEREEEERKKIQKEELKKAERKHRDEFRGLIDEHIATG  677

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   VK+   Y A+ASN+SG+TPK+LFED VE+L+ +YHE K+++K+VLK
Sbjct  678  ELTAKTSWRDYLVKVKDLPVYLAIASNSSGATPKELFEDAVEDLKRKYHELKSQIKDVLK  737

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++F+ ++ E IG+PSI +  L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  738  LRKVTLSTGSTFDEFRVSVSEGIGSPSIPDFKLKLVFDDLLERAKEKEEKEARKQTRNTE  797

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +   ITA+SSWE+ K LVE + +++ IG+E+  ++ FE+Y++ L+
Sbjct  798  KLVDMLRSFKYITASSSWEDSKHLVEGTEKFRTIGDESFRKKTFEDYISHLK  849



>ref|XP_010313079.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Solanum 
lycopersicum]
Length=1044

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 182/232 (78%), Gaps = 4/232 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC RL KIDRLE+FQEYIRDLE+EEEEQRK + E+LR+AERKNRD FR +ME+H+A G
Sbjct  593  DERCPRLEKIDRLEIFQEYIRDLEREEEEQRKLRMEELRKAERKNRDEFRKLMEEHVAVG  652

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + AKT+WRDYC  +K+  AYQAV+SNTSGS+ KDLF DVV+EL+ QY +DK+R+++ ++
Sbjct  653  MLNAKTIWRDYCIKIKDIAAYQAVSSNTSGSSAKDLFADVVDELDKQYLDDKSRIRDAVR  712

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              +I  +  W+ +DFK AI + I +P IS+ NL+L+FE+L+ERA+++EEKEAKKR+RLA 
Sbjct  713  MTEIGLTSTWTLDDFKDAIAKYISSPPISDTNLKLVFEELLERAREREEKEAKKRKRLAD  772

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F E+L  + EITA+S WE+CK L  D    +  G+E+ L EIF+++V  L+
Sbjct  773  EFYELLHASKEITASSKWEDCKSLFGD----RITGDESLLLEIFDKFVNELK  820



>ref|XP_004250825.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Solanum 
lycopersicum]
Length=1044

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 182/232 (78%), Gaps = 4/232 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC RL KIDRLE+FQEYIRDLE+EEEEQRK + E+LR+AERKNRD FR +ME+H+A G
Sbjct  593  DERCPRLEKIDRLEIFQEYIRDLEREEEEQRKLRMEELRKAERKNRDEFRKLMEEHVAVG  652

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + AKT+WRDYC  +K+  AYQAV+SNTSGS+ KDLF DVV+EL+ QY +DK+R+++ ++
Sbjct  653  MLNAKTIWRDYCIKIKDIAAYQAVSSNTSGSSAKDLFADVVDELDKQYLDDKSRIRDAVR  712

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              +I  +  W+ +DFK AI + I +P IS+ NL+L+FE+L+ERA+++EEKEAKKR+RLA 
Sbjct  713  MTEIGLTSTWTLDDFKDAIAKYISSPPISDTNLKLVFEELLERAREREEKEAKKRKRLAD  772

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F E+L  + EITA+S WE+CK L  D    +  G+E+ L EIF+++V  L+
Sbjct  773  EFYELLHASKEITASSKWEDCKSLFGD----RITGDESLLLEIFDKFVNELK  820



>ref|XP_010313077.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Solanum 
lycopersicum]
Length=1045

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 182/232 (78%), Gaps = 4/232 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC RL KIDRLE+FQEYIRDLE+EEEEQRK + E+LR+AERKNRD FR +ME+H+A G
Sbjct  594  DERCPRLEKIDRLEIFQEYIRDLEREEEEQRKLRMEELRKAERKNRDEFRKLMEEHVAVG  653

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + AKT+WRDYC  +K+  AYQAV+SNTSGS+ KDLF DVV+EL+ QY +DK+R+++ ++
Sbjct  654  MLNAKTIWRDYCIKIKDIAAYQAVSSNTSGSSAKDLFADVVDELDKQYLDDKSRIRDAVR  713

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              +I  +  W+ +DFK AI + I +P IS+ NL+L+FE+L+ERA+++EEKEAKKR+RLA 
Sbjct  714  MTEIGLTSTWTLDDFKDAIAKYISSPPISDTNLKLVFEELLERAREREEKEAKKRKRLAD  773

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F E+L  + EITA+S WE+CK L  D    +  G+E+ L EIF+++V  L+
Sbjct  774  EFYELLHASKEITASSKWEDCKSLFGD----RITGDESLLLEIFDKFVNELK  821



>ref|XP_010489948.1| PREDICTED: pre-mRNA-processing protein 40B-like [Camelina sativa]
Length=958

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 179/232 (77%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HI  G
Sbjct  613  DERCSRLEKIDQLEIFQEYLRDLEREEEERQKIQKEELKKAERKHRDEFRGLIDEHIGTG  672

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA T WRDY   VK+   Y A+ SN+SG+TPKDLFED VE+L+ +YHE K+++K+VLK
Sbjct  673  ELTANTSWRDYLVKVKDLPVYSAITSNSSGATPKDLFEDAVEDLKRKYHELKSQIKDVLK  732

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FK +I E I  P IS++ L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  733  LRKVTLSGGSTFDEFKVSISEDISVPPISDLKLKLVFDDLLERAKEKEEKEARKQTRQTE  792

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            + ++ML +  +ITA+SSWEE K LVE S   +AIG+E   +  FE+YV  L+
Sbjct  793  NLMDMLRSFKDITASSSWEESKHLVEGSERCRAIGDENFRKHTFEDYVLHLK  844



>ref|XP_009604101.1| PREDICTED: pre-mRNA-processing protein 40A-like [Nicotiana tomentosiformis]
Length=770

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 179/230 (78%), Gaps = 4/230 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRLE+FQEYIRDLE+EEEE RK + ++LR+AERKNRD FR +ME+H+AA
Sbjct  384  DDERCSCLEKIDRLEIFQEYIRDLEREEEEHRKLRMDELRKAERKNRDEFRKLMEEHLAA  443

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + AKT WRDYC  VK+  AYQAV+SNTSG T KDLF+DV +ELE QY +DK+R+++ +
Sbjct  444  GILNAKTNWRDYCIKVKDLPAYQAVSSNTSGPTAKDLFQDVFDELEKQYLDDKSRIRDAV  503

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            +  +I  +  W+ EDFK AI + I +P IS+ NL+ +FE+L+ERA+++EEKEAK+R+RLA
Sbjct  504  RMAEIGLTSTWTLEDFKVAIAKDISSPPISDTNLKFVFEELLERAREREEKEAKRRKRLA  563

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVT  55
             +F E+L  + EITA+S WE+CK +  D    + +GEE+ L EIF+++ +
Sbjct  564  DEFYELLHTSKEITASSKWEDCKSIFGD----RIMGEESFLLEIFDKFSS  609



>ref|XP_010557533.1| PREDICTED: pre-mRNA-processing protein 40B isoform X4 [Tarenaya 
hassleriana]
Length=873

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC  L KIDR+E+FQEY+RDLE+EEEE++K  KE+L++AERKNRD FR ++++HI+ G
Sbjct  490  DERCLHLEKIDRIEIFQEYLRDLEREEEERKKILKEELKKAERKNRDEFRKLIDEHISTG  549

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAK  WRDY   V++S  Y A+ SN+SG+TPKDLFED V++L+ Q+ E K+R+K+ LK
Sbjct  550  VLTAKISWRDYLTKVRDSPVYSAIVSNSSGATPKDLFEDAVDDLQKQHRELKSRIKHCLK  609

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S   +F++FK ++ E I  P +S+VNL+L+F+DL+ER K+KE KEAKK +RLA+
Sbjct  610  RGKITLSSASTFDEFKVSVSEEISFP-VSDVNLKLVFDDLLERVKEKEGKEAKKCKRLAE  668

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            D V++L +  +ITA+SSWE+CK LVE S E +++G+E   R+ FE+YV+ L+
Sbjct  669  DLVDILRSFKDITASSSWEDCKHLVEGSQECRSVGDEDFRRQTFEDYVSHLK  720



>ref|XP_010557531.1| PREDICTED: pre-mRNA-processing protein 40B isoform X3 [Tarenaya 
hassleriana]
Length=953

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC  L KIDR+E+FQEY+RDLE+EEEE++K  KE+L++AERKNRD FR ++++HI+ G
Sbjct  570  DERCLHLEKIDRIEIFQEYLRDLEREEEERKKILKEELKKAERKNRDEFRKLIDEHISTG  629

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAK  WRDY   V++S  Y A+ SN+SG+TPKDLFED V++L+ Q+ E K+R+K+ LK
Sbjct  630  VLTAKISWRDYLTKVRDSPVYSAIVSNSSGATPKDLFEDAVDDLQKQHRELKSRIKHCLK  689

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S   +F++FK ++ E I  P +S+VNL+L+F+DL+ER K+KE KEAKK +RLA+
Sbjct  690  RGKITLSSASTFDEFKVSVSEEISFP-VSDVNLKLVFDDLLERVKEKEGKEAKKCKRLAE  748

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            D V++L +  +ITA+SSWE+CK LVE S E +++G+E   R+ FE+YV+ L+
Sbjct  749  DLVDILRSFKDITASSSWEDCKHLVEGSQECRSVGDEDFRRQTFEDYVSHLK  800



>ref|XP_010557530.1| PREDICTED: pre-mRNA-processing protein 40B isoform X2 [Tarenaya 
hassleriana]
Length=983

 Score =   208 bits (530),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC  L KIDR+E+FQEY+RDLE+EEEE++K  KE+L++AERKNRD FR ++++HI+ G
Sbjct  602  DERCLHLEKIDRIEIFQEYLRDLEREEEERKKILKEELKKAERKNRDEFRKLIDEHISTG  661

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAK  WRDY   V++S  Y A+ SN+SG+TPKDLFED V++L+ Q+ E K+R+K+ LK
Sbjct  662  VLTAKISWRDYLTKVRDSPVYSAIVSNSSGATPKDLFEDAVDDLQKQHRELKSRIKHCLK  721

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S   +F++FK ++ E I  P +S+VNL+L+F+DL+ER K+KE KEAKK +RLA+
Sbjct  722  RGKITLSSASTFDEFKVSVSEEISFP-VSDVNLKLVFDDLLERVKEKEGKEAKKCKRLAE  780

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            D V++L +  +ITA+SSWE+CK LVE S E +++G+E   R+ FE+YV+ L+
Sbjct  781  DLVDILRSFKDITASSSWEDCKHLVEGSQECRSVGDEDFRRQTFEDYVSHLK  832



>ref|XP_010557525.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557526.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557527.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557528.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557529.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557534.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
Length=985

 Score =   208 bits (530),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC  L KIDR+E+FQEY+RDLE+EEEE++K  KE+L++AERKNRD FR ++++HI+ G
Sbjct  602  DERCLHLEKIDRIEIFQEYLRDLEREEEERKKILKEELKKAERKNRDEFRKLIDEHISTG  661

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAK  WRDY   V++S  Y A+ SN+SG+TPKDLFED V++L+ Q+ E K+R+K+ LK
Sbjct  662  VLTAKISWRDYLTKVRDSPVYSAIVSNSSGATPKDLFEDAVDDLQKQHRELKSRIKHCLK  721

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              KIT S   +F++FK ++ E I  P +S+VNL+L+F+DL+ER K+KE KEAKK +RLA+
Sbjct  722  RGKITLSSASTFDEFKVSVSEEISFP-VSDVNLKLVFDDLLERVKEKEGKEAKKCKRLAE  780

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            D V++L +  +ITA+SSWE+CK LVE S E +++G+E   R+ FE+YV+ L+
Sbjct  781  DLVDILRSFKDITASSSWEDCKHLVEGSQECRSVGDEDFRRQTFEDYVSHLK  832



>ref|XP_001774266.1| predicted protein [Physcomitrella patens]
 gb|EDQ60902.1| predicted protein [Physcomitrella patens]
Length=1182

 Score =   209 bits (532),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 184/260 (71%), Gaps = 28/260 (11%)
 Frame = -2

Query  744   DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
             DDERCSRL K+DRLEVFQEYIRDLEKEE+E ++ QK+QLRR ERK+RD FR +M++H AA
Sbjct  742   DDERCSRLDKLDRLEVFQEYIRDLEKEEDEAKRLQKDQLRRKERKHRDEFRKLMDEHKAA  801

Query  564   GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
             G +TAKT+WRDY   VK++ AYQAVASNTSG+TPK+LFEDVVEEL  QYH+DK RVK+V+
Sbjct  802   GILTAKTVWRDYLTKVKDNSAYQAVASNTSGTTPKELFEDVVEELVKQYHDDKARVKDVM  861

Query  384   KSEKITFSPLWSFEDFKAAI-----LETIGTPSISEVNL---------------------  283
             K+ KI+    W+F+ FKAA      L  I  P++ ++                       
Sbjct  862   KAGKISVGGTWTFDKFKAAYAEAGDLAAIAVPNLKKITAGAVLCGVLATSILSADADQFW  921

Query  282   --QLIFEDLMerakdkeekeakkrqrlaKDFVEMLSNADEITAASSWEECKELVEDSSEY  109
               +L+FED +ERAK+KEEKEAKKR+R+A DF  +L +   +T +S WE+ + L+EDS EY
Sbjct  922   LQKLVFEDYVERAKEKEEKEAKKRRRMADDFTNLLRSTKAVTLSSKWEDVRPLIEDSQEY  981

Query  108   KAIGEETTLREIFEEYVTRL  49
             +A+ ++   +++FE+YV  L
Sbjct  982   RALPDDGQRKKLFEDYVIHL  1001



>ref|XP_009796951.1| PREDICTED: pre-mRNA-processing protein 40A-like [Nicotiana sylvestris]
Length=837

 Score =   204 bits (519),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 178/230 (77%), Gaps = 4/230 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCS L KIDRLE+FQEYIRDLE+EEEE RK + +++R+AERKNRD FR +ME+H+AA
Sbjct  451  DDERCSCLEKIDRLEIFQEYIRDLEREEEEHRKLRMDEMRKAERKNRDEFRKLMEEHVAA  510

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + AKT WRDYC  VK+  AY AV+SNTSG   KDLF+DV +ELE QY +DK+R+++ +
Sbjct  511  GILNAKTNWRDYCIKVKDLPAYLAVSSNTSGPKAKDLFQDVFDELEKQYLDDKSRIRDAI  570

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            +  +I  +  W+ EDFK AI + I +P IS+ NL+ +FE+L+ERA+++EEKEAK+R+RLA
Sbjct  571  RMAEIGLTSTWTLEDFKVAISKDISSPPISDTNLKFVFEELLERAREREEKEAKRRKRLA  630

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVT  55
             +F E+L  + EITA+S WE+CK +  D    + +GEE+ L EIF+++++
Sbjct  631  DEFYELLHTSKEITASSKWEDCKSIFGD----RIMGEESFLLEIFDKFIS  676



>ref|XP_009145759.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Brassica 
rapa]
Length=993

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 183/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  617  DERCSRLEKIDQLEIFQEYLRDLEREEEERKKIQKEELKKAERKHRDEFRGLIDEHIATG  676

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAK+ WRDY   VK+   Y A+ASN+SG+TPK+LFED  E+L+ +YHE K+++K+VLK
Sbjct  677  ELTAKSSWRDYLVKVKDLPVYLAIASNSSGATPKELFEDAAEDLKRKYHELKSQIKDVLK  736

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FK ++ E I +PSI +  L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  737  LRKVTLSTESTFDEFKVSVSEGISSPSIPDFKLKLVFDDLLERAKEKEEKEARKQTRNTE  796

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +   ITA+SSWE+ K LVE + +++ IG+E+  ++ FE+Y++ L+
Sbjct  797  KLVDMLRSFKYITASSSWEDYKHLVEGTEKFRTIGDESFRKKTFEDYISHLK  848



>ref|XP_006352104.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Solanum 
tuberosum]
Length=1003

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 181/232 (78%), Gaps = 4/232 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC RL KIDRLE+FQEYIRDLE+EEEEQRK + E+LR+AERKNRD FR +ME+H+A G
Sbjct  594  DERCPRLEKIDRLEIFQEYIRDLEREEEEQRKLRMEELRKAERKNRDEFRKLMEEHVAVG  653

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + AKT+WRDYC  +K+  AY AV+SNTSGS+ KDLF DVV+EL+ QY +DK+R+++ ++
Sbjct  654  MLNAKTIWRDYCIKIKDIAAYLAVSSNTSGSSAKDLFADVVDELDKQYLDDKSRIRDAVR  713

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              +   +  W+ +DFK AI + I +P IS+ NL+L+FE+L+ERA+++EEKEAKKR+RLA 
Sbjct  714  MTENGLTSTWTLDDFKDAIAKDISSPPISDTNLKLVFEELLERAREREEKEAKKRKRLAD  773

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F E+L  + EITA+S WE+CK L  D    + +G+E+ L EIF+++V  L+
Sbjct  774  EFYELLHASKEITASSKWEDCKSLFGD----RIMGDESLLLEIFDKFVNELK  821



>ref|XP_006352103.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Solanum 
tuberosum]
Length=1003

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 181/232 (78%), Gaps = 4/232 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERC RL KIDRLE+FQEYIRDLE+EEEEQRK + E+LR+AERKNRD FR +ME+H+A G
Sbjct  594  DERCPRLEKIDRLEIFQEYIRDLEREEEEQRKLRMEELRKAERKNRDEFRKLMEEHVAVG  653

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + AKT+WRDYC  +K+  AY AV+SNTSGS+ KDLF DVV+EL+ QY +DK+R+++ ++
Sbjct  654  MLNAKTIWRDYCIKIKDIAAYLAVSSNTSGSSAKDLFADVVDELDKQYLDDKSRIRDAVR  713

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              +   +  W+ +DFK AI + I +P IS+ NL+L+FE+L+ERA+++EEKEAKKR+RLA 
Sbjct  714  MTENGLTSTWTLDDFKDAIAKDISSPPISDTNLKLVFEELLERAREREEKEAKKRKRLAD  773

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +F E+L  + EITA+S WE+CK L  D    + +G+E+ L EIF+++V  L+
Sbjct  774  EFYELLHASKEITASSKWEDCKSLFGD----RIMGDESLLLEIFDKFVNELK  821



>emb|CDY51697.1| BnaA05g36840D [Brassica napus]
Length=994

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 183/232 (79%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  618  DERCSRLEKIDQLEIFQEYLRDLEREEEERKKIQKEELKKAERKHRDEFRGLIDEHIATG  677

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA++ WRDY   VK+   Y A+ASN+SG+TPK+LFED  E+L+ +YHE K+++K+VLK
Sbjct  678  ELTAQSSWRDYLVKVKDLPVYLAIASNSSGATPKELFEDAAEDLKRKYHELKSQIKDVLK  737

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FK ++ E I +PSI +  L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  738  LRKVTLSTGSTFDEFKVSVSEGISSPSIPDFKLKLVFDDLLERAKEKEEKEARKQTRNTE  797

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +   ITA+SSWE+ K LVE + +++ IG+E+  ++ FE+Y++ L+
Sbjct  798  KLVDMLRSFKYITASSSWEDSKHLVEGTEKFRTIGDESFRKKTFEDYISHLK  849



>ref|NP_188601.4| pre-mRNA-processing protein 40B [Arabidopsis thaliana]
 sp|F4JCC1.1|PR35B_ARATH RecName: Full=Pre-mRNA-processing protein 40B; AltName: Full=Mediator 
of RNA polymerase II transcription subunit 35b [Arabidopsis 
thaliana]
 gb|AEE76274.1| pre-mRNA-processing protein 40B [Arabidopsis thaliana]
Length=992

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 179/232 (77%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++ ERK+RD F  ++++HIA G
Sbjct  618  DERCSRLEKIDQLEIFQEYLRDLEREEEEKKKIQKEELKKVERKHRDEFHGLLDEHIATG  677

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT+WRDY   VK+   Y A+ASN+SG+TPKDLFED VE+L+ + HE K+++K+VLK
Sbjct  678  ELTAKTIWRDYLMKVKDLPVYSAIASNSSGATPKDLFEDAVEDLKKRDHELKSQIKDVLK  737

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S   +F++FK +I E IG P I +V L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  738  LRKVNLSAGSTFDEFKVSISEDIGFPLIPDVRLKLVFDDLLERAKEKEEKEARKQTRQTE  797

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML +  +ITA+SSWEE K LVE S +   IG+E+  +  FE+YV+ L+
Sbjct  798  KLVDMLRSFKDITASSSWEELKHLVEGSEKCSTIGDESFRKRCFEDYVSLLK  849



>gb|KDO49546.1| hypothetical protein CISIN_1g001687mg [Citrus sinensis]
Length=873

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K+DRLE+FQEY+ DLEKEEEEQRK QKE+L + ERKNRD FR +ME  +A G
Sbjct  646  DERCSRLDKMDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEADVALG  705

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDYC  VK+S  Y AVASNTSGSTPKDLFEDVVEEL+ Q+ EDKTR+K+ +K
Sbjct  706  TLTAKTNWRDYCIKVKDSPPYMAVASNTSGSTPKDLFEDVVEELQKQFQEDKTRIKDAVK  765

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLM  259
              KIT S  W+FEDFKA++LE   +P IS+VNL+LIF+DL+
Sbjct  766  LRKITLSSTWTFEDFKASVLEDATSPPISDVNLKLIFDDLL  806



>gb|KFK39295.1| hypothetical protein AALP_AA3G226000 [Arabis alpina]
Length=725

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+L +FQ Y+R+LE+EEE+++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  360  DERCSRLEKIDQLGIFQVYLRNLEREEEDRKKIQKEELKKAERKHRDDFRGLIDEHIATG  419

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   V++   Y A+ASN+SG+TPK+LFED VE+L+ +YH  K+++K+VLK
Sbjct  420  ELTAKTSWRDYLMKVRDIPVYSAIASNSSGATPKELFEDDVEDLKRKYHALKSQIKDVLK  479

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
               +  S   +F++FK +I E IG+P I +V L+L+F+DL+ERAK+KEEKEA+K+ R ++
Sbjct  480  LRNVALSAGSTFDEFKVSISEAIGSPPIPDVKLKLVFDDLLERAKEKEEKEARKQTRHSE  539

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              ++ML +  +ITA+S+WEE K LVE S + + IG+E+  ++ FE+YV+ L+
Sbjct  540  KLMDMLRSFKDITASSTWEELKHLVEGSEKCRTIGDESFRKQTFEDYVSHLK  591



>gb|KJB63970.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=775

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +ME+H+A 
Sbjct  591  DDERCSRLEKIDRLLIFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMEEHVAD  650

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VKE   Y AVASNTSGSTPKDLFEDV EEL+ QYHE KTR+K  +
Sbjct  651  GTLTAKTYWRDYCLKVKELPQYLAVASNTSGSTPKDLFEDVAEELDKQYHEHKTRIKEAM  710

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIF  271
            K+ K+T    W+FEDFKAAI E +G+ SIS++NL+++ 
Sbjct  711  KTGKVTMVYSWTFEDFKAAISEDVGSSSISDINLKVLL  748



>ref|XP_007018439.1| Pre-mRNA-processing protein 40A isoform 4 [Theobroma cacao]
 gb|EOY15664.1| Pre-mRNA-processing protein 40A isoform 4 [Theobroma cacao]
Length=844

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +M++H+  
Sbjct  648  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMDEHVVD  707

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE QY +DKT +K+ +
Sbjct  708  GTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQYQQDKTHIKDAM  767

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            KS KI+    W+ EDFKAAI E +G+  IS++NL+L++E+L++ AK+KEEKEAKKRQRLA
Sbjct  768  KSGKISMVSTWTVEDFKAAISEDVGSLPISDINLKLVYEELLKSAKEKEEKEAKKRQRLA  827

Query  204  KDFVEML  184
             DF ++L
Sbjct  828  DDFTKLL  834



>ref|XP_002966973.1| hypothetical protein SELMODRAFT_439841 [Selaginella moellendorffii]
 gb|EFJ31572.1| hypothetical protein SELMODRAFT_439841 [Selaginella moellendorffii]
Length=809

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 180/233 (77%), Gaps = 0/233 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER SRL K+DRLEVFQEYIRDLEKEEEE++K QKEQ+RR ERKNRD FR+++E H AA
Sbjct  421  DDERWSRLDKMDRLEVFQEYIRDLEKEEEEEKKMQKEQIRRKERKNRDEFRSLLEFHKAA  480

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A+  WRDY   +KE  AYQA+ +N SGSTPK+LF DV+EEL+  Y EDK ++K+++
Sbjct  481  GILVARCPWRDYLAKIKEHPAYQAICTNLSGSTPKELFMDVLEELDKLYLEDKAKIKDIM  540

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KIT  P  +++DFKAA+ E     +ISE++++L FED +ER K+KEEKEAKKR+RLA
Sbjct  541  KVGKITVVPTTTYDDFKAALAEAGDLTAISELHIKLAFEDALERLKEKEEKEAKKRRRLA  600

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L +   ITA S+WEE K L++++ E++AI +E  LR++F+E+V  LQ
Sbjct  601  EEFSTLLRSNKTITATSNWEESKPLLQETVEFRAIDDEVVLRKLFDEHVAHLQ  653



>ref|XP_006299213.1| hypothetical protein CARUB_v10015361mg [Capsella rubella]
 gb|EOA32111.1| hypothetical protein CARUB_v10015361mg [Capsella rubella]
Length=987

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 177/232 (76%), Gaps = 0/232 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCS L KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  613  DERCSCLEKIDQLEIFQEYLRDLEREEEERQKIQKEELKKAERKHRDEFRGLIDEHIATG  672

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   V++   Y A+ SN+SG+TPKDLFED +E+L+ +YH+ K+++K+VLK
Sbjct  673  ELTAKTSWRDYLMKVRDLPVYSAITSNSSGATPKDLFEDALEDLKRKYHDLKSQIKDVLK  732

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T     +F++FK +I E I   SIS+V L+++F+DL+ER K+KEEKEA+K+ R  +
Sbjct  733  FRKVTLYGGSTFDEFKVSISEDISVSSISDVKLKVVFDDLLERVKEKEEKEARKQTRQTE  792

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ML    +ITA+SSWEE K LVE S   + IG+E+  +  FE+YV+ L+
Sbjct  793  KLVDMLRFFKDITASSSWEESKHLVEGSERCRTIGDESFRKHTFEDYVSHLK  844



>ref|XP_010691544.1| PREDICTED: pre-mRNA-processing protein 40A-like [Beta vulgaris 
subsp. vulgaris]
Length=1004

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 172/231 (74%), Gaps = 0/231 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            D+RCSRL  +D+L++FQEY+ DLEK+EEEQ++ QKE++R++ER+NRD FR +ME H+  G
Sbjct  622  DQRCSRLDTMDQLKIFQEYVGDLEKDEEEQKRIQKEEIRKSERRNRDEFRKLMEGHVFDG  681

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
            T+TAKT WRDY   +K+   Y AV+SN+SGSTPK+LFEDV EEL+ QY +D+ R+K+ +K
Sbjct  682  TLTAKTHWRDYHSKIKDLPVYLAVSSNSSGSTPKELFEDVAEELKKQYEDDRIRIKDAVK  741

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
            S K+  S  W+ EDFK A    I +P++ E NL+L+FE+L+ER ++KEEKE+K+R+RL  
Sbjct  742  SGKVFLSSTWTLEDFKTATEIEISSPAVPENNLKLVFEELLERVREKEEKESKRRKRLGD  801

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
            +F  ML +  +IT  S WE+     E   E+++IG+E   R+IFEEY+ +L
Sbjct  802  EFFNMLCSLKDITVDSMWEDSLPSFEAREEFRSIGDEAVSRQIFEEYIDQL  852



>ref|XP_011092488.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Sesamum 
indicum]
Length=1049

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 168/232 (72%), Gaps = 20/232 (9%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KI+RLE+FQEYIRDLE EEEEQRK + E+ R+AERKNRD FR +ME+H+A G
Sbjct  678  DERCSRLEKIERLEIFQEYIRDLEMEEEEQRKLRMEEQRKAERKNRDEFRKLMEEHVAGG  737

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA + WRDYC  VK++ AY AV+SNTSGST KDLF+DV+++LE Q             
Sbjct  738  ILTANSHWRDYCMKVKDAPAYLAVSSNTSGSTAKDLFDDVIDDLEKQ-------------  784

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
               I+ S  W+FEDFK A+ + I    IS++NL+LIFE+L+E  K+K EKEAKKR+RLA+
Sbjct  785  ---ISLSMNWTFEDFKGALPKEISPKPISDINLKLIFEELLEITKEKGEKEAKKRKRLAE  841

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            D  E L  + EIT++S WE+CK LVE+    + IGEE+  REIF++ +  L+
Sbjct  842  DIYEFLFTSKEITSSSKWEDCKPLVEE----RFIGEESFFREIFDKVIIELK  889



>gb|EYU39080.1| hypothetical protein MIMGU_mgv1a000980mg [Erythranthe guttata]
Length=923

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 168/230 (73%), Gaps = 4/230 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERC RL KIDRLE+FQEYIRDLEKEEEE RK + E+ R+AERKNRD FR +ME+H+A 
Sbjct  580  DDERCLRLEKIDRLEIFQEYIRDLEKEEEELRKLRMEEQRKAERKNRDEFRKLMEEHVAT  639

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TA T WR+YC  VK++ AY AV SNT+GST KDLF+DVV++LE QY ED+  ++  +
Sbjct  640  GALTANTHWREYCMKVKDAPAYLAVCSNTTGSTAKDLFQDVVDDLEKQYSEDREHIEAAM  699

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K+EKI  S  W+ EDFK A+ + + + S+S++NL+L+F+DL++  K+KEEKEAKK +RL 
Sbjct  700  KAEKIFLSSSWTIEDFKGALSKELKSKSVSDINLKLVFDDLIKTEKEKEEKEAKKLKRLT  759

Query  204  KDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVT  55
            +D  + L  + +I+ +S WE+ K LVE     +   EE+   EIF + + 
Sbjct  760  EDVYKFLFVSKDISPSSKWEDFKSLVEK----RFTAEESFFLEIFNKVIN  805



>emb|CDO97301.1| unnamed protein product [Coffea canephora]
Length=871

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KIDRLE+FQEYIRDLEKEEEEQ K ++E+ R+AERKNRD FR +ME+H+AAG
Sbjct  659  DERCSRLEKIDRLEIFQEYIRDLEKEEEEQLKLRREEQRKAERKNRDEFRKLMEEHVAAG  718

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKTLWRDYC  VK+S AY AV+SN+SGST K+LF+DV EEL  +Y +DK ++++ + 
Sbjct  719  ILTAKTLWRDYCIQVKDSPAYLAVSSNSSGSTAKELFDDVSEELVKKYLDDKAQIRDAVD  778

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              +I+ +   + +DFKAAI + +G+P +S+VNL+L+F++L+ERA++KEEKEAK+R+RLA 
Sbjct  779  IREISLTSSSTLDDFKAAIAKDVGSP-VSDVNLKLVFDELLERAREKEEKEAKRRKRLAD  837

Query  201  DFVEMLSNADEITAASSWEECKELVE  124
            D  + L  + EI+ +S WE+ K+L+E
Sbjct  838  DLYQFLHGSKEISISSRWEDWKQLIE  863



>dbj|BAB02553.1| formin binding protein-like [Arabidopsis thaliana]
Length=844

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++ ERK+RD F  ++++HIA G
Sbjct  428  DERCSRLEKIDQLEIFQEYLRDLEREEEEKKKIQKEELKKVERKHRDEFHGLLDEHIATG  487

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT+WRDY   VK+   Y A+ASN+SG+TPKDLFED VE+L+ + HE K+++K+VLK
Sbjct  488  ELTAKTIWRDYLMKVKDLPVYSAIASNSSGATPKDLFEDAVEDLKKRDHELKSQIKDVLK  547

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S   +F++FK +I E IG P I +V L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  548  LRKVNLSAGSTFDEFKVSISEDIGFPLIPDVRLKLVFDDLLERAKEKEEKEARKQTRQTE  607

Query  201  DFVEMLSNADEITAASSWEECKELVEDS  118
              V+ML +  +ITA+SSWEE K LVE S
Sbjct  608  KLVDMLRSFKDITASSSWEELKHLVEGS  635



>gb|EPS71108.1| hypothetical protein M569_03648, partial [Genlisea aurea]
Length=667

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 165/225 (73%), Gaps = 4/225 (2%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL K++R+E+FQEYIRDLE EEEEQRK + +++R+AER+NRD FR +ME+HIA+G
Sbjct  416  DERCSRLQKMERVEIFQEYIRDLELEEEEQRKLRMDEIRKAERRNRDEFRKLMEEHIASG  475

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             ++  + WRDY   VK+S AY +V+ NTSG T KDLFEDV+++LE QY EDK  ++  ++
Sbjct  476  IISVDSHWRDYAMKVKDSPAYNSVSLNTSGPTAKDLFEDVIDDLEKQYMEDKASIEEGMR  535

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
            + KI+ S  WS EDFK A+ E +    I++ NL+LIF +L+E  K+KEEKE K+R+RLA+
Sbjct  536  NHKISLSTSWSLEDFKHALSEHMSLKQIADSNLKLIFHELLEMKKEKEEKEVKRRKRLAE  595

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFE  67
            D  E L N  E+T +S WEEC+  VE+    + IGEE    EIFE
Sbjct  596  DVYEFLYNLKELTCSSKWEECRPYVEE----RFIGEEYFFLEIFE  636



>ref|XP_009145760.1| PREDICTED: pre-mRNA-processing protein 40B isoform X2 [Brassica 
rapa]
Length=824

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+LE+FQEY+RDLE+EEEE++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  617  DERCSRLEKIDQLEIFQEYLRDLEREEEERKKIQKEELKKAERKHRDEFRGLIDEHIATG  676

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAK+ WRDY   VK+   Y A+ASN+SG+TPK+LFED  E+L+ +YHE K+++K+VLK
Sbjct  677  ELTAKSSWRDYLVKVKDLPVYLAIASNSSGATPKELFEDAAEDLKRKYHELKSQIKDVLK  736

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+T S   +F++FK ++ E I +PSI +  L+L+F+DL+ERAK+KEEKEA+K+ R  +
Sbjct  737  LRKVTLSTESTFDEFKVSVSEGISSPSIPDFKLKLVFDDLLERAKEKEEKEARKQTRNTE  796

Query  201  DFVEMLSNADEITAASSWEECKELVE  124
              V+ML +   ITA+SSWE+ K LVE
Sbjct  797  KLVDMLRSFKYITASSSWEDYKHLVE  822



>gb|KFK39294.1| hypothetical protein AALP_AA3G226000 [Arabis alpina]
Length=709

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 170/232 (73%), Gaps = 16/232 (7%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DERCSRL KID+L +FQ Y+R+LE+EEE+++K QKE+L++AERK+RD FR ++++HIA G
Sbjct  360  DERCSRLEKIDQLGIFQVYLRNLEREEEDRKKIQKEELKKAERKHRDDFRGLIDEHIATG  419

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TAKT WRDY   V++   Y A+ASN+SG+TPK+LFED VE+L+               
Sbjct  420  ELTAKTSWRDYLMKVRDIPVYSAIASNSSGATPKELFEDDVEDLKR--------------  465

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
              K+  S   +F++FK +I E IG+P I +V L+L+F+DL+ERAK+KEEKEA+K+ R ++
Sbjct  466  --KVALSAGSTFDEFKVSISEAIGSPPIPDVKLKLVFDDLLERAKEKEEKEARKQTRHSE  523

Query  201  DFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              ++ML +  +ITA+S+WEE K LVE S + + IG+E+  ++ FE+YV+ L+
Sbjct  524  KLMDMLRSFKDITASSTWEELKHLVEGSEKCRTIGDESFRKQTFEDYVSHLK  575



>ref|XP_002961039.1| hypothetical protein SELMODRAFT_402621 [Selaginella moellendorffii]
 gb|EFJ38578.1| hypothetical protein SELMODRAFT_402621 [Selaginella moellendorffii]
Length=799

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 170/237 (72%), Gaps = 15/237 (6%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDER SRL K+DRLEVFQEYIRDLEKEEEE++K QKEQ+RR ERKNRD FR+++E H AA
Sbjct  418  DDERWSRLDKMDRLEVFQEYIRDLEKEEEEEKKMQKEQIRRKERKNRDEFRSLLESHKAA  477

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A+  WRDY   +KE  AYQA+ +N SGSTPK+LF DV+EEL+  Y EDK ++K ++
Sbjct  478  GILVARCPWRDYLAKIKEHPAYQAICTNLSGSTPKELFMDVLEELDKLYLEDKAKIKEIM  537

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K  KIT  P  +++DFKAA+ E     +ISE++++L FED +ER K+KEEKEAKKR+RLA
Sbjct  538  KVGKITVVPTTTYDDFKAALAEAGDLTAISELHIKLAFEDALERLKEKEEKEAKKRRRLA  597

Query  204  KDFVEMLS----NADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            ++F  +L     + D +         KE V    E++AI +E  LR++F+E+V  LQ
Sbjct  598  EEFSTLLRSNKVSGDRLAG-------KETV----EFRAIDDEVVLRKLFDEHVAHLQ  643



>ref|XP_001768159.1| predicted protein [Physcomitrella patens]
 gb|EDQ67032.1| predicted protein [Physcomitrella patens]
Length=563

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 134/300 (45%), Positives = 177/300 (59%), Gaps = 71/300 (24%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL K+DRLEVFQEYIR+LEKEEEE+++ QKEQLRR ERK+RD FR +M++H AA
Sbjct  80   DDERCSRLDKLDRLEVFQEYIRELEKEEEEEKRKQKEQLRRKERKHRDEFRKLMDEHKAA  139

Query  564  GTVTAKTLWRDY-------C------------------------------------PMVK  514
            G +TAKT WRDY       C                                    P V+
Sbjct  140  GILTAKTAWRDYLMKDCLTCNLGTKFPWDALESSLGNMPIDLLTSNIPPVDAYLLDPQVE  199

Query  513  ESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFK  334
                +    SNTSG+TPK+LFEDV+EEL  QYHEDK R K+V+K+ KI+    W+F+ FK
Sbjct  200  VLSTFAETTSNTSGTTPKELFEDVIEELVKQYHEDKARAKDVMKAGKISVGATWTFDKFK  259

Query  333  AAILETIGTPSISEVNLQ----------------------------LIFEDLMerakdke  238
            AA  E     +I+E NL+                            L+FED +ERAK+KE
Sbjct  260  AAYAEAGDLAAIAEPNLKKITPGAVLCGVLATSILGSDAEQFWLQKLVFEDYVERAKEKE  319

Query  237  ekeakkrqrlaKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
            EKEAKKR+R+A DF  +L +   +T++S WE+ K L+E S EY+A+ ++   +++FEEYV
Sbjct  320  EKEAKKRRRMADDFTNLLRSTKAVTSSSKWEDVKLLIEVSQEYRALSDDGHRKKLFEEYV  379



>gb|EEC70813.1| hypothetical protein OsI_02277 [Oryza sativa Indica Group]
Length=1026

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD+    L +    E+FQEYIRDLEKEEEE ++  KEQ+RR ERKNRD FR M+E+H+A 
Sbjct  547  DDDAVPDLKRSIDWEIFQEYIRDLEKEEEEHKRIHKEQVRRQERKNRDEFRKMLEEHVAE  606

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +TAKT WRDYC  VK+S  Y AVASN SGS PKDLFEDV+EELE QY +DK R+K  +
Sbjct  607  GMLTAKTRWRDYCAQVKDSSVYLAVASNISGSMPKDLFEDVMEELEKQYQDDKARIKEAV  666

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFED  265
            KS KI  +  W+ EDF+ A+ E      I+ +N++LIF+D
Sbjct  667  KSGKIPMTTSWTLEDFETAVTEDDTLKGITNINMKLIFDD  706



>ref|XP_007018441.1| Pre-mRNA-processing protein 40A isoform 6 [Theobroma cacao]
 gb|EOY15666.1| Pre-mRNA-processing protein 40A isoform 6 [Theobroma cacao]
Length=774

 Score =   152 bits (384),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +M++H+  
Sbjct  648  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMDEHVVD  707

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE QY +DKT +K+ +
Sbjct  708  GTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQYQQDKTHIKDAM  767

Query  384  KSEKITF  364
            KS K+ +
Sbjct  768  KSGKVRY  774



>ref|XP_008338016.1| PREDICTED: pre-mRNA-processing protein 40A-like, partial [Malus 
domestica]
Length=102

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -2

Query  585  MEDHIAAGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDK  406
            ME+H+A GT+TAKTLWRDYC  VK+   Y+AVA NTSGSTPK+LF+DV EELE QYH+DK
Sbjct  1    MEEHVADGTLTAKTLWRDYCMKVKDLPPYEAVALNTSGSTPKELFDDVFEELEKQYHDDK  60

Query  405  TRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQ  280
             R+K+ +KS K+T +   +FE+FK  ILE IG+P IS++N +
Sbjct  61   ARIKDAMKSGKVTMASTLAFEEFKVPILEDIGSPPISDINFK  102



>ref|XP_007018442.1| Pre-mRNA-processing protein 40A isoform 7 [Theobroma cacao]
 gb|EOY15667.1| Pre-mRNA-processing protein 40A isoform 7 [Theobroma cacao]
Length=787

 Score =   133 bits (335),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DDERCSRL KIDRL +FQ+YI DLEKEEEE++K QKEQLRRAERKNRDAFR +M++H+  
Sbjct  639  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKEQLRRAERKNRDAFRKLMDEHVVD  698

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQ  421
            GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE Q
Sbjct  699  GTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQ  746



>gb|AAF78276.1|AC020576_20 Contains similarity to formin binding protein 11 from Mus musculus 
gb|AF135439 and contains multiple FF PF|01846 and WW PF|00397 
domains. EST gb|AI997587 comes from this gene [Arabidopsis 
thaliana]
Length=919

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 111/158 (70%), Gaps = 16/158 (10%)
 Frame = -2

Query  519  VKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFED  340
            +K+   YQAVASNTSGSTPKDLFEDV EELE Q                I+    W FED
Sbjct  623  LKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQ----------------ISMVSSWLFED  666

Query  339  FKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEMLSNADEITA  160
            FK+AI E + T  IS++NL+LI++DL+ R K+KEEKEA+K QRLA++F  +L    EIT 
Sbjct  667  FKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLAEEFTNLLHTFKEITV  726

Query  159  ASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            AS+WE+ K+LVE+S EY++IG+E+  + +FEEY+T LQ
Sbjct  727  ASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ  764



>ref|XP_007018443.1| Pre-mRNA-processing protein 40A isoform 8 [Theobroma cacao]
 gb|EOY15668.1| Pre-mRNA-processing protein 40A isoform 8 [Theobroma cacao]
Length=789

 Score =   129 bits (323),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRD--lekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHI  571
            DDERCSRL KIDRL +FQ+YI D   E+EE+++ +  +EQLRRAERKNRDAFR +M++H+
Sbjct  639  DDERCSRLEKIDRLVMFQDYIHDLEKEEEEKKKMQKVEEQLRRAERKNRDAFRKLMDEHV  698

Query  570  AAGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQ  421
              GT+TAKT WRDYC  VK+   Y AVASNTSGSTPKDLFEDVVEELE Q
Sbjct  699  VDGTLTAKTYWRDYCLKVKDLPPYLAVASNTSGSTPKDLFEDVVEELEKQ  748



>ref|XP_005647286.1| hypothetical protein COCSUDRAFT_47676 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22742.1| hypothetical protein COCSUDRAFT_47676 [Coccomyxa subellipsoidea 
C-169]
Length=716

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 148/226 (65%), Gaps = 3/226 (1%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            L K+DRLEVFQ+YI  LE++E+E ++ +KE+ RR ERKNRDAF+++++ H++ G + A  
Sbjct  368  LDKLDRLEVFQDYILHLERKEKEAKEKEKEERRRRERKNRDAFKDLLQRHLSEGVLVAHM  427

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
             W+DY P+VK+  ++ AV  N +GS+ K+LFED +E  + Q+ +DK  +K V K  +I  
Sbjct  428  RWKDYQPLVKKEESWIAVEKNLTGSSAKELFEDALEVADAQFDKDKALLKEVTK--EIPV  485

Query  363  SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEML  184
             P  +F+ F AA+       ++ + N +L+F++L+ + K++  KE K+R+R   DF+++L
Sbjct  486  QPDSTFDHFNAALEAVDSVKNVIKPNRKLVFDELLAKVKERAAKEEKRRKRARDDFIDLL  545

Query  183  SNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
             ++  +T  SSWE+ +  +E + EYKAI +E    + F EY   L+
Sbjct  546  RDSRAMTVDSSWEDIRPSLESAPEYKAISKEER-EQAFNEYRAYLK  590



>ref|XP_005845731.1| hypothetical protein CHLNCDRAFT_136322 [Chlorella variabilis]
 gb|EFN53629.1| hypothetical protein CHLNCDRAFT_136322 [Chlorella variabilis]
Length=751

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 123/212 (58%), Gaps = 4/212 (2%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            L K+DRLEVF+EYIR+LE+   E+R+ +KE+ RR ER  RDAFR ++  H   G + A T
Sbjct  436  LDKLDRLEVFEEYIRELERVHREEREKEKEERRRQERLARDAFRALLAKHREEGIINALT  495

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
             W++Y P+V E  +Y+AV  N SGS PK+LF DV+EE+E +Y + +  VK   K   +  
Sbjct  496  RWKEYVPIVSEEESYKAVERNASGSRPKELFLDVLEEMEAEYGKQREAVKAAAKELGLEV  555

Query  363  SPLWSFEDFKAAILETIG----TPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDF  196
                  E F+ A+    G       +++  ++L  ++L+ RAK++  K  KK +R  +DF
Sbjct  556  GADSQLEAFREALAPQRGEGGTLAGVTDATIKLYHDELVGRAKEEAYKAEKKLRRAREDF  615

Query  195  VEMLSNADEITAASSWEECKELVEDSSEYKAI  100
              ML +   I   ++WE   EL     E++A+
Sbjct  616  AYMLKHMRGIKHDTTWEAAAELCGGEPEWRAL  647



>ref|XP_004334590.1| hypothetical protein ACA1_309660 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR12577.1| hypothetical protein ACA1_309660 [Acanthamoeba castellanii str. 
Neff]
Length=632

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 133/235 (57%), Gaps = 6/235 (3%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            DD R S L K+DRL +F+  IRDLE+ E E+++  +E  RR  RKNRD FR ++ +   A
Sbjct  297  DDPRYSALDKLDRLALFEHRIRDLERVEAEEKRKSRETQRRQYRKNRDTFRALLREAYDA  356

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G +   + W+ +   +KE   Y+ +     GSTP +L+ D VE+L+ +Y E K  +  + 
Sbjct  357  GKLDRNSKWKRFKRTIKEDPRYEDLIGQ-PGSTPSELYGDFVEDLQERYEETKRIIDRIT  415

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            K   IT +   + + F AAI      P++ + +   IF ++       + +E +++++  
Sbjct  416  KEGNITITSWMAEDQFLAAISTHPSYPNLDQPSASKIFAEM---RDQVDRREKREKRKRE  472

Query  204  KDFVEML-SNADEITAASSWEEC-KELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            K+F  ML S+ D+ITAAS +++  +EL+ + + YKAI  E   + +FE YV  L+
Sbjct  473  KNFTLMLKSHKDKITAASVYDDAVRELLAEEASYKAIPAEEERKALFESYVDHLK  527



>ref|XP_011396721.1| Pre-mRNA-processing factor 40-like protein A [Auxenochlorella 
protothecoides]
 gb|KFM23843.1| Pre-mRNA-processing factor 40-like protein A [Auxenochlorella 
protothecoides]
Length=1242

 Score = 96.7 bits (239),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 79/269 (29%), Positives = 129/269 (48%), Gaps = 48/269 (18%)
 Frame = -2

Query  708  RLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKTLWRDY  529
            RLEVF+E + ++EK E+E     +E+L R+ER NR AFR ++ D  A G V A++ WR+ 
Sbjct  283  RLEVFREVMEEVEKREKEAAARAREELVRSERANRAAFRELLADLRARGAVHARSRWREA  342

Query  528  CPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITFSPLWS  349
              +V+   AY AV  NT+GS P++LFED++E++E  Y ED+  +K V+    +       
Sbjct  343  LALVEAEPAYLAVERNTTGSRPRELFEDLLEDMEKAYLEDRAEIKAVVAERGLVVDIDSK  402

Query  348  FEDFKAAI-----------------------------------------LETIGT-----  307
             EDF AA+                                          + +G      
Sbjct  403  LEDFLAALGRAAPAEAAPAGKDGAAADGMDRGDGEGKDVSAGEVTVAQGAQALGAGAEPA  462

Query  306  --PSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEMLSNADEITAASSWEECKE  133
               SI   +LQL F +    A+D+  K  K+ +   +DF  +L +   I A + WE+  +
Sbjct  463  LPDSIPTQSLQLYFVEQQGLARDEIAKREKEHRYQREDFSRLLRHERRIEAETPWEDAVQ  522

Query  132  LVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            L+E   E+K +      RE+F+ ++ +L+
Sbjct  523  LLEKEPEWKELESLEEKRELFDAFIAKLK  551



>ref|XP_002950379.1| hypothetical protein VOLCADRAFT_104642 [Volvox carteri f. nagariensis]
 gb|EFJ48580.1| hypothetical protein VOLCADRAFT_104642 [Volvox carteri f. nagariensis]
Length=951

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            L K++RLEVFQE+++DLE+ E+E+++ +KE+ +R ER+ RDAF++++  H   G ++ ++
Sbjct  665  LDKVERLEVFQEFVKDLERREKEEKEREKEERKRQERRARDAFKDLLRRHRDEGLISVRS  724

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
             W++Y   V    AY+AV +NTSGS PK+LFED++EE+E +Y + K  +K +LK    T 
Sbjct  725  RWKEYSEQVVSEEAYRAVEANTSGSRPKELFEDLIEEMEQEYEKAKDTLKVLLKDGGFTV  784

Query  363  SPLWSFEDF  337
            +P  S+E F
Sbjct  785  TPTTSYEQF  793



>ref|XP_003713617.1| pre-mRNA-processing protein prp40 [Magnaporthe oryzae 70-15]
 gb|EHA53810.1| pre-mRNA-processing protein prp40 [Magnaporthe oryzae 70-15]
Length=901

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 127/237 (54%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L VFQ +I+ LE+   + R+ QK +  R ERK RDAF  ++ +   AG
Sbjct  370  DEKYKSLTKFDILTVFQNHIKALERSFNDSRQEQKTKKYRQERKTRDAFSALLTELRQAG  429

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P ++    YQA+    SGST +D+F D++EE E      +  V++V+ 
Sbjct  430  KIKASTKWSQIFPQIENDERYQAILGQ-SGSTAQDMFFDIIEEEERALRSTRNDVEDVID  488

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   SP  +F+ F A + E   T ++ +  L LIFE L+E+ K+K   E ++ +R  +
Sbjct  489  DKRFEVSPKTTFDSFLAVMKEDRRTANLDQELLSLIFERLLEKRKEKRTDEERQAERKER  548

Query  201  DFVE-----MLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +E     M      I+   ++E+ K  ++ S E++A+  E   R  FE+Y+ RL+
Sbjct  549  RAIEDLRAYMKRVDPPISVNDTYEKVKPRLQKSDEFQAVQSEDARRGAFEKYLRRLR  605



>gb|ELQ37082.1| pre-mRNA-processing protein prp40 [Magnaporthe oryzae Y34]
 gb|ELQ59453.1| pre-mRNA-processing protein prp40 [Magnaporthe oryzae P131]
Length=943

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 127/237 (54%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L VFQ +I+ LE+   + R+ QK +  R ERK RDAF  ++ +   AG
Sbjct  370  DEKYKSLTKFDILTVFQNHIKALERSFNDSRQEQKTKKYRQERKTRDAFSALLTELRQAG  429

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P ++    YQA+    SGST +D+F D++EE E      +  V++V+ 
Sbjct  430  KIKASTKWSQIFPQIENDERYQAILGQ-SGSTAQDMFFDIIEEEERALRSTRNDVEDVID  488

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   SP  +F+ F A + E   T ++ +  L LIFE L+E+ K+K   E ++ +R  +
Sbjct  489  DKRFEVSPKTTFDSFLAVMKEDRRTANLDQELLSLIFERLLEKRKEKRTDEERQAERKER  548

Query  201  DFVE-----MLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +E     M      I+   ++E+ K  ++ S E++A+  E   R  FE+Y+ RL+
Sbjct  549  RAIEDLRAYMKRVDPPISVNDTYEKVKPRLQKSDEFQAVQSEDARRGAFEKYLRRLR  605



>ref|XP_003294183.1| hypothetical protein DICPUDRAFT_159144 [Dictyostelium purpureum]
 gb|EGC29285.1| hypothetical protein DICPUDRAFT_159144 [Dictyostelium purpureum]
Length=591

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 117/225 (52%), Gaps = 4/225 (2%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            L + D L VF+ YIRDLEK  ++Q++ +KE+++R  RKNRD FR  + +    G + A T
Sbjct  297  LDQFDFLTVFESYIRDLEKRLDDQKRVEKEKIKRECRKNRDMFREFLNEKYLGGEIHALT  356

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
             W+++    +   AY  ++  T GSTP +LF D  EELE +Y  D  ++K + K  +  +
Sbjct  357  KWKNFKEKYENEPAYIGLSQRTLGSTPLELFSDFREELETKYENDYKKLKEIYKETEFKY  416

Query  363  SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEML  184
            +P  + E  K A  +      ISE N     E L      +E KE    ++    F ++L
Sbjct  417  TPETTVELLKTAFSKHQNFKQISEFNFLPYLEYL---KYKEETKEKNLAKKRVSHFKQLL  473

Query  183  SNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRL  49
            S+   I+ +S+W+E K  +E   E+  + E   L  IF  Y+  L
Sbjct  474  SDTKTISKSSTWDEVKPTLETKKEFIELEEPDRLN-IFNSYIEYL  517



>ref|XP_008728394.1| hypothetical protein G647_05846 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21777.1| hypothetical protein G647_05846 [Cladophialophora carrionii CBS 
160.54]
Length=764

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 121/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  318  DEKFKLLSKSDVLTAFENHIKSLERTFNDARQQQKATKARRERQNRDRFMELLQSLRSQG  377

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA T W    P ++E   Y AV    +GSTP DLF D+VEE E      +  V +VL+
Sbjct  378  KITAGTKWMTILPQIEEDPRYVAVLGQ-AGSTPLDLFWDLVEEEERALRGRRNDVYDVLE  436

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T  I+   LQLIF+ L ++   + E E     R  +
Sbjct  437  DKRFEVTPRTSFDEFLDIMLTDRRTAPINRDVLQLIFQRLHDKVVRRSEDEKHAADRHQR  496

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  VE + EY+AI +E   +  +E+ + RL+
Sbjct  497  RAVDALRSRIKHLEPPVRITDSWEDVKPRVEKTDEYRAIEDEELRKSAYEKVIKRLK  553



>ref|XP_007758887.1| hypothetical protein A1O7_06696 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ59264.1| hypothetical protein A1O7_06696 [Cladophialophora yegresii CBS 
114405]
Length=764

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 121/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  318  DEKFKLLSKSDVLTAFENHIKSLERTFNDARQQQKATKARRERQNRDRFMELLQSLRSQG  377

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA T W    P ++E   Y AV    +GSTP DLF D+VEE E      +  V +VL+
Sbjct  378  KITAGTKWMTILPEIEEDPRYVAVLGQ-AGSTPLDLFWDLVEEEERALRGRRNDVYDVLE  436

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T  I+   LQLIF+ L ++   + E E     R  +
Sbjct  437  DKRYEVTPRTSFDEFLDIMLTDRRTAPINRDVLQLIFQRLHDKVVRRSEDEKHAADRHQR  496

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  VE + EY+A+ +E   +  FE+ + RL+
Sbjct  497  RAVDALRSRIKHLEPPVRMTDSWEDVKPRVEKTDEYRAVEDEGLRKSAFEKVIKRLK  553



>ref|XP_007797302.1| putative pre-mrna-processing protein prp40 protein [Eutypa lata 
UCREL1]
 gb|EMR63612.1| putative pre-mrna-processing protein prp40 protein [Eutypa lata 
UCREL1]
Length=838

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/237 (30%), Positives = 124/237 (52%), Gaps = 5/237 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            ++E+   L   D L  FQ +I+ LE+   E R+ QK +  R ERKNRD F ++++D   A
Sbjct  324  NEEKYKTLTSFDILTAFQNHIKALERSFNETRQRQKNKKLRIERKNRDGFVDLLQDLRKA  383

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            GT+ A T W+   P+++    ++A+     GSTP DLF DVVEE E      +  + +V+
Sbjct  384  GTIKAGTKWKQILPLIENDERFKAICGQ-GGSTPLDLFWDVVEEEERALRGTRNDILDVM  442

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
               +  F+P  +F++F  A+     T +I    L LIFE L ER   + +++    ++  
Sbjct  443  DDNRFEFTPKTTFDEFSTALKNDRRTANIDRDILTLIFERLQERKSKRSDEDKHTERQQR  502

Query  204  KDFVEMLSNADE----ITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +   E+ S+       + A  +WE+ +  +  + E++A+  E   R  FE+ + R++
Sbjct  503  RAIDELRSHIKHLEPPLQADDTWEKIRPRLVRAPEFQAVNSEEARRGAFEKVLRRVK  559



>ref|XP_002848304.1| pre-mRNA-processing protein prp40 [Arthroderma otae CBS 113480]
 gb|EEQ30991.1| pre-mRNA-processing protein prp40 [Arthroderma otae CBS 113480]
Length=792

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 123/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++ D  + G
Sbjct  338  DEKFKALTKSDILTAFENHIKSLERVFNDLRQQQKANKVRRERQARDAFISLLRDLRSQG  397

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P+++E   Y A+    SGSTP DLF D+VEE E      +  V +VL 
Sbjct  398  KIKAGSKWANLYPLIEEDPRYTAMLGQ-SGSTPLDLFWDMVEEEERAIRGPRNDVLDVLD  456

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FKA +     T +I +  L+LIF+ L E+   + E E     R  +
Sbjct  457  DKRFETTLKTTFDEFKAVMRTDRRTATIDQETLRLIFDRLQEKVLRRTEDEKHAANRQQR  516

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  SWE+ K  +E   EY+A+  E   R  F++ V RL+
Sbjct  517  RAIDLLRSRIKHLEPPVLATDSWEDVKPRIEKMEEYRAVDSEDARRSAFDKVVRRLK  573



>gb|ERS98440.1| hypothetical protein HMPREF1624_05224 [Sporothrix schenckii ATCC 
58251]
Length=884

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 122/230 (53%), Gaps = 1/230 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +DE+   L K D L VFQ +++ LE+   + R+ +K    R ERKNR+AF  ++ D    
Sbjct  344  NDEKYQSLSKFDVLTVFQNHMKALERTFNDARQQEKTAKLRRERKNREAFAALLGDLARD  403

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A + W    P+V+    Y A+   ++GSTP++LF D+V+E +      +  V++V+
Sbjct  404  GKIKASSKWSQIFPLVQHDPRYLALVGQSAGSTPQELFWDLVDEEQRALRGTRNDVEDVI  463

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              +    +P  +F+ F   + +   T +I    L LIFE L ER K+K   + + ++R  
Sbjct  464  DDKHFEVTPKTTFDSFLDVMKDDRRTANIDREVLALIFERLQERRKEKRSDDDRLQRRAL  523

Query  204  KDFVEMLSNAD-EITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
             DF  +L   D  +TA  ++++ K  ++ S EY A+  +      F++YV
Sbjct  524  DDFRALLKRVDPPLTATDTYDKVKPRLQKSEEYLAVSSDEAREAAFDKYV  573



>gb|EZF35286.1| hypothetical protein H101_01197 [Trichophyton interdigitale H6]
 gb|KDB25363.1| hypothetical protein H109_02828 [Trichophyton interdigitale MR816]
Length=788

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 124/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  336  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFVSLLQELRSQG  395

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P+++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  396  KIKAGSKWMNIYPLIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  454

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK+ +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  455  DKRFETTLKTTFDEFKSVMRTDRRTATIDQDTLQLIFDRLQEKLLRRTEDEKHAANRQQR  514

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        I A  +WE+ K  +E   EY+A+  E   R  FE+ V RL+
Sbjct  515  RAIDLLRSRIKHLEPPIQANDTWEDVKPRIEKMEEYRAVESEDARRSAFEKAVRRLK  571



>ref|XP_003021969.1| hypothetical protein TRV_03917 [Trichophyton verrucosum HKI 0517]
 gb|EFE41351.1| hypothetical protein TRV_03917 [Trichophyton verrucosum HKI 0517]
Length=767

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 124/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  315  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFISLLQELRSQG  374

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P+++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  375  KIKAGSKWMNIYPLIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  433

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK+ +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  434  DKRFETTLKTTFDEFKSVMRTDRRTATIDQDTLQLIFDRLQEKLLRRTEDEKHAANRQQR  493

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  +WE+ K  +E   EY+A+  E   R  FE+ V RL+
Sbjct  494  RAIDLLRSRIKHLEPPVQANDTWEDVKPRIEKMEEYRAVESEDARRSAFEKVVRRLK  550



>gb|EGE00238.1| formin binding protein [Trichophyton tonsurans CBS 112818]
 gb|EGE04857.1| formin binding protein [Trichophyton equinum CBS 127.97]
Length=780

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 124/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  336  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFVSLLQELRSQG  395

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P+++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  396  KIKAGSKWMNIYPLIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  454

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK+ +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  455  DKRFETTLKTTFDEFKSVMRTDRRTATIDQDTLQLIFDRLQEKLLRRTEDEKHAANRQQR  514

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  +WE+ K  +E   EY+A+  E   R  FE+ V RL+
Sbjct  515  RAIDLLRSRIKHLEPPVQANDTWEDVKPRIEKMEEYRAVESEDARRSAFEKVVRRLK  571



>ref|XP_003010493.1| hypothetical protein ARB_03194 [Arthroderma benhamiae CBS 112371]
 gb|EFE29853.1| hypothetical protein ARB_03194 [Arthroderma benhamiae CBS 112371]
Length=794

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 124/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  342  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFISLLQELRSQG  401

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P+++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  402  KIKAGSKWMNIYPLIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  460

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK+ +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  461  DKRFETTLKTTFDEFKSVMRTDRRTATIDQDTLQLIFDRLQEKLLRRTEDEKHAANRQQR  520

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  +WE+ K  +E   EY+A+  E   R  FE+ V RL+
Sbjct  521  RAIDLLRSRIKHLEPPVQANDTWEDVKPRIEKMEEYRAVESEDARRSAFEKVVRRLK  577



>ref|XP_009649389.1| pre-mRNA-processing protein prp40 [Verticillium dahliae VdLs.17]
 gb|EGY18443.1| pre-mRNA-processing protein prp40 [Verticillium dahliae VdLs.17]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/237 (29%), Positives = 125/237 (53%), Gaps = 5/237 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +DER   L + D L  FQ +++ LE+   + ++ QK Q  R ERK RDAF +++ +    
Sbjct  353  NDERYKTLSQFDVLTAFQNHMKALERTFNDSKQEQKNQKFRRERKARDAFLDLLNELRRQ  412

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A T W+ + P+++    Y+A+A    GSTP++LF D+VEE E      +  V +VL
Sbjct  413  GKINAATKWQKFHPLIENEERYRAMAGQ-PGSTPQELFWDIVEEEERALRGPRVDVLDVL  471

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              E+   +P  +F++F A + +   T +I+   L ++FE L ER   + E +    ++  
Sbjct  472  DDERFEVTPKTTFDEFLAVVKKNRRTANINNDTLTILFERLQERRSKRPEDDKHSERQQR  531

Query  204  KDFVEMLSNADE----ITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +   ++ ++       I    +WE+ +  + DS  ++A+  E      F+++V RL+
Sbjct  532  RAVDDLRTHMKRVEPPIAVGDTWEKVRPRLADSPAFQAVASEEARVGAFDKFVRRLR  588



>gb|EZF23484.1| hypothetical protein H100_03934 [Trichophyton rubrum MR850]
 gb|EZF42441.1| hypothetical protein H102_03921 [Trichophyton rubrum CBS 100081]
 gb|EZF53259.1| hypothetical protein H103_03936 [Trichophyton rubrum CBS 288.86]
 gb|EZF63643.1| hypothetical protein H104_03921 [Trichophyton rubrum CBS 289.86]
 gb|EZF74247.1| hypothetical protein H105_03949 [Trichophyton soudanense CBS 
452.61]
 gb|EZF84996.1| hypothetical protein H110_03928 [Trichophyton rubrum MR1448]
 gb|EZF95747.1| hypothetical protein H113_03959 [Trichophyton rubrum MR1459]
 gb|EZG06795.1| hypothetical protein H106_03745 [Trichophyton rubrum CBS 735.88]
 gb|EZG17355.1| hypothetical protein H107_04046 [Trichophyton rubrum CBS 202.88]
 gb|KDB34199.1| hypothetical protein H112_03926 [Trichophyton rubrum D6]
 gb|EGD89009.2| hypothetical protein TERG_05255 [Trichophyton rubrum CBS 118892]
Length=618

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 123/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  166  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFISLLQELRSQG  225

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P ++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  226  KIKAGSKWMNIYPFIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  284

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK+ +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  285  DKRFETTLKTTFDEFKSVMRTDRRTATIDQDTLQLIFDRLQEKLLRRTEDEKHAANRQQR  344

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  +WE+ K  +E   EY+A+  E   R  FE+ V RL+
Sbjct  345  RAIDLLRSRIKHLEPPVQANDTWEDVKPRIEKMEEYRAVESEDARRSAFEKVVRRLK  401



>ref|XP_007737848.1| hypothetical protein A1O3_09564 [Capronia epimyces CBS 606.96]
 gb|EXJ77338.1| hypothetical protein A1O3_09564 [Capronia epimyces CBS 606.96]
Length=793

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 119/237 (50%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            D++   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F+ ++++    G
Sbjct  334  DDKFKLLSKSDILTAFENHIKSLERTFNDARQQQKATKLRRERRNRDKFQELLQELRTQG  393

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P ++E   Y A+    SGSTP DLF D++EE E      +  V +VL+
Sbjct  394  KIKAGTKWMTILPDIEEDPRYVAMLGQ-SGSTPLDLFWDMIEEEERALRGRRNAVYDVLE  452

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF+DF   +L    T +I    LQLIF+ L ++   + E E     R  +
Sbjct  453  DKRYEVTPKTSFDDFFDVMLTDRRTANIDRDALQLIFQRLHDKVLRRSEDEKHAADRHQR  512

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    +WE+ K  VE + EY AI  E   R  F++ + RL+
Sbjct  513  RAVDALRSRIKHLEPSVRLTDTWEDVKPRVEKTEEYHAIEREDLRRSAFDKVIKRLK  569



>ref|XP_003175896.1| pre-mRNA-processing protein prp40 [Microsporum gypseum CBS 118893]
 gb|EFR00414.1| pre-mRNA-processing protein prp40 [Microsporum gypseum CBS 118893]
Length=803

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 123/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  347  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFISLLQELRSQG  406

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P+++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  407  KIKAGSKWMNLYPLIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  465

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK  +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  466  DKRFETTLKTTFDEFKTVMRTDRRTATIDQDTLQLIFDRLQEKVLRRTEDEKHAANRQQR  525

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  SWE+ K  +E   EY+A+  E   R  F++ V RL+
Sbjct  526  RAIDLLRSRIKHLEPAVQANDSWEDVKPRIEKMEEYRAVESEDARRSAFDKVVRRLK  582



>gb|KHJ46570.1| FF domain protein [Trichuris suis]
Length=643

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 122/238 (51%), Gaps = 6/238 (3%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +D     + K D L VF+E+IR LEK+E ++ +      RR ERK R+ FR  +E+    
Sbjct  356  NDTEIQSMDKEDALIVFEEHIRQLEKDERDEEQNALLMKRRQERKGREKFRQFLEELRRG  415

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A + W D  P++     Y+ +     GSTP DLF+  V +L+ Q  ED+  +K+++
Sbjct  416  GKLHAASKWCDLYPIISADHRYEDML-GLGGSTPLDLFKFYVMDLQKQMEEDRHLIKDIM  474

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekea----kkr  217
            K      S    F +F+  + + + +  I   N++  F+ L+ +A+ KE+  +    K +
Sbjct  475  KDRGFKLSSKTEFSEFEQLLKDNVKSAKIDPENIRACFDSLVAKAEAKEKSRSKDERKMK  534

Query  216  qrlaKDFVEML-SNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +     F  ML S    +   S+W+E +  +ED   +K +G E    ++FE+YV  LQ
Sbjct  535  KAAENTFTSMLRSLGRSVLPDSTWDEVRPQIEDQPAFKQVGSEEERVQLFEQYVQALQ  592



>ref|XP_003234662.1| formin binding protein [Trichophyton rubrum CBS 118892]
Length=790

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 123/237 (52%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+ RDAF +++++  + G
Sbjct  338  DEKFKALTKSDILTAFENHIKSLERVFNDVRQQQKASKTRRERQARDAFISLLQELRSQG  397

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W +  P ++E   Y A+    SGS+P DLF DVVEE E      +  V +VL 
Sbjct  398  KIKAGSKWMNIYPFIEEDPRYTAMLGQ-SGSSPLDLFWDVVEEEERAIRGPRNDVLDVLD  456

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +   +F++FK+ +     T +I +  LQLIF+ L E+   + E E     R  +
Sbjct  457  DKRFETTLKTTFDEFKSVMRTDRRTATIDQDTLQLIFDRLQEKLLRRTEDEKHAANRQQR  516

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              +++L +        + A  +WE+ K  +E   EY+A+  E   R  FE+ V RL+
Sbjct  517  RAIDLLRSRIKHLEPPVQANDTWEDVKPRIEKMEEYRAVESEDARRSAFEKVVRRLK  573



>gb|KIW99709.1| hypothetical protein Z518_11122 [Rhinocladiella mackenziei CBS 
650.93]
Length=790

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 118/237 (50%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DER   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  343  DERFKLLSKSDVLTAFENHIKSLERTFNDARQQQKASKVRRERQNRDRFMELLQGLRSQG  402

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A + W    P +++   Y A+    +GSTP DLF D+VE+ E      +  V +VL+
Sbjct  403  KIKAGSKWMSVLPEIEDDPRYVAMLGQ-AGSTPLDLFWDMVEDEERALRGRRNDVYDVLE  461

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T  I    LQLIF+ L E+   + E E     R  +
Sbjct  462  DKRYEVTPRTSFDEFFDVMLTDRRTADIDRDALQLIFQRLHEKVLRRSEDEKHAADRHQR  521

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  VE + EY A+G E   +  FE+ V RL+
Sbjct  522  RAVDALRSRIKHLEPPVRITDSWEDVKSRVEKTEEYHAVGSEELRKSAFEKVVKRLK  578



>gb|KIH87644.1| pre-mRNA-processing factor 40 [Sporothrix brasiliensis 5110]
Length=894

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 122/230 (53%), Gaps = 1/230 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +DE+   L K D L VFQ +++ LE+   + R+ +K    R ERKNR+AF  ++ D    
Sbjct  344  NDEKYQSLSKFDVLTVFQTHMKALERTFNDARQQEKTAKLRRERKNREAFAALLGDLARD  403

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A + W    P+V+    Y A+   ++GSTP++LF D+V+E +      +  V++V+
Sbjct  404  GKIKASSKWSQIFPLVQHDPRYLALVGQSAGSTPQELFWDLVDEEQRALRGTRNDVEDVI  463

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              +    +P  +F+ F   + +   T +I    L LIFE L ER K+K   + + ++R  
Sbjct  464  DDKHFEVTPKTTFDSFLDVMKDDRRTANIDREVLALIFERLQERKKEKRSDDDRLQRRAL  523

Query  204  KDFVEMLSNAD-EITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
             DF  +L   D  +TA  ++++ K  ++ S E+ A+  +      F++YV
Sbjct  524  DDFRALLKRVDPPLTATDTYDKVKPRLQKSEEFLAVSSDEAREAAFDKYV  573



>ref|XP_008721419.1| hypothetical protein HMPREF1541_08879 [Cyphellophora europaea 
CBS 101466]
 gb|ETN36601.1| hypothetical protein HMPREF1541_08879 [Cyphellophora europaea 
CBS 101466]
Length=761

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 120/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE    L K D L  F+ +I+ LE+   + R+ QK    R ER+NRDAF +++++  A G
Sbjct  315  DENFKLLSKSDVLTAFENHIKSLERTFNDARQQQKANKARIERQNRDAFTDLLQELRAQG  374

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W D  P +++   Y  +    SGSTP DLF D VEE E+     +  V +VL+
Sbjct  375  KIKANTKWVDLLPQIEKDPRYVRMLGQ-SGSTPLDLFWDTVEEEESALRGRRNDVYDVLE  433

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  +F++F   +L    T  I +  LQLI++ L ++   + E E     R  +
Sbjct  434  DKRYEVTPKTTFDEFYEVVLTDRRTAKIDKDALQLIYQRLRDKVLKRSEDEKHAADRHQR  493

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +     WE+ K  VE + EYKA+  +   +  FE+ + RL+
Sbjct  494  RAVDALRSRIKHLEPPVRVNDLWEDVKPRVEKTEEYKALENDEIRQSAFEKVIKRLK  550



>ref|XP_001825324.1| formin binding protein (FNB3) [Aspergillus oryzae RIB40]
 ref|XP_002380499.1| formin binding protein (FNB3), putative [Aspergillus flavus NRRL3357]
 dbj|BAE64191.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED50118.1| formin binding protein (FNB3), putative [Aspergillus flavus NRRL3357]
Length=797

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 123/238 (52%), Gaps = 6/238 (3%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +D++   L K D L VF+ +I+ LE+   + R+ QK    R ER  R+ F  ++++  + 
Sbjct  330  NDDKFKSLSKSDILTVFENHIKSLERAFNDARQQQKAAKARKERHAREQFTELLKELRSQ  389

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A + W +  P++KE   Y  +  N SGS+P DLF DVVEE E      +  V +VL
Sbjct  390  GKIKAGSKWMNIYPLIKEDPRYLGILGN-SGSSPLDLFWDVVEEEERSLRGPRNDVLDVL  448

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              ++   +P  +FE+F   +L    T ++ +  LQLIF+ + ++A  + E+E     R  
Sbjct  449  DDKRFDVTPKTTFEEFNTVVLADRRTANLDQEILQLIFQRIQDKAIRRTEEEKHAADRHQ  508

Query  204  KDFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +  V+ L +        +    +W++ +  VE   EYKAI  +   +  F++ + RL+
Sbjct  509  RRAVDALRSRIKRLEPPVRPTDTWDQVRPRVEKYEEYKAIDSDELRQSAFDKVIRRLK  566



>gb|EIT74743.1| spliceosomal protein FBP11/Splicing factor PRP40 [Aspergillus 
oryzae 3.042]
 gb|KDE75389.1| spliceosomal protein [Aspergillus oryzae 100-8]
Length=799

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 123/238 (52%), Gaps = 6/238 (3%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +D++   L K D L VF+ +I+ LE+   + R+ QK    R ER  R+ F  ++++  + 
Sbjct  330  NDDKFKSLSKSDILTVFENHIKSLERAFNDARQQQKAAKARKERHAREQFTELLKELRSQ  389

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A + W +  P++KE   Y  +  N SGS+P DLF DVVEE E      +  V +VL
Sbjct  390  GKIKAGSKWMNIYPLIKEDPRYLGILGN-SGSSPLDLFWDVVEEEERSLRGPRNDVLDVL  448

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              ++   +P  +FE+F   +L    T ++ +  LQLIF+ + ++A  + E+E     R  
Sbjct  449  DDKRFDVTPKTTFEEFNTVVLADRRTANLDQEILQLIFQRIQDKAIRRTEEEKHAADRHQ  508

Query  204  KDFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +  V+ L +        +    +W++ +  VE   EYKAI  +   +  F++ + RL+
Sbjct  509  RRAVDALRSRIKRLEPPVRPTDTWDQVRPRVEKYEEYKAIDSDELRQSAFDKVIRRLK  566



>gb|KIW01312.1| hypothetical protein PV09_07348 [Verruconis gallopava]
Length=729

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 132/238 (55%), Gaps = 6/238 (3%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +DE+   L K++ ++ F+ + ++ E+   EQR+ ++    R ER+NRDA+  ++ +   A
Sbjct  307  NDEQLRGLPKLELIKAFESFQKEAERALHEQRQEERFAKARRERQNRDAYNGLLRELRNA  366

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A T W D  P++++   Y A+    SGSTP +LF DVVEE + +    +  V +VL
Sbjct  367  GKIKANTKWSDIQPLIEDDPRYDAMLGQ-SGSTPLELFWDVVEEEDRELRAKRNVVYDVL  425

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
            ++E+   +   SF++F++ +     T S  +  L++I++ L+ + +++EEKE  K +R  
Sbjct  426  EAERYEMTTKTSFDEFRSVMQADSTTASYDKDTLRMIYDRLIAKVQEREEKERHKNERHY  485

Query  204  K----DFVEMLSNAD-EITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +    D    L   D  +    SWE+ +  +E   EYKA+  +   R  F++++ RL+
Sbjct  486  RREMDDLRSRLKRLDPPVRVDDSWEQVRPRLEKYDEYKALDSDDLRRSAFDKFIRRLK  543



>gb|KIW67875.1| hypothetical protein, variant [Capronia semiimmersa]
Length=543

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 120/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            D++   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++     G
Sbjct  97   DDKFKLLSKSDVLTAFENHIKSLERTFNDARQQQKATKARRERQNRDNFMELLQSLRGQG  156

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA T W    P ++E   Y A+    +GSTP DLF D+VEE E      +  V +VL+
Sbjct  157  KITAGTKWMTILPEIEEDPRYVAMLGQ-AGSTPLDLFWDLVEEEERALRGRRNDVYDVLE  215

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T  I+   LQLIF+ L ++   + E E     R  +
Sbjct  216  DKRYEVTPRTSFDEFLDVMLTDRRTAPINRDVLQLIFQRLHDKVVRRSEDEKHAADRHQR  275

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  V+ + EY+AI +E   +  +++ + RL+
Sbjct  276  RAVDALRSRIKHLEPPVRITDSWEDVKSRVDKTDEYRAIEDEDLRKSAYDKVIKRLK  332



>ref|XP_004361782.1| WW domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG23931.1| WW domain-containing protein [Dictyostelium fasciculatum]
Length=607

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 126/230 (55%), Gaps = 1/230 (0%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +D   S   K + L+V++ YIR+LEK+E+E ++++KE  ++  R +RD++R  + +    
Sbjct  327  NDALISTCDKYEVLQVYESYIRELEKKEDEAQRSEKEAAKKEARIHRDSYREFLNEKYNE  386

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A T W+++    +       +A    GSTP +LF D +EELE++Y +D  R+K + 
Sbjct  387  GEIHAYTRWKEFYKKYQSHPIVVQLAGQVVGSTPLELFTDFIEELESRYEKDFKRLKTMT  446

Query  384  KSEKITFSPLW-SFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrl  208
            +     FSP   + +DFK +I       SIS +N+   FE L ER + K++   KKRQ+ 
Sbjct  447  QDVNFLFSPQQTTLDDFKQSISTHDKFNSISALNIVPFFEYLKEREEKKQKDSIKKRQKA  506

Query  207  aKDFVEMLSNADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
              +F  +L +   I+  S WEE K  +     Y  + +E    +IF+EY+
Sbjct  507  ILNFKALLEDTRTISKHSKWEEIKPTICKIPHYTDLDDEEEKAKIFQEYL  556



>ref|XP_008080559.1| FF [Glarea lozoyensis ATCC 20868]
 gb|EPE32547.1| FF [Glarea lozoyensis ATCC 20868]
Length=779

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 122/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LEK   + R+ QK Q  R ER+NRD + +++++  +AG
Sbjct  331  DEKFKSLSKSDMLTAFENHIKILEKTFNDARQQQKNQRSRRERQNRDRYLSLLQELKSAG  390

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P +K+   YQA+     GSTP DLF DVVEE E      +  V +VL 
Sbjct  391  KIKAGTKWSKLYPSIKQDERYQAMLGQ-QGSTPLDLFWDVVEEEERALRSTRNDVLDVLD  449

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++       +FE+F A +     T +I    L LIFE L E+A  + E +  + +R  +
Sbjct  450  DKRFEIQQKTTFEEFLALMQNDRRTANIDRDALSLIFERLHEKASRRSEDDKHQAERQQR  509

Query  201  DFVEMLSN-----ADEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        I A  S+E  K  +E S EY A+G +   R  +++ + RL+
Sbjct  510  RAVDSLRSYIKHLEPPIRADDSFERVKPRIEKSEEYLAVGTDELRRSAYDKVIRRLK  566



>gb|KEZ44644.1| hypothetical protein SAPIO_CDS3688 [Scedosporium apiospermum]
Length=826

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 130/237 (55%), Gaps = 5/237 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +DE+   L K D L  FQ +++ LE+   + ++ QK +  R ER+NRDAF  ++ +   A
Sbjct  320  NDEKYKALSKFDILTAFQNHMKALERAFNDSKQEQKNKKYRRERQNRDAFNALLSELRRA  379

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
            G + A T WR   P+++    Y A+A   SGSTP++LF DVVEE E      +  V +VL
Sbjct  380  GKINAGTKWRQIHPLLENDERYIAMAGQ-SGSTPQELFWDVVEEEERGLRGTRNEVLDVL  438

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdke---ekeakkrq  214
              ++   S   +F++F + + +   T +I    L+LIFE + E++  +        ++++
Sbjct  439  DDKRFEVSQKTTFDEFLSVVKDDRRTANIEPDLLRLIFERIQEKSSKRSDDDRHAERQQR  498

Query  213  rlaKDFVEMLSNAD-EITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            R A++    + + D  +T   ++E+ +  +  S +++AI  E   R +F++++ RL+
Sbjct  499  RAAENLRSYMKHLDPPLTVQDTYEKARSRLARSDDFQAITSEDARRAVFDKFIRRLR  555



>gb|KIX95128.1| hypothetical protein Z520_09044 [Fonsecaea multimorphosa CBS 
102226]
Length=771

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 117/237 (49%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++     G
Sbjct  322  DEKFKLLSKSDVLTAFENHIKSLERTFNDARQQQKATKARRERQNRDRFVELLQSLRGQG  381

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P ++E   Y A+    SGSTP DLF D+VEE E      +  V +VL+
Sbjct  382  KIKAGTKWMTILPEIEEDPRYVAMLGQ-SGSTPLDLFWDMVEEEERALRGRRNDVYDVLE  440

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T +I    LQLIF+ L ++   + E E     R  +
Sbjct  441  DKRYEVTPRTSFDEFLDVMLADRRTANIDRDALQLIFQRLHDKVVRRSEDEKHAADRHQR  500

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  VE + EY A+  E   +  F++ V RL+
Sbjct  501  RAVDALRSRIKHLEPPVRITDSWEDIKARVEKTDEYHAVESEELRKSAFDKVVKRLK  557



>gb|KIW82700.1| hypothetical protein Z517_05727 [Fonsecaea pedrosoi CBS 271.37]
Length=769

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 119/237 (50%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DE+   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  319  DEKFKLLSKSDVLTAFENHIKSLERTFNDARQQQKASKARRERQNRDRFVELLQTLRSQG  378

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P +++   Y A+    +GSTP DLF D+VEE E      +  V +VL+
Sbjct  379  KIKAGTKWMTILPEIEDDPRYVAMLGQ-AGSTPLDLFWDMVEEEERALRGRRNDVYDVLE  437

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T +I    LQLIF+ L ++   + E E     R  +
Sbjct  438  DKRYEVTPRTSFDEFLDVMLADRRTANIDRDALQLIFQRLHDKVVRRSEDERHAADRHQR  497

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        I  + SWE+ K  VE + EY A+  E   +  FE+ V RL+
Sbjct  498  RAVDALRSRIKHLEPPIRISDSWEDVKSRVEKTDEYHAVESEELRKSAFEKVVKRLK  554



>gb|KIW67874.1| hypothetical protein PV04_07090 [Capronia semiimmersa]
Length=764

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 120/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            D++   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++     G
Sbjct  318  DDKFKLLSKSDVLTAFENHIKSLERTFNDARQQQKATKARRERQNRDNFMELLQSLRGQG  377

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             +TA T W    P ++E   Y A+    +GSTP DLF D+VEE E      +  V +VL+
Sbjct  378  KITAGTKWMTILPEIEEDPRYVAMLGQ-AGSTPLDLFWDLVEEEERALRGRRNDVYDVLE  436

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T  I+   LQLIF+ L ++   + E E     R  +
Sbjct  437  DKRYEVTPRTSFDEFLDVMLTDRRTAPINRDVLQLIFQRLHDKVVRRSEDEKHAADRHQR  496

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  V+ + EY+AI +E   +  +++ + RL+
Sbjct  497  RAVDALRSRIKHLEPPVRITDSWEDVKSRVDKTDEYRAIEDEDLRKSAYDKVIKRLK  553



>gb|ERL88888.1| hypothetical protein D910_06270 [Dendroctonus ponderosae]
Length=674

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 127/224 (57%), Gaps = 4/224 (2%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            + K D L VF+E+IR  EKE  E+R+ +K + +R  RKNRD F  +++     G +T+ +
Sbjct  339  MDKEDALIVFEEHIRLSEKEYLEEREREKRRQKRQSRKNRDQFLALLDHLHEEGKLTSMS  398

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
            LW +  P++   + + A+   T GSTP DLF+  VE+L++++H++K  +K +L+ ++   
Sbjct  399  LWVELYPIISADIRFSAMLGQT-GSTPLDLFKFYVEDLKSRFHDEKKIIKEILREKEFDV  457

Query  363  SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEML  184
                SF+ F   I E   + S+   N++L +  L+E+A+ KE++  K+  +  K      
Sbjct  458  KAATSFDQFATVICEDKRSASLDAGNVKLTYNSLLEKAEMKEKERLKEETKRMKKLENAF  517

Query  183  SNADE---ITAASSWEECKELVEDSSEYKAIGEETTLREIFEEY  61
             N  +   +     WEE K  VE+ +EYKA G ++  + +++++
Sbjct  518  KNLLKELNVDFEKPWEEIKAKVENENEYKAFGSDSDAQRVYKDF  561



>gb|KIW36962.1| hypothetical protein, variant 2 [Exophiala oligosperma]
Length=543

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 120/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DER   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  97   DERYKLLSKSDVLTAFENHIKSLERSFNDARQQQKSSKARRERQNRDRFIELLQSLRSQG  156

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W +  P ++E   Y A+    +GSTP DLF DV+EE E      +  V +VL+
Sbjct  157  KIKAGTKWMNILPSIEEDPRYVAMLGQ-AGSTPLDLFWDVLEEEERALRGRRNDVYDVLE  215

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +     T SI    L+LIF+ L E+   + E E     R  +
Sbjct  216  DQRYEVTPKTSFDEFLDIMHTDRRTASIDRDALELIFQRLHEKVTKRSEDEKHAAGRHQR  275

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +  A +WE  K  VE ++EY+A+  +   +  +E+ + RL+
Sbjct  276  HAVDALRSRIKHLDPPVRIADTWETVKLRVEKTAEYQAVESDDLRKSAYEKVIKRLK  332



>gb|ETN61619.1| U1 small nuclear ribonucleoprotein [Anopheles darlingi]
Length=900

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 129/225 (57%), Gaps = 4/225 (2%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            + K D L VF+E+IR LE+EE+E+++ +K++++R +RKNRD F  +++     G +T+ +
Sbjct  474  MDKEDALIVFEEHIRGLEREEDEEKEREKKRMKRQQRKNRDQFLALLDTLHEEGKLTSMS  533

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
            LW +  P++   + + A+     GSTP DLF+  VE L+ ++H++K  +K +LK ++   
Sbjct  534  LWVELYPLISADLRFSAMLGQP-GSTPLDLFKFYVENLKARFHDEKKIIKEILKEKEFIV  592

Query  363  SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEML  184
             P  +FEDF   + E   + ++   N++L +  L+E+A+  E++  K+  R  +     L
Sbjct  593  QPTTTFEDFATVVCEDKRSATLDAGNVKLTYNSLLEKAEAAEKERLKEETRRIRKMENEL  652

Query  183  SNA---DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYV  58
                    ++   SWE  ++LV D   Y+   +E  +  ++EEYV
Sbjct  653  KGVWIEAGLSGVDSWETAQKLVLDRDVYEQYEKEDKVERLWEEYV  697



>gb|ERL88889.1| hypothetical protein D910_06270 [Dendroctonus ponderosae]
Length=750

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 127/224 (57%), Gaps = 4/224 (2%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            + K D L VF+E+IR  EKE  E+R+ +K + +R  RKNRD F  +++     G +T+ +
Sbjct  415  MDKEDALIVFEEHIRLSEKEYLEEREREKRRQKRQSRKNRDQFLALLDHLHEEGKLTSMS  474

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
            LW +  P++   + + A+   T GSTP DLF+  VE+L++++H++K  +K +L+ ++   
Sbjct  475  LWVELYPIISADIRFSAMLGQT-GSTPLDLFKFYVEDLKSRFHDEKKIIKEILREKEFDV  533

Query  363  SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEML  184
                SF+ F   I E   + S+   N++L +  L+E+A+ KE++  K+  +  K      
Sbjct  534  KAATSFDQFATVICEDKRSASLDAGNVKLTYNSLLEKAEMKEKERLKEETKRMKKLENAF  593

Query  183  SNADE---ITAASSWEECKELVEDSSEYKAIGEETTLREIFEEY  61
             N  +   +     WEE K  VE+ +EYKA G ++  + +++++
Sbjct  594  KNLLKELNVDFEKPWEEIKAKVENENEYKAFGSDSDAQRVYKDF  637



>gb|KIW91040.1| hypothetical protein Z519_07934 [Cladophialophora bantiana CBS 
173.52]
Length=771

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 117/237 (49%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DER   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  322  DERFKLLSKSDVLTAFENHIKSLERTFNDARQQQKASRARRERQNRDRFVELLQTLRSQG  381

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A   W    P ++E   Y A+    +GSTP DLF DVVEE E      +  V +VL+
Sbjct  382  KIKAGAKWMTILPEIEEDPRYVAMLGQ-AGSTPLDLFWDVVEEEERALRGRRNDVYDVLE  440

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T +I    LQLIF+ L ++   + E E     R  +
Sbjct  441  DKRYEVTPRTSFDEFLDVMLTDRRTANIDRDALQLIFQRLHDKVVRRSEDEKHAADRHQR  500

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  VE + EY A+  E   +  F++ + RL+
Sbjct  501  RAVDALRSRIKHLDPAVRITDSWEDVKARVEKTDEYHAVESEELRKSAFDKVIKRLK  557



>gb|ENN74007.1| hypothetical protein YQE_09397, partial [Dendroctonus ponderosae]
Length=750

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 127/224 (57%), Gaps = 4/224 (2%)
 Frame = -2

Query  723  LXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAGTVTAKT  544
            + K D L VF+E+IR  EKE  E+R+ +K + +R  RKNRD F  +++     G +T+ +
Sbjct  415  MDKEDALIVFEEHIRLSEKEYLEEREREKRRQKRQSRKNRDQFLALLDHLHEEGKLTSMS  474

Query  543  LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF  364
            LW +  P++   + + A+   T GSTP DLF+  VE+L++++H++K  +K +L+ ++   
Sbjct  475  LWVELYPIISADIRFSAMLGQT-GSTPLDLFKFYVEDLKSRFHDEKKIIKEILREKEFDV  533

Query  363  SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaKDFVEML  184
                SF+ F   I E   + S+   N++L +  L+E+A+ KE++  K+  +  K      
Sbjct  534  KAATSFDQFATVICEDKRSASLDAGNVKLTYNSLLEKAEMKEKERLKEETKRMKKLENAF  593

Query  183  SNADE---ITAASSWEECKELVEDSSEYKAIGEETTLREIFEEY  61
             N  +   +     WEE K  VE+ +EYKA G ++  + +++++
Sbjct  594  KNLLKELNVDFEKPWEEIKAKVENENEYKAFGSDSDAQRVYKDF  637



>ref|XP_007743836.1| hypothetical protein A1O5_05043 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ71237.1| hypothetical protein A1O5_05043 [Cladophialophora psammophila 
CBS 110553]
Length=771

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 117/237 (49%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DER   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  322  DERFKLLSKSDVLTAFENHIKSLERTFNDARQQQKASRARRERQNRDRFVELLQTLRSQG  381

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A   W    P ++E   Y A+    +GSTP DLF D+VEE E      +  V +VL+
Sbjct  382  KIKAGAKWMTILPEIEEDPRYVAMLGQ-AGSTPLDLFWDIVEEEERALRGRRNDVYDVLE  440

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +L    T +I    LQLIF+ L ++   + E E     R  +
Sbjct  441  DKRYEVTPRTSFDEFLDVMLTDRRTANIDRDALQLIFQRLHDKVVRRSEDEKHAADRHQR  500

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +    SWE+ K  VE + EY A+  E   +  F++ V RL+
Sbjct  501  RAVDALRSRIKHLDPAVRITDSWEDIKARVEKTDEYHAVESEELRKSAFDKVVKRLK  557



>ref|XP_007918326.1| putative pre-mrna-processing protein prp40 protein [Togninia 
minima UCRPA7]
 gb|EON96921.1| putative pre-mrna-processing protein prp40 protein [Togninia 
minima UCRPA7]
Length=771

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 124/237 (52%), Gaps = 5/237 (2%)
 Frame = -2

Query  744  DDERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAA  565
            +DE+   L K D L VFQ +++ +E+   + R+ +K +  R ER+ RD F +++ +   A
Sbjct  330  NDEKYKVLSKFDVLTVFQNHMKAVERTFNDSRQEEKAKKHRKERQARDGFVSLLRELRRA  389

Query  564  GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL  385
              + A T W    P++++   Y+A+     GSTP++LF D+VEE E      +  V + L
Sbjct  390  SKIKAGTKWSQVFPLIEKEDRYRAMIG-IGGSTPQELFWDIVEEEERALRGTRNDVIDAL  448

Query  384  KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrla  205
              ++   +P   F+DF A + E   T +I    L+LIFE L E+     E++ +  ++  
Sbjct  449  YDKRFEVTPKTDFQDFLAIVKEDRRTANIDRDILKLIFERLQEKKTKPSEEDRQSERKQR  508

Query  204  K---DFVEMLSNAD-EITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
            +   D    L   +  IT   ++EE K  ++ S E++A+  E   R  F++++ RL+
Sbjct  509  RAIDDLRSFLKRLEPPITVNDTYEEVKPRLQKSEEFQAVASEDDRRGAFDKHIRRLR  565



>gb|KIW36960.1| hypothetical protein PV06_10861 [Exophiala oligosperma]
 gb|KIW36961.1| hypothetical protein, variant 1 [Exophiala oligosperma]
Length=764

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 120/237 (51%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DER   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F  +++   + G
Sbjct  318  DERYKLLSKSDVLTAFENHIKSLERSFNDARQQQKSSKARRERQNRDRFIELLQSLRSQG  377

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W +  P ++E   Y A+    +GSTP DLF DV+EE E      +  V +VL+
Sbjct  378  KIKAGTKWMNILPSIEEDPRYVAMLGQ-AGSTPLDLFWDVLEEEERALRGRRNDVYDVLE  436

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P  SF++F   +     T SI    L+LIF+ L E+   + E E     R  +
Sbjct  437  DQRYEVTPKTSFDEFLDIMHTDRRTASIDRDALELIFQRLHEKVTKRSEDEKHAAGRHQR  496

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
              V+ L +        +  A +WE  K  VE ++EY+A+  +   +  +E+ + RL+
Sbjct  497  HAVDALRSRIKHLDPPVRIADTWETVKLRVEKTAEYQAVESDDLRKSAYEKVIKRLK  553



>gb|ESA04877.1| hypothetical protein GLOINDRAFT_230931 [Rhizophagus irregularis 
DAOM 181602]
Length=212

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 92/158 (58%), Gaps = 1/158 (1%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            D+    +  +D L V++E+I+ LE+E  +++K + E+  R +R+NRDA+R +M +     
Sbjct  48   DKTLREMDMLDFLAVYEEHIKILERETADKKKRELEEQTRQQRRNRDAYRTLMNELRQKN  107

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + AK+ W++  P++     YQ +     GS P +LF DVVEEL+   ++ +  V  ++K
Sbjct  108  VINAKSKWKEIYPLIHTDEQYQNMLGQ-PGSNPLELFWDVVEELDEILYQQRKIVTEIMK  166

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFE  268
            ++ +T +   SFE F+ A        S++E NL++IFE
Sbjct  167  TKDVTINSGMSFEQFQVACSSDDRISSVNETNLRIIFE  204



>gb|KIV88433.1| hypothetical protein, variant [Exophiala mesophila]
Length=545

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 116/237 (49%), Gaps = 6/237 (3%)
 Frame = -2

Query  741  DERCSRLXKIDRLEVFQEYIRDlekeeeeqrktqkeqlrRAERKNRDAFRNMMEDHIAAG  562
            DER   L K D L  F+ +I+ LE+   + R+ QK    R ER+NRD F ++++   + G
Sbjct  97   DERFKLLSKSDVLTAFENHIKSLERSFNDARQQQKAIKSRRERQNRDGFVDLLQSLRSKG  156

Query  561  TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK  382
             + A T W    P ++    Y A+    SGSTP DLF D++EE E      +  V +VL+
Sbjct  157  RIKAGTKWMSILPEIETDPRYVAMLGQ-SGSTPLDLFWDMLEEEERALRGRRNDVYDVLE  215

Query  381  SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMerakdkeekeakkrqrlaK  202
             ++   +P   FEDF   ++    T +I    LQL+F+ L ++   + E E     R  +
Sbjct  216  DKRFEVTPKTPFEDFVDVMMTDRRTANIDRDALQLLFQRLHDKVVRRTEDEKHNADRNQR  275

Query  201  DFVEMLSNA-----DEITAASSWEECKELVEDSSEYKAIGEETTLREIFEEYVTRLQ  46
               + L +        +    +WE+ K  VE   EY+A+  E   R  F++ + RL+
Sbjct  276  RATDALRSRIKHLEPPVRLHDTWEDVKPRVEKLEEYRAVETEDLRRSAFDKVIKRLK  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420