BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034D20

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010321856.1|  PREDICTED: pectinesterase                          445   1e-150   Solanum lycopersicum
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     443   8e-150   Nicotiana sylvestris
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     442   1e-149   Nicotiana sylvestris
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     438   4e-149   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     441   6e-149   Nicotiana tomentosiformis
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     439   3e-148   Nicotiana tomentosiformis
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     438   4e-148   Solanum lycopersicum
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     437   2e-147   Nicotiana tomentosiformis
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     437   2e-147   Nicotiana sylvestris
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    436   2e-147   Solanum tuberosum [potatoes]
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   419   1e-142   Citrus sinensis [apfelsine]
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            422   6e-142   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    422   9e-142   Citrus sinensis [apfelsine]
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               413   1e-141   Erythranthe guttata [common monkey flower]
gb|AHB84678.1|  pectin methylesterase                                   422   1e-141   Citrus reticulata [mandarin orange]
emb|CDP15270.1|  unnamed protein product                                420   9e-141   Coffea canephora [robusta coffee]
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     419   2e-140   Sesamum indicum [beniseed]
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     416   2e-139   Vitis vinifera
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         411   2e-139   Jatropha curcas
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     414   9e-139   Eucalyptus grandis [rose gum]
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     413   3e-138   Prunus mume [ume]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     410   5e-138   Glycine soja [wild soybean]
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     410   2e-137   Populus euphratica
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     410   2e-137   Populus euphratica
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             410   6e-137   
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    401   8e-137   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    411   9e-137   Glycine max [soybeans]
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             410   1e-136   Phaseolus vulgaris [French bean]
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     409   1e-136   Fragaria vesca subsp. vesca
gb|EPS62329.1|  pectinesterase                                          409   2e-136   Genlisea aurea
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     408   4e-136   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             407   6e-136   Phaseolus vulgaris [French bean]
gb|KJB41904.1|  hypothetical protein B456_007G127000                    407   6e-136   Gossypium raimondii
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             407   6e-136   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     403   1e-135   Glycine soja [wild soybean]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     405   2e-135   Phoenix dactylifera
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    405   4e-135   Glycine max [soybeans]
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          404   5e-135   Amborella trichopoda
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    405   6e-135   Gossypium arboreum [tree cotton]
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     404   6e-135   Nelumbo nucifera [Indian lotus]
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    404   8e-135   Cicer arietinum [garbanzo]
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 404   9e-135   Medicago truncatula
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    404   1e-134   Cucumis sativus [cucumbers]
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           393   2e-134   Vigna radiata [mung bean]
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               403   2e-134   Ricinus communis
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     404   3e-134   
gb|KGN44975.1|  Pectinesterase                                          404   4e-134   Cucumis sativus [cucumbers]
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    402   9e-134   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     400   5e-133   Nelumbo nucifera [Indian lotus]
gb|KJB09419.1|  hypothetical protein B456_001G140500                    399   7e-133   Gossypium raimondii
gb|AGG23325.1|  pectin methylesterase 1                                 399   8e-133   Musa acuminata AAA Group [Cavendish banana]
gb|ACQ85264.1|  pectin methylesterase                                   399   1e-132   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     399   1e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     394   9e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     377   1e-128   
gb|EPS67066.1|  pectinesterase                                          399   2e-128   Genlisea aurea
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     387   8e-128   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     373   3e-127   Elaeis guineensis
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     373   4e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042866.1|  Os01g0312500                                       379   9e-127   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          380   4e-125   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70505.1|  hypothetical protein OsI_01594                          379   4e-125   Oryza sativa Indica Group [Indian rice]
gb|KJB49889.1|  hypothetical protein B456_008G143700                    379   6e-125   Gossypium raimondii
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    377   2e-124   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   369   6e-123   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          372   3e-122   Sorghum bicolor [broomcorn]
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   364   5e-121   
emb|CBI24582.3|  unnamed protein product                                357   9e-121   Vitis vinifera
gb|EMT27728.1|  Pectinesterase                                          360   5e-120   
dbj|BAJ96804.1|  predicted protein                                      366   5e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     364   1e-119   Nelumbo nucifera [Indian lotus]
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     363   1e-119   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     365   2e-119   Brachypodium distachyon [annual false brome]
ref|XP_002322401.1|  putative pectin methylesterase family protein      362   4e-119   Populus trichocarpa [western balsam poplar]
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    360   8e-119   
emb|CBI38888.3|  unnamed protein product                                352   1e-118   Vitis vinifera
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    361   2e-118   Morus notabilis
gb|EMS45437.1|  Pectinesterase                                          353   2e-118   Triticum urartu
ref|NP_001146685.1|  pectinesterase precursor                           362   2e-118   Zea mays [maize]
ref|XP_004307817.2|  PREDICTED: pectinesterase 2-like                   360   3e-118   Fragaria vesca subsp. vesca
ref|NP_001060620.1|  Os07g0675100                                       362   3e-118   
gb|EEC82670.1|  hypothetical protein OsI_27314                          362   3e-118   Oryza sativa Indica Group [Indian rice]
gb|EMT05022.1|  Pectinesterase 3                                        358   4e-118   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               358   4e-118   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                360   6e-118   Erythranthe guttata [common monkey flower]
gb|ACN40984.1|  unknown                                                 362   8e-118   Picea sitchensis
ref|XP_010271283.1|  PREDICTED: pectinesterase                          359   1e-117   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   359   1e-117   Vitis vinifera
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   358   1e-117   Populus euphratica
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     358   3e-117   Eucalyptus grandis [rose gum]
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     358   3e-117   Nelumbo nucifera [Indian lotus]
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   359   4e-117   
emb|CDO97717.1|  unnamed protein product                                348   5e-117   Coffea canephora [robusta coffee]
gb|ABZ89800.1|  pectin methylesterase-like protein                      359   5e-117   Taiwania cryptomerioides
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             356   5e-117   
gb|AFI23415.1|  pectin methylesterase                                   350   7e-117   Coffea arabica [arabica coffee]
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     356   1e-116   Phoenix dactylifera
gb|AFW03479.1|  pectin methylesterase 5                                 355   2e-116   Gossypium barbadense [Egyptian cotton]
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         356   2e-116   Jatropha curcas
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   355   3e-116   Populus euphratica
gb|ABQ42392.1|  pectin methylesterase-like protein                      357   3e-116   Taiwania cryptomerioides
ref|XP_002318285.1|  putative pectin methylesterase family protein      355   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     355   5e-116   Nelumbo nucifera [Indian lotus]
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        353   1e-115   
gb|KJB41089.1|  hypothetical protein B456_007G090100                    354   1e-115   Gossypium raimondii
gb|KHG19575.1|  Uncharacterized protein F383_07269                      353   1e-115   Gossypium arboreum [tree cotton]
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   352   4e-115   Citrus sinensis [apfelsine]
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   352   4e-115   Citrus sinensis [apfelsine]
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             352   4e-115   Citrus clementina [clementine]
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          352   6e-115   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     353   6e-115   Tarenaya hassleriana [spider flower]
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   352   8e-115   Nelumbo nucifera [Indian lotus]
emb|CDP20891.1|  unnamed protein product                                352   8e-115   Coffea canephora [robusta coffee]
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     352   9e-115   Nelumbo nucifera [Indian lotus]
gb|AFW03484.1|  pectin methylesterase 5                                 351   1e-114   Gossypium hirsutum [American cotton]
ref|XP_007038413.1|  Pectinesterase                                     351   1e-114   
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   351   1e-114   Prunus mume [ume]
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   350   2e-114   Eucalyptus grandis [rose gum]
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         350   3e-114   Jatropha curcas
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     350   3e-114   Phoenix dactylifera
gb|KHN35618.1|  Pectinesterase 2                                        345   3e-114   Glycine soja [wild soybean]
emb|CAN60506.1|  hypothetical protein VITISV_022717                     341   3e-114   Vitis vinifera
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   350   3e-114   
gb|AER38244.1|  PME5                                                    350   4e-114   Gossypium barbadense [Egyptian cotton]
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     350   5e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN25547.1|  Pectinesterase 2                                        344   5e-114   Glycine soja [wild soybean]
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     349   6e-114   Elaeis guineensis
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   347   7e-114   Eucalyptus grandis [rose gum]
emb|CBI24284.3|  unnamed protein product                                340   7e-114   Vitis vinifera
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               349   1e-113   Ricinus communis
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   349   1e-113   Nelumbo nucifera [Indian lotus]
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             348   1e-113   Citrus clementina [clementine]
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    347   1e-113   
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          349   1e-113   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     348   1e-113   Nelumbo nucifera [Indian lotus]
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       350   1e-113   Cucumis sativus [cucumbers]
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     350   2e-113   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   348   2e-113   Pyrus x bretschneideri [bai li]
emb|CAN83663.1|  hypothetical protein VITISV_017689                     348   2e-113   Vitis vinifera
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        348   2e-113   Vitis vinifera
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   348   3e-113   Eucalyptus grandis [rose gum]
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   348   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_011046483.1|  PREDICTED: probable pectinesterase/pectinest...    349   3e-113   Populus euphratica
gb|AAN84553.1|  methyl pectinesterase                                   337   4e-113   Lolium perenne [perennial ryegrass]
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             348   4e-113   Prunus persica
gb|KHN42767.1|  Pectinesterase 2                                        345   4e-113   Glycine soja [wild soybean]
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   347   5e-113   Citrus sinensis [apfelsine]
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    347   6e-113   Citrus sinensis [apfelsine]
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   353   8e-113   
ref|XP_004299718.2|  PREDICTED: pectinesterase-like                     348   9e-113   Fragaria vesca subsp. vesca
gb|KJB41905.1|  hypothetical protein B456_007G127100                    347   1e-112   Gossypium raimondii
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               346   1e-112   Ricinus communis
emb|CDP20872.1|  unnamed protein product                                346   1e-112   Coffea canephora [robusta coffee]
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   346   1e-112   Nicotiana sylvestris
ref|XP_009335708.1|  PREDICTED: probable pectinesterase/pectinest...    347   1e-112   Pyrus x bretschneideri [bai li]
ref|XP_009335714.1|  PREDICTED: probable pectinesterase/pectinest...    347   1e-112   
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    346   1e-112   Solanum lycopersicum
ref|XP_008803383.1|  PREDICTED: pectinesterase                          346   2e-112   Phoenix dactylifera
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   345   2e-112   
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    347   2e-112   Nelumbo nucifera [Indian lotus]
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     344   2e-112   Eucalyptus grandis [rose gum]
ref|XP_002314796.1|  pectin methylesterase 6 family protein             345   3e-112   Populus trichocarpa [western balsam poplar]
ref|NP_001275775.1|  pectinesterase 2 precursor                         345   3e-112   Citrus sinensis [apfelsine]
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    345   4e-112   Glycine max [soybeans]
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   345   4e-112   Eucalyptus grandis [rose gum]
emb|CAN76835.1|  hypothetical protein VITISV_043176                     344   4e-112   Vitis vinifera
ref|XP_002515774.1|  Pectinesterase-2 precursor, putative               346   4e-112   Ricinus communis
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   344   5e-112   Eucalyptus grandis [rose gum]
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     343   5e-112   
emb|CBI36882.3|  unnamed protein product                                346   5e-112   Vitis vinifera
gb|KJB49890.1|  hypothetical protein B456_008G143800                    346   5e-112   Gossypium raimondii
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   344   6e-112   Eucalyptus grandis [rose gum]
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             347   7e-112   Phaseolus vulgaris [French bean]
ref|XP_007052106.1|  Pectinesterase 2                                   344   7e-112   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    345   7e-112   Prunus mume [ume]
ref|XP_002268492.2|  PREDICTED: probable pectinesterase/pectinest...    345   8e-112   Vitis vinifera
emb|CBI24285.3|  unnamed protein product                                342   8e-112   Vitis vinifera
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     342   8e-112   
gb|AGV54687.1|  pectinesterase                                          347   9e-112   Phaseolus vulgaris [French bean]
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    343   1e-111   Nicotiana tomentosiformis
ref|XP_008389982.1|  PREDICTED: pectinesterase                          344   1e-111   
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   345   2e-111   Setaria italica
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   343   2e-111   Glycine max [soybeans]
ref|XP_002273427.2|  PREDICTED: probable pectinesterase/pectinest...    345   2e-111   Vitis vinifera
emb|CAN78759.1|  hypothetical protein VITISV_000562                     343   2e-111   Vitis vinifera
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   343   2e-111   Vitis vinifera
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   343   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   343   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_008363719.1|  PREDICTED: probable pectinesterase/pectinest...    344   2e-111   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        342   2e-111   Prunus mume [ume]
gb|ABK24761.1|  unknown                                                 344   2e-111   Picea sitchensis
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        343   2e-111   Populus euphratica
ref|XP_010098938.1|  Pectinesterase 2                                   343   2e-111   Morus notabilis
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          344   3e-111   Amborella trichopoda
ref|XP_010269594.1|  PREDICTED: probable pectinesterase/pectinest...    344   3e-111   Nelumbo nucifera [Indian lotus]
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     343   3e-111   Populus euphratica
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     343   4e-111   Eucalyptus grandis [rose gum]
ref|XP_002874923.1|  pectinesterase family protein                      344   4e-111   
emb|CDP17208.1|  unnamed protein product                                342   5e-111   Coffea canephora [robusta coffee]
ref|XP_007220646.1|  hypothetical protein PRUPE_ppa003474mg             343   5e-111   Prunus persica
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     342   5e-111   Nelumbo nucifera [Indian lotus]
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    343   6e-111   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   342   6e-111   Nicotiana sylvestris
emb|CDY68840.1|  BnaCnng60750D                                          339   6e-111   Brassica napus [oilseed rape]
ref|XP_007050982.1|  Plant invertase/pectin methylesterase inhibi...    342   9e-111   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        341   9e-111   Vitis vinifera
ref|XP_002315399.2|  hypothetical protein POPTR_0010s25400g             343   1e-110   
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             341   1e-110   Eutrema salsugineum [saltwater cress]
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      341   1e-110   Glycine soja [wild soybean]
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    341   1e-110   Glycine max [soybeans]
ref|XP_010684347.1|  PREDICTED: pectinesterase                          343   1e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        341   1e-110   Sesamum indicum [beniseed]
ref|XP_006287360.1|  hypothetical protein CARUB_v10000558mg             343   1e-110   Capsella rubella
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     342   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   340   1e-110   Glycine max [soybeans]
ref|XP_006433466.1|  hypothetical protein CICLE_v10003641mg             342   1e-110   Citrus clementina [clementine]
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         340   2e-110   Jatropha curcas
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             340   2e-110   Prunus persica
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        341   2e-110   
gb|KDO53806.1|  hypothetical protein CISIN_1g0081982mg                  335   2e-110   Citrus sinensis [apfelsine]
ref|XP_008375415.1|  PREDICTED: probable pectinesterase/pectinest...    333   2e-110   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   340   3e-110   Cicer arietinum [garbanzo]
ref|XP_010088299.1|  putative pectinesterase/pectinesterase inhib...    341   3e-110   Morus notabilis
ref|XP_002872845.1|  pectinesterase family protein                      337   4e-110   
gb|KHN16553.1|  Pectinesterase 2                                        336   4e-110   Glycine soja [wild soybean]
ref|XP_006396440.1|  hypothetical protein EUTSA_v10028546mg             341   4e-110   Eutrema salsugineum [saltwater cress]
ref|XP_004135375.1|  PREDICTED: probable pectinesterase/pectinest...    341   4e-110   Cucumis sativus [cucumbers]
ref|XP_008231877.1|  PREDICTED: probable pectinesterase/pectinest...    341   5e-110   Prunus mume [ume]
ref|XP_008446714.1|  PREDICTED: probable pectinesterase/pectinest...    340   6e-110   Cucumis melo [Oriental melon]
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   339   7e-110   Cucumis melo [Oriental melon]
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   338   7e-110   Pyrus x bretschneideri [bai li]
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   339   7e-110   Cucumis sativus [cucumbers]
ref|XP_010273807.1|  PREDICTED: pectinesterase-like isoform X3          341   8e-110   
ref|XP_010422609.1|  PREDICTED: probable pectinesterase/pectinest...    340   9e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          343   9e-110   
ref|XP_010273806.1|  PREDICTED: pectinesterase-like isoform X2          341   1e-109   
ref|XP_003541559.2|  PREDICTED: probable pectinesterase/pectinest...    340   1e-109   
ref|NP_567227.1|  Probable pectinesterase/pectinesterase inhibito...    340   1e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18942.1|  BnaC04g04080D                                          329   1e-109   Brassica napus [oilseed rape]
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    340   1e-109   Fragaria vesca subsp. vesca
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    338   1e-109   Tarenaya hassleriana [spider flower]
ref|XP_010273805.1|  PREDICTED: pectinesterase-like isoform X1          340   1e-109   
ref|XP_010556727.1|  PREDICTED: probable pectinesterase/pectinest...    340   1e-109   Tarenaya hassleriana [spider flower]
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     341   2e-109   Glycine soja [wild soybean]
ref|XP_011079963.1|  PREDICTED: probable pectinesterase/pectinest...    340   2e-109   Sesamum indicum [beniseed]
ref|XP_010069897.1|  PREDICTED: probable pectinesterase/pectinest...    339   2e-109   Eucalyptus grandis [rose gum]
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             338   2e-109   Phaseolus vulgaris [French bean]
ref|XP_009111300.1|  PREDICTED: probable pectinesterase/pectinest...    338   2e-109   
gb|KHN43319.1|  Putative pectinesterase/pectinesterase inhibitor 7      332   2e-109   Glycine soja [wild soybean]
ref|XP_007222884.1|  hypothetical protein PRUPE_ppa003581mg             339   2e-109   Prunus persica
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   335   2e-109   
ref|XP_010457268.1|  PREDICTED: probable pectinesterase/pectinest...    339   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_008219291.1|  PREDICTED: probable pectinesterase/pectinest...    339   3e-109   Prunus mume [ume]
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   337   3e-109   
gb|KHN35620.1|  Pectinesterase 2                                        332   3e-109   Glycine soja [wild soybean]
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     338   3e-109   Nelumbo nucifera [Indian lotus]
ref|XP_008812398.1|  PREDICTED: probable pectinesterase/pectinest...    338   3e-109   
ref|XP_003591484.1|  Pectinesterase                                     330   3e-109   Medicago truncatula
emb|CAA96434.1|  pectin methylesterase                                  330   3e-109   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_192141.1|  probable pectinesterase/pectinesterase inhibito...    337   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008346152.1|  PREDICTED: probable pectinesterase/pectinest...    339   3e-109   
ref|XP_002302726.1|  pectinesterase family protein                      338   4e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010456048.1|  PREDICTED: probable pectinesterase/pectinest...    339   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_004162735.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    338   4e-109   
emb|CAA96435.1|  pectin methylesterase                                  330   4e-109   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    338   4e-109   Eucalyptus grandis [rose gum]
ref|XP_008451544.1|  PREDICTED: probable pectinesterase/pectinest...    338   6e-109   Cucumis melo [Oriental melon]
gb|KDP30022.1|  hypothetical protein JCGZ_18594                         338   7e-109   Jatropha curcas
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    338   7e-109   Fragaria vesca subsp. vesca
ref|XP_002310960.2|  hypothetical protein POPTR_0008s01180g             338   8e-109   
ref|XP_009625476.1|  PREDICTED: pectinesterase-like                     338   8e-109   Nicotiana tomentosiformis
ref|XP_004231267.1|  PREDICTED: probable pectinesterase/pectinest...    337   8e-109   Solanum lycopersicum
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    336   8e-109   Glycine max [soybeans]
ref|XP_010474855.1|  PREDICTED: probable pectinesterase/pectinest...    338   9e-109   Camelina sativa [gold-of-pleasure]
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     337   9e-109   Solanum lycopersicum
ref|XP_006432534.1|  hypothetical protein CICLE_v10000705mg             338   9e-109   Citrus clementina [clementine]
ref|XP_010654104.1|  PREDICTED: pectinesterase                          337   9e-109   Vitis vinifera
emb|CDX95641.1|  BnaC03g25220D                                          333   1e-108   
ref|XP_006382446.1|  hypothetical protein POPTR_0005s02250g             333   1e-108   
ref|XP_010481250.1|  PREDICTED: probable pectinesterase/pectinest...    338   1e-108   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          337   1e-108   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        336   1e-108   
gb|KJB30790.1|  hypothetical protein B456_005G160000                    336   1e-108   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    337   1e-108   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         329   1e-108   
emb|CDY65637.1|  BnaAnng20820D                                          336   1e-108   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     335   1e-108   
gb|KDP28189.1|  hypothetical protein JCGZ_13960                         337   1e-108   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    338   1e-108   
dbj|BAF42040.1|  pectin methylesterase 3                                337   1e-108   
ref|XP_004173650.1|  PREDICTED: probable pectinesterase/pectinest...    331   1e-108   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    335   1e-108   
ref|XP_010429512.1|  PREDICTED: probable pectinesterase/pectinest...    337   2e-108   
gb|KHN03710.1|  Putative pectinesterase/pectinesterase inhibitor 40     332   2e-108   
gb|ABK94644.1|  unknown                                                 329   2e-108   
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    337   2e-108   
gb|KHN20388.1|  Putative pectinesterase/pectinesterase inhibitor 7      336   2e-108   
ref|XP_008356803.1|  PREDICTED: probable pectinesterase/pectinest...    337   2e-108   
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             338   2e-108   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    335   2e-108   
emb|CDX83392.1|  BnaA03g21140D                                          333   2e-108   
emb|CAE76634.1|  pectin methylesterase                                  326   2e-108   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    335   2e-108   
ref|XP_003521574.1|  PREDICTED: probable pectinesterase/pectinest...    336   2e-108   
gb|AAL87311.1|  unknown protein                                         337   2e-108   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        335   2e-108   
ref|XP_006306147.1|  hypothetical protein CARUB_v10011654mg             337   2e-108   
emb|CAA96436.1|  pectin methylesterase                                  327   2e-108   
ref|NP_563662.1|  pectinesterase 7                                      337   3e-108   
ref|XP_009355065.1|  PREDICTED: probable pectinesterase/pectinest...    337   3e-108   
ref|XP_002882002.1|  predicted protein                                  334   3e-108   
ref|XP_003591498.1|  Pectinesterase                                     328   3e-108   
ref|XP_009111298.1|  PREDICTED: probable pectinesterase/pectinest...    336   3e-108   
ref|XP_009799791.1|  PREDICTED: probable pectinesterase/pectinest...    335   3e-108   
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    334   5e-108   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     335   5e-108   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    336   5e-108   
emb|CDY35644.1|  BnaC09g29660D                                          332   6e-108   
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    337   6e-108   
ref|XP_003536881.1|  PREDICTED: probable pectinesterase/pectinest...    335   6e-108   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    336   6e-108   
ref|XP_009339241.1|  PREDICTED: probable pectinesterase/pectinest...    336   6e-108   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    334   6e-108   
ref|XP_006644119.1|  PREDICTED: probable pectinesterase/pectinest...    335   7e-108   
gb|AHC69829.1|  pectin methylesterase PME2.1                            335   7e-108   
gb|KEH21378.1|  pectinesterase                                          329   7e-108   
ref|XP_002457749.1|  hypothetical protein SORBIDRAFT_03g012820          335   7e-108   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 335   8e-108   
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                     336   8e-108   
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    335   8e-108   
gb|KFK30820.1|  pectinesterase family protein                           335   8e-108   
gb|AGR44472.1|  pectin methylesterase 3                                 335   8e-108   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             332   8e-108   
ref|XP_003588521.1|  Pectinesterase                                     336   9e-108   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    335   1e-107   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    334   1e-107   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     334   1e-107   
emb|CDY65861.1|  BnaCnng48920D                                          335   1e-107   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    333   1e-107   
ref|XP_010694877.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    324   1e-107   
ref|NP_566379.1|  pectinesterase 25                                     324   1e-107   
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    334   1e-107   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     334   1e-107   
dbj|BAF00855.1|  hypothetical protein                                   335   1e-107   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    333   1e-107   
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    333   2e-107   
ref|XP_011032979.1|  PREDICTED: probable pectinesterase/pectinest...    335   2e-107   
emb|CDY15440.1|  BnaA08g27240D                                          335   2e-107   
ref|XP_006361900.1|  PREDICTED: probable pectinesterase/pectinest...    334   2e-107   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     333   2e-107   
gb|KJB23307.1|  hypothetical protein B456_004G091400                    334   2e-107   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     333   2e-107   
gb|KHN10315.1|  Putative pectinesterase/pectinesterase inhibitor 25     338   3e-107   
gb|AAM67242.1|  putative pectinesterase                                 323   3e-107   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          334   3e-107   
ref|XP_004290810.1|  PREDICTED: probable pectinesterase/pectinest...    333   3e-107   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   332   4e-107   
emb|CDY14384.1|  BnaA10g06710D                                          330   4e-107   
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             334   4e-107   
emb|CDX74715.1|  BnaA05g04610D                                          329   4e-107   
ref|XP_010522800.1|  PREDICTED: probable pectinesterase/pectinest...    333   4e-107   
ref|XP_004496026.1|  PREDICTED: probable pectinesterase/pectinest...    332   5e-107   
emb|CDO97716.1|  unnamed protein product                                331   6e-107   
ref|XP_004513409.1|  PREDICTED: probable pectinesterase/pectinest...    333   6e-107   
ref|XP_006480113.1|  PREDICTED: probable pectinesterase/pectinest...    333   6e-107   
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    334   6e-107   
gb|AFW03480.1|  pectin methylesterase 1                                 333   6e-107   
ref|XP_007148761.1|  hypothetical protein PHAVU_005G011900g             328   7e-107   
ref|XP_006444392.1|  hypothetical protein CICLE_v10023588mg             332   7e-107   
ref|XP_004136013.1|  PREDICTED: probable pectinesterase/pectinest...    332   7e-107   
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    321   7e-107   
emb|CBI23005.3|  unnamed protein product                                327   8e-107   
ref|XP_004513410.1|  PREDICTED: probable pectinesterase/pectinest...    332   8e-107   
ref|XP_010932330.1|  PREDICTED: pectinesterase-like                     332   9e-107   
ref|XP_003591482.1|  Pectinesterase                                     332   9e-107   
ref|XP_006361902.1|  PREDICTED: probable pectinesterase/pectinest...    332   1e-106   
gb|KJB57093.1|  hypothetical protein B456_009G147900                    333   1e-106   
ref|XP_006828577.1|  hypothetical protein AMTR_s00129p00031200          332   1e-106   
ref|XP_006444391.1|  hypothetical protein CICLE_v10024391mg             332   1e-106   
ref|XP_009760201.1|  PREDICTED: probable pectinesterase/pectinest...    332   1e-106   
gb|KHN08673.1|  Putative pectinesterase/pectinesterase inhibitor 41     331   1e-106   
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   330   1e-106   
ref|XP_003518980.1|  PREDICTED: probable pectinesterase/pectinest...    332   1e-106   
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   330   1e-106   
ref|XP_006444394.1|  hypothetical protein CICLE_v10020108mg             328   1e-106   
ref|XP_004967522.1|  PREDICTED: probable pectinesterase/pectinest...    332   1e-106   
ref|XP_004513411.1|  PREDICTED: probable pectinesterase/pectinest...    332   1e-106   
ref|XP_009111299.1|  PREDICTED: probable pectinesterase/pectinest...    331   1e-106   
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             332   1e-106   
ref|XP_002523112.1|  Pectinesterase-2 precursor, putative               332   1e-106   
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    333   1e-106   
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    333   1e-106   
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      330   2e-106   
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    332   2e-106   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     331   2e-106   
ref|XP_011010962.1|  PREDICTED: probable pectinesterase/pectinest...    332   2e-106   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          330   2e-106   
ref|XP_009409567.1|  PREDICTED: pectinesterase/pectinesterase inh...    331   2e-106   
ref|XP_010917364.1|  PREDICTED: pectinesterase                          330   2e-106   
ref|XP_006396439.1|  hypothetical protein EUTSA_v10029374mg             330   2e-106   
emb|CDP00815.1|  unnamed protein product                                330   2e-106   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    331   2e-106   
gb|EAY73715.1|  hypothetical protein OsI_01593                          330   2e-106   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 331   2e-106   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   330   2e-106   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    332   2e-106   
ref|XP_006598050.1|  PREDICTED: probable pectinesterase/pectinest...    335   3e-106   
gb|KHN26434.1|  Putative pectinesterase/pectinesterase inhibitor 47     332   3e-106   
ref|XP_007148760.1|  hypothetical protein PHAVU_005G011900g             330   3e-106   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     330   3e-106   
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 329   3e-106   
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          330   3e-106   
ref|XP_003535331.2|  PREDICTED: probable pectinesterase/pectinest...    330   3e-106   
ref|XP_007145536.1|  hypothetical protein PHAVU_007G246700g             331   3e-106   
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          332   4e-106   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                332   4e-106   
gb|AFB77929.1|  pectin methylesterase                                   331   4e-106   
gb|KJB45339.1|  hypothetical protein B456_007G302100                    331   4e-106   
gb|KHG08631.1|  Pectinesterase 3                                        331   4e-106   
ref|XP_010088302.1|  putative pectinesterase/pectinesterase inhib...    330   4e-106   
ref|NP_001042865.1|  Os01g0311800                                       330   4e-106   
ref|XP_009111182.1|  PREDICTED: probable pectinesterase/pectinest...    331   5e-106   
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    330   5e-106   
ref|XP_006418303.1|  hypothetical protein EUTSA_v10007177mg             331   5e-106   
gb|KFK42633.1|  hypothetical protein AALP_AA1G020600                    331   6e-106   
ref|XP_003554529.1|  PREDICTED: probable pectinesterase/pectinest...    330   6e-106   
ref|XP_006577155.1|  PREDICTED: probable pectinesterase/pectinest...    330   6e-106   
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   321   6e-106   
ref|XP_003527536.2|  PREDICTED: probable pectinesterase/pectinest...    331   6e-106   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             330   6e-106   
ref|XP_010422610.1|  PREDICTED: probable pectinesterase/pectinest...    329   6e-106   
emb|CBI27741.3|  unnamed protein product                                323   7e-106   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    330   7e-106   
ref|XP_010088303.1|  putative pectinesterase/pectinesterase inhib...    330   7e-106   
ref|XP_007146998.1|  hypothetical protein PHAVU_006G088100g             330   7e-106   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    328   7e-106   
gb|AAF23891.1|  pectin methyl esterase                                  329   7e-106   
ref|NP_001274785.1|  pectin methyl esterase                             329   8e-106   
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    330   8e-106   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 329   8e-106   
gb|EYU26911.1|  hypothetical protein MIMGU_mgv1a025577mg                329   9e-106   
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   334   1e-105   
emb|CDY49170.1|  BnaA02g10290D                                          326   1e-105   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    328   1e-105   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             328   1e-105   
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                329   1e-105   
ref|XP_007199619.1|  hypothetical protein PRUPE_ppa024812mg             328   1e-105   
gb|AFW03475.1|  pectin methylesterase 1                                 330   1e-105   
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        319   1e-105   
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                     330   1e-105   
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...    330   1e-105   
ref|XP_006442946.1|  hypothetical protein CICLE_v10023535mg             330   1e-105   
emb|CDY22045.1|  BnaA09g00740D                                          328   1e-105   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    330   2e-105   
ref|XP_009421463.1|  PREDICTED: probable pectinesterase/pectinest...    330   2e-105   
ref|XP_004297462.2|  PREDICTED: pectinesterase                          330   2e-105   
ref|XP_007031046.1|  Pectinesterase-2 precursor                         329   2e-105   
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    330   2e-105   
ref|XP_002317208.1|  pectin methylesterase family protein               328   2e-105   
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    318   2e-105   
ref|XP_004499739.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    329   2e-105   
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     328   2e-105   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 328   2e-105   
emb|CDX96216.1|  BnaC02g14350D                                          325   2e-105   
emb|CDP08022.1|  unnamed protein product                                328   2e-105   
emb|CDY52778.1|  BnaCnng23230D                                          327   2e-105   
ref|XP_007163133.1|  hypothetical protein PHAVU_001G209200g             328   2e-105   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   327   2e-105   
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    330   2e-105   
gb|ACN40878.1|  unknown                                                 331   3e-105   
dbj|BAH20370.1|  AT3G10720                                              325   3e-105   
gb|KHN35616.1|  Pectinesterase 2                                        322   3e-105   
ref|XP_009600658.1|  PREDICTED: probable pectinesterase/pectinest...    328   3e-105   
ref|XP_006479999.1|  PREDICTED: probable pectinesterase/pectinest...    328   3e-105   
gb|KEH24403.1|  pectinesterase/pectinesterase inhibitor                 328   3e-105   
ref|XP_009335753.1|  PREDICTED: probable pectinesterase/pectinest...    327   3e-105   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    327   4e-105   
ref|XP_010044212.1|  PREDICTED: pectinesterase                          328   4e-105   
emb|CDY52779.1|  BnaCnng23240D                                          328   4e-105   
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     327   4e-105   
ref|NP_001275859.1|  pectinesterase 1 precursor                         329   4e-105   
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                326   4e-105   
gb|AFI23412.1|  pectin methylesterase                                   321   4e-105   
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    329   4e-105   
gb|KHN35617.1|  Pectinesterase 2                                        326   4e-105   
ref|XP_003598362.1|  Pectinesterase                                     328   4e-105   
ref|XP_007133557.1|  hypothetical protein PHAVU_011G188900g             330   4e-105   
ref|XP_009378757.1|  PREDICTED: probable pectinesterase/pectinest...    327   4e-105   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               327   4e-105   
ref|XP_009119610.1|  PREDICTED: probable pectinesterase/pectinest...    328   5e-105   
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    328   5e-105   
ref|XP_009763888.1|  PREDICTED: probable pectinesterase/pectinest...    328   5e-105   
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             328   6e-105   
ref|XP_006444393.1|  hypothetical protein CICLE_v10023718mg             327   6e-105   
ref|XP_010932335.1|  PREDICTED: probable pectinesterase/pectinest...    327   6e-105   
ref|XP_008369099.1|  PREDICTED: probable pectinesterase/pectinest...    327   6e-105   
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      326   7e-105   
gb|KEH19216.1|  pectinesterase/pectinesterase inhibitor                 329   7e-105   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    328   9e-105   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    325   9e-105   



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   445 bits (1144),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 205/245 (84%), Positives = 224/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ +GIT ENYAGP KHQAVALRSGSDLS F+  SF+AYQDT
Sbjct  320  VDGWTTFRSATVAVVGNGFLARGITFENYAGPSKHQAVALRSGSDLSAFYQCSFIAYQDT  379

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVV QNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  380  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQNCNLYARKPNPNQKNMFTAQGREDPNQNT  439

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DL+PV SSFKNYLGRPWK+YSRTV ++SN+GSLIDPAGWLEW G+FA
Sbjct  440  GISILNCKVEAASDLVPVVSSFKNYLGRPWKQYSRTVILISNIGSLIDPAGWLEWSGDFA  499

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARVKWPGYR++N +SEA+QFTVGNFI G +WIPATGVPFY 
Sbjct  500  LNTLYYGEYLNRGPGSNTSARVKWPGYRVINSSSEASQFTVGNFIQGSEWIPATGVPFYS  559

Query  82   NLTAS  68
             LT+S
Sbjct  560  GLTSS  564



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   443 bits (1139),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 206/245 (84%), Positives = 224/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ KGIT ENYAGP KHQAVALRS SDLS F+  SFVAYQDT
Sbjct  323  VDGWTTFRSATVAVVGKGFLAKGITFENYAGPSKHQAVALRSSSDLSAFYQCSFVAYQDT  382

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVV QNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  383  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQNCNLYARKPDPNQKNLFTAQGREDPNQNT  442

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AAADLIPVQSSFKNYLGRPWKEYSRTV + S +GSLI+PAGWLEW+G+FA
Sbjct  443  GISILNCKVEAAADLIPVQSSFKNYLGRPWKEYSRTVVLQSYIGSLIEPAGWLEWNGDFA  502

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY NRGPGS+TSARVKWPGYR++N+S EA+QFTVGNFI G +W+P TG PFY+
Sbjct  503  LKTLYYGEYMNRGPGSSTSARVKWPGYRVINSSIEASQFTVGNFIQGGEWLPPTGFPFYL  562

Query  82   NLTAS  68
            NLT+S
Sbjct  563  NLTSS  567



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   442 bits (1137),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 204/245 (83%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI +GIT EN+AGP KHQAVALRSGSDLS F+  SFVAYQDT
Sbjct  316  VDGWTTFRSATVAVVGNGFIARGITFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDT  375

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQNCNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  376  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNT  435

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DL+PV SSFKNYLGRPWK+YSRTVF+LSN+GSLIDPAGWLEWDG FA
Sbjct  436  GISILNCKVEAASDLVPVLSSFKNYLGRPWKQYSRTVFLLSNIGSLIDPAGWLEWDGNFA  495

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N+GPGSNT+ARVKWPGYR++N+S EA+QF VGNF+ G QW+PATG PF++
Sbjct  496  LNTLYYGEYLNKGPGSNTNARVKWPGYRVINSSAEASQFNVGNFLQGSQWLPATGFPFFL  555

Query  82   NLTAS  68
             LT+S
Sbjct  556  GLTSS  560



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   438 bits (1126),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 204/245 (83%), Positives = 222/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ +GIT ENYAGP KHQAVALRSGSDLS F+  SFVAYQDT
Sbjct  235  VDGWTTFRSATVAVVGNGFLARGITFENYAGPSKHQAVALRSGSDLSAFYQCSFVAYQDT  294

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVV QNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  295  LYVHSLRQFYRNCDVYGTVDFIFGNAAVVLQNCNLYARKPNPNQKNLFTAQGREDPNQNT  354

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DL+PV SSFKNYLGRPWK+YSRTV + SN+GSLIDPAGWLEW G+FA
Sbjct  355  GISILNCKVEAASDLVPVLSSFKNYLGRPWKQYSRTVILFSNIGSLIDPAGWLEWSGDFA  414

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARVKWPGYR++N+S EA+QFTVGNFI G +WIPAT VPFY 
Sbjct  415  LNTLYYGEYLNRGPGSNTSARVKWPGYRVINSSTEASQFTVGNFIQGSEWIPATEVPFYS  474

Query  82   NLTAS  68
             LT+S
Sbjct  475  GLTSS  479



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   441 bits (1133),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 206/245 (84%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI +GIT EN+AGP KHQAVALRSGSDLS F+  SFVAYQDT
Sbjct  316  VDGWTTFRSATVAVVGNGFIARGITFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDT  375

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQNCNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  376  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNT  435

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAA+DL+PV SSFKNYLGRPWK+YSRTVF+ SN+GSLIDPAGWLEWDG FA
Sbjct  436  GISILNCKVAAASDLVPVLSSFKNYLGRPWKQYSRTVFLRSNIGSLIDPAGWLEWDGNFA  495

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N GPGS TSARVKWPGYR++N+S EA+QFTVGNFI G QW+PATG PF++
Sbjct  496  LNTLYYGEYLNNGPGSITSARVKWPGYRVINSSAEASQFTVGNFIQGSQWLPATGFPFFL  555

Query  82   NLTAS  68
            +LT+S
Sbjct  556  SLTSS  560



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   439 bits (1129),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 204/245 (83%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ KGIT ENYAGP KHQAVA+RSGSD S F+  SFVAYQDT
Sbjct  323  VDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQAVAVRSGSDFSAFYQCSFVAYQDT  382

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNC+LYARKP  NQKNIFTAQGREDPNQNT
Sbjct  383  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCSLYARKPNENQKNIFTAQGREDPNQNT  442

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILN K+AAAADLIPVQSSFKNY+GRPWKEYSRTV ML+++GSLI+PAG+LEW+G FA
Sbjct  443  GISILNSKIAAAADLIPVQSSFKNYIGRPWKEYSRTVIMLTHIGSLIEPAGYLEWNGTFA  502

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY+NRGPGSNTSARV WPGYR++N S EA+QFTVGNFI G++W+P TG PFY+
Sbjct  503  LDTLYYGEYRNRGPGSNTSARVNWPGYRVINNSAEASQFTVGNFIEGKEWLPDTGFPFYL  562

Query  82   NLTAS  68
            NLTAS
Sbjct  563  NLTAS  567



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   438 bits (1127),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 205/245 (84%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ KGIT ENYAGP KHQAVA+RSGSDLS F+  SFVAYQDT
Sbjct  318  VDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQAVAVRSGSDLSAFYQCSFVAYQDT  377

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVV QNCNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  378  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQNCNLYARKPNDNQKNIFTAQGREDPNQNT  437

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISIL+ K+A+AADLIPV+S+FKNYLGRPWKEYSRTVFML+++GSLIDPAG+LEW+G FA
Sbjct  438  GISILSGKIASAADLIPVESTFKNYLGRPWKEYSRTVFMLTHIGSLIDPAGFLEWNGSFA  497

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++NTS EA+ FTVGNFI G++W+P TG PFYV
Sbjct  498  LSTLYYGEYMNRGPGSNTSARVTWPGYRVINTSAEASLFTVGNFIEGKEWLPDTGFPFYV  557

Query  82   NLTAS  68
            NLTAS
Sbjct  558  NLTAS  562



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   437 bits (1123),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 201/245 (82%), Positives = 220/245 (90%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ KGIT ENYAGP KHQAV LRS SDLS F+  SFVAYQDT
Sbjct  324  VDGWTTFRSATVAVVGKGFLAKGITFENYAGPSKHQAVTLRSSSDLSAFYQCSFVAYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVV QNCNLYARKP  NQ+N+FTAQGREDPNQNT
Sbjct  384  LYVHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNLYARKPDPNQRNLFTAQGREDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AAADL+PVQSSFKNYLGRPWKEYSRTVF+ S +GSLI+PAGWLEW+G FA
Sbjct  444  GISILNCKVEAAADLVPVQSSFKNYLGRPWKEYSRTVFLQSYIGSLIEPAGWLEWNGNFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY NRGPGSNTS RVKWPGYR++N+S E +QFTVGNFI G +W+PATG PFY+
Sbjct  504  LKTLYYGEYMNRGPGSNTSVRVKWPGYRVINSSAETSQFTVGNFIQGGEWLPATGFPFYL  563

Query  82   NLTAS  68
            N T S
Sbjct  564  NFTFS  568



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   437 bits (1123),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/245 (83%), Positives = 224/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN+AGP KHQAVA+RSGSDLS F+  SFVAYQDT
Sbjct  322  VDGWTTFRSATVAVVGNGFIAKGITFENFAGPSKHQAVAVRSGSDLSAFYQCSFVAYQDT  381

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNC+LYARKP  NQKNIFTAQGREDPNQNT
Sbjct  382  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCSLYARKPNENQKNIFTAQGREDPNQNT  441

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILN K+AAAADLIPVQSSFKNY+GRPWKEYSRTV ML+++GSLI+PAG+LEW+G FA
Sbjct  442  GISILNSKIAAAADLIPVQSSFKNYIGRPWKEYSRTVIMLTHIGSLIEPAGYLEWNGTFA  501

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV W GYR++N S EA+QFTVGNFI G++W+P TG PFY+
Sbjct  502  LDTLYYGEYMNRGPGSNTSARVNWSGYRVINNSAEASQFTVGNFIEGKEWLPDTGFPFYL  561

Query  82   NLTAS  68
            NLTAS
Sbjct  562  NLTAS  566



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   436 bits (1122),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/245 (83%), Positives = 224/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ KGIT ENYAGP KHQAVA+RSGSD S F+  SFVAYQDT
Sbjct  318  VDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQAVAVRSGSDFSAFYQCSFVAYQDT  377

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVV QNCNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  378  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQNCNLYARKPNDNQKNIFTAQGREDPNQNT  437

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISIL+ K+A+AADLIPV+S+FKNYLGRPWKEYSRTVFML+++GSLIDPAG+LEW+G FA
Sbjct  438  GISILSGKIASAADLIPVESTFKNYLGRPWKEYSRTVFMLTHIGSLIDPAGFLEWNGSFA  497

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARVKWPGYR++N S EA+ FTVGNFI G++W+P TG PFYV
Sbjct  498  LSTLYYGEYMNRGPGSNTSARVKWPGYRVINNSAEASLFTVGNFIEGKEWLPDTGFPFYV  557

Query  82   NLTAS  68
            NLTAS
Sbjct  558  NLTAS  562



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   419 bits (1076),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT+EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  157  VDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDT  216

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQ CNLYARKP ANQKNI TAQGREDPNQNT
Sbjct  217  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNT  276

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAA+DLIP Q+ FK YLGRPWKEYSRTVFMLS LG LI PAGWLEW+G FA
Sbjct  277  GISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFA  336

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYV  83
            L TL+YGEY+NRGPGSNTSARV WPGYR++N S  A QFT G F+ G +W+ +TG+PFY+
Sbjct  337  LSTLFYGEYKNRGPGSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTGIPFYL  396

Query  82   NLT  74
            NLT
Sbjct  397  NLT  399



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   422 bits (1085),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT+EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  305  VDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDT  364

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQ CNLYARKP ANQKNI TAQGREDPNQNT
Sbjct  365  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNT  424

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAA+DLIP Q+ FK YLGRPWKEYSRTVFMLS LG LI PAGWLEW+G FA
Sbjct  425  GISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFA  484

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYV  83
            L TL+YGEY+NRGPGSNTSARV WPGYR++N S  A QFT G F+ G +W+ +TG+PFY+
Sbjct  485  LSTLFYGEYKNRGPGSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTGIPFYL  544

Query  82   NLT  74
            NLT
Sbjct  545  NLT  547



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   422 bits (1085),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT+EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  326  VDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDT  385

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQ CNLYARKP ANQKNI TAQGREDPNQNT
Sbjct  386  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNT  445

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAA+DLIP Q+ FK YLGRPWKEYSRTVFMLS LG LI PAGWLEW+G FA
Sbjct  446  GISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFA  505

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYV  83
            L TL+YGEY+NRGPGSNTSARV WPGYR++N S  A QFT G F+ G +W+ +TG+PFY+
Sbjct  506  LSTLFYGEYKNRGPGSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTGIPFYL  565

Query  82   NLT  74
            NLT
Sbjct  566  NLT  568



>gb|EYU46749.1| hypothetical protein MIMGU_mgv1a0044631mg, partial [Erythranthe 
guttata]
Length=325

 Score =   413 bits (1062),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 194/245 (79%), Positives = 215/245 (88%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRS+TVAVVG GF+ KGIT ENYAGP KHQAVALRSG+D S F+  SFVAYQDT
Sbjct  81   VDGWTTFRSSTVAVVGNGFLAKGITFENYAGPSKHQAVALRSGADFSAFYQCSFVAYQDT  140

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQN NLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  141  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNSNLYARKPDPNQKNIFTAQGREDPNQNT  200

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV S F+ +LGRPWK YSRTVFM SN+ +++DP GWLEWDG+FA
Sbjct  201  GISILNCKVAAAADLIPVLSQFRTFLGRPWKLYSRTVFMFSNMEAVVDPKGWLEWDGDFA  260

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L T YY EY+NRGPGSNT+ARV W GY +LN+S EA+QFTV NFI G QW+PATG PF+ 
Sbjct  261  LNTSYYREYKNRGPGSNTTARVTWTGYAVLNSSTEASQFTVANFIQGNQWLPATGFPFFP  320

Query  82   NLTAS  68
            NLTA+
Sbjct  321  NLTAT  325



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   422 bits (1085),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT+EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  326  VDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDT  385

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQ CNLYARKP ANQKNI TAQGREDPNQNT
Sbjct  386  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNIITAQGREDPNQNT  445

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAA+DLIP Q+ FK YLGRPWKEYSRTVFMLS LG LI PAGWLEW+G FA
Sbjct  446  GISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFA  505

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYV  83
            L TL+YGEY+NRGPGSNTSARV WPGYR++N S  A QFT G F+ G +W+ +TG+PFY+
Sbjct  506  LSTLFYGEYKNRGPGSNTSARVTWPGYRVINNSAVAAQFTAGPFLQGSEWLNSTGIPFYL  565

Query  82   NLT  74
            NLT
Sbjct  566  NLT  568



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   420 bits (1080),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 220/243 (91%), Gaps = 1/243 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            GWTTFRS+TVAVVG GFI +GIT+ENYAGP +HQAVALRSGSDLS F+  SF+ YQDTLY
Sbjct  345  GWTTFRSSTVAVVGDGFIARGITVENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLY  404

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHSLRQFYR+CDVYGTVDFIFGNAAVVFQ CNLYAR+P  NQ+N+FTAQGREDPNQNTGI
Sbjct  405  VHSLRQFYRECDVYGTVDFIFGNAAVVFQLCNLYARRPNPNQQNLFTAQGREDPNQNTGI  464

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SILNCKVAAAADL+PV SSF++YLGRPW+EYSRTV++LSN+ SLIDPAGWL W+G FAL 
Sbjct  465  SILNCKVAAAADLLPVLSSFRSYLGRPWREYSRTVYLLSNMESLIDPAGWLPWNGSFALS  524

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+YGEY+NRGPGSNT+ARVKWPGYR++ NT+ A+QFTVGNFI G  W+P TG+PFY NL
Sbjct  525  TLFYGEYKNRGPGSNTTARVKWPGYRVITNTTVASQFTVGNFIQGTAWLPNTGIPFYPNL  584

Query  76   TAS  68
            T S
Sbjct  585  TPS  587



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   419 bits (1076),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 216/244 (89%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRS+TVAV+G GFI KGIT ENYAGP KHQAVALRSG+D S F+  SFVAYQDT
Sbjct  319  VDGWTTFRSSTVAVLGNGFIAKGITFENYAGPSKHQAVALRSGADFSAFYQCSFVAYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGT+DFIFGNAAVVFQN NLYAR+P  NQ+NIFTAQGREDPNQNT
Sbjct  379  LYVHSLRQFYRECDIYGTIDFIFGNAAVVFQNSNLYARRPNDNQRNIFTAQGREDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV S F+ +LGRPWK+YSRTVFM S + +++DP GWLEW+G FA
Sbjct  439  GISILNCKVAAAADLIPVLSQFRTFLGRPWKQYSRTVFMYSKMENVVDPQGWLEWNGSFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++N+S EA+QFTV NFI G QW+PAT +PFY 
Sbjct  499  LDTLYYGEYMNRGPGSNTSARVTWPGYRVINSSTEASQFTVANFIQGNQWLPATAIPFYP  558

Query  82   NLTA  71
            NLTA
Sbjct  559  NLTA  562



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   416 bits (1070),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/241 (79%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            GWTTF+S TVAVV   FI KGI+ ENYAGP  HQAVALRSG+DLSVF+   F+ YQDTLY
Sbjct  319  GWTTFQSGTVAVVANNFIAKGISFENYAGPSNHQAVALRSGADLSVFYLCRFIGYQDTLY  378

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHSLRQFYR+CDVYGT+DFIFGNAAVV QNCNLYAR+P ANQKN+FTAQGR+DPN+NTGI
Sbjct  379  VHSLRQFYRECDVYGTIDFIFGNAAVVLQNCNLYARRPNANQKNVFTAQGRDDPNENTGI  438

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKVAAAADLIPV SSFK+YLGRPWKEYSRTV+M SN+G+LIDPAGWLEWDG+FAL 
Sbjct  439  SIQNCKVAAAADLIPVLSSFKSYLGRPWKEYSRTVYMQSNIGNLIDPAGWLEWDGDFALS  498

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+NRGPGSNTS RV WPGYR++N+S  A+QFTVG FI G +W+PATG+P+Y NL
Sbjct  499  TLYYGEYKNRGPGSNTSGRVTWPGYRVINSSSVASQFTVGAFIQGDEWLPATGIPYYSNL  558

Query  76   T  74
            T
Sbjct  559  T  559



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN AGP  HQAVALRSGSDLS F+  SFV YQDT
Sbjct  188  VDGWTTFRSATVAVVGNGFIAKGITFENSAGPSMHQAVALRSGSDLSAFYQCSFVGYQDT  247

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGT+DFIFGNAAVVFQNCNLYAR+P  NQKNI TAQGREDPNQNT
Sbjct  248  LYVHSLRQFYRECDVYGTIDFIFGNAAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNT  307

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+SSFK YLGRPWKEYSRTV++ S +  LIDPAGWLEW+G+FA
Sbjct  308  GISILNCKVAAAADLIPVKSSFKTYLGRPWKEYSRTVYITSYIDDLIDPAGWLEWNGDFA  367

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY NRGPGSNTS RV WPGYR++N S EA+QF V  FI G +W+ ATGVPF +
Sbjct  368  LKTLYYGEYMNRGPGSNTSGRVTWPGYRVINNSAEASQFAVEPFIQGSEWLNATGVPFSL  427

Query  82   NL  77
             L
Sbjct  428  GL  429



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   414 bits (1065),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 214/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVA VG+GFI KGI+ ENYAGP KHQAVA RSGSDLS F++ SF+ YQDT
Sbjct  319  VDGWTTFRSATVAAVGSGFIAKGISFENYAGPSKHQAVAFRSGSDLSAFYSCSFIGYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  379  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARKPNENQKNIFTAQGREDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+SSFK YLGRPWKEYSRTV+MLSN+  ++DPAGWLEW+G FA
Sbjct  439  GISILNCKVAAAADLIPVKSSFKTYLGRPWKEYSRTVYMLSNIEDVVDPAGWLEWNGTFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY+N+GPGSNTSARV WPGY++L N +EA QFTV +FI G  W+  T +P+Y+
Sbjct  499  LNTLYYAEYRNQGPGSNTSARVTWPGYKVLTNVTEATQFTVSSFIQGNDWLNGTSIPYYL  558

Query  82   NL  77
             L
Sbjct  559  GL  560



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   413 bits (1061),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 213/243 (88%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI +GIT EN AGP KHQAVA RSGSD S F+  SFV YQDT
Sbjct  319  VDGWTTFRSATVAVVGDGFIAQGITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVV QNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  379  LYVHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAA+DL+PV+S+FK YLGRPWKEYSRTV+M S +  L+ PAGWLEW+G FA
Sbjct  439  GISILNCKVAAASDLVPVKSTFKTYLGRPWKEYSRTVYMKSYIDDLVQPAGWLEWNGTFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARVKWPGYR++N+S EANQFTVG FI G +W+ +T +P+++
Sbjct  499  LSTLYYGEYLNRGPGSNTSARVKWPGYRVINSSDEANQFTVGPFIQGNEWLNSTNIPYFI  558

Query  82   NLT  74
             LT
Sbjct  559  GLT  561



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   410 bits (1053),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAVVG GFI KGIT EN AGP KHQAVALRSGSD S F+  SFVAYQDT
Sbjct  239  VDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDT  298

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAA V QNCNLYARKP  NQ+N+FTAQGREDPNQNT
Sbjct  299  LYVHSLRQFYRDCDVYGTVDFIFGNAATVLQNCNLYARKPNENQRNLFTAQGREDPNQNT  358

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+S FKNYLGRPWK+YSRTV++ S +  LIDP GWLEW+G FA
Sbjct  359  GISILNCKVAAAADLIPVKSQFKNYLGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFA  418

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++ N +EANQFTV NFI G +W+ +T +PF+ 
Sbjct  419  LDTLYYGEYNNRGPGSNTSARVTWPGYRVIKNATEANQFTVRNFIQGNEWLSSTDIPFFS  478

Query  82   NLT  74
            + +
Sbjct  479  DFS  481



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 213/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  316  VDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDT  375

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGT+DFIFGNAAVVFQ  NLYARKP +NQ+NIFTAQGREDPNQNT
Sbjct  376  LYVHSLRQFYRECDVYGTIDFIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNT  435

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+SSF+ +LGRPWKEYSRTVF+ S +  L+DPAGWLEW+  FA
Sbjct  436  GISILNCKVAAAADLIPVKSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFA  495

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++ N++EA+QFTVG FI G  W+ +T +P+++
Sbjct  496  LSTLYYGEYMNRGPGSNTSARVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTDIPYFL  555

Query  82   NL  77
            NL
Sbjct  556  NL  557



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 213/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  316  VDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDT  375

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGT+DFIFGNAAVVFQ  NLYARKP +NQ+NIFTAQGREDPNQNT
Sbjct  376  LYVHSLRQFYRECDVYGTIDFIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNT  435

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+SSF+ +LGRPWKEYSRTVF+ S +  L+DPAGWLEW+  FA
Sbjct  436  GISILNCKVAAAADLIPVKSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFA  495

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++ N++EA+QFTVG FI G  W+ +T +P+++
Sbjct  496  LSTLYYGEYMNRGPGSNTSARVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTDIPYFL  555

Query  82   NL  77
            NL
Sbjct  556  NL  557



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   410 bits (1053),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 213/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  316  VDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDT  375

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVH+LRQFYR+CD+YGT+DFIFGNAAVVFQN NLYARKP +NQKNIFTAQGREDPNQNT
Sbjct  376  LYVHTLRQFYRECDIYGTIDFIFGNAAVVFQNSNLYARKPNSNQKNIFTAQGREDPNQNT  435

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+SSF+ +LGRPWKEYSRTVF+ S +  L+DPAGWLEW+  FA
Sbjct  436  GISILNCKVAAAADLIPVKSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFA  495

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY NRGPGSNTSARV WPGYRI+ N++EA+QFTVG FI G  W+ +T +P+++
Sbjct  496  LSTLYYREYMNRGPGSNTSARVTWPGYRIITNSTEASQFTVGAFIQGNTWLNSTDIPYFL  555

Query  82   NL  77
            NL
Sbjct  556  NL  557



>sp|P85076.1|PME_ACTDE RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Actinidia deliciosa]
Length=321

 Score =   401 bits (1030),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 208/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRS+TVAVVGTGFI +GI+ ENYAGP KHQAVALRSG+D S F+  SFV YQDT
Sbjct  79   VDGWTTFRSSTVAVVGTGFIARGISFENYAGPSKHQAVALRSGADFSAFYQCSFVGYQDT  138

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFY +CDVYGT+DFIFGNAA V Q CNLYARKP  NQKNIFTAQGR+DPNQNT
Sbjct  139  LYVHSLRQFYSECDVYGTIDFIFGNAAAVLQKCNLYARKPNENQKNIFTAQGRDDPNQNT  198

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV SSFK YLGRPWKEYSRTVF+LS + SLIDPAGWLEW G+FA
Sbjct  199  GISILNCKVAAAADLIPVLSSFKTYLGRPWKEYSRTVFLLSQMESLIDPAGWLEWSGDFA  258

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRI-LNTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY+N GPGSNT+ARV WPGY +  N +E  QFTVGNFI G QW+ +  +P Y+
Sbjct  259  LTTLYYREYKNTGPGSNTTARVTWPGYAVTTNETEVIQFTVGNFIQGSQWLTSYNIPVYL  318

Query  82   NLT  74
            NLT
Sbjct  319  NLT  321



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   411 bits (1056),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAVVG GFI KGIT EN AGP KHQAVALRSGSD S F+  SFVAYQDT
Sbjct  373  VDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDT  432

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAA V QNCNLYARKP  NQ+N+FTAQGREDPNQNT
Sbjct  433  LYVHSLRQFYRDCDVYGTVDFIFGNAATVLQNCNLYARKPNENQRNLFTAQGREDPNQNT  492

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADLIPV+S FKNYLGRPWK+YSRTV++ S +  LIDP GWLEW+G FA
Sbjct  493  GISILNCKVAAAADLIPVKSQFKNYLGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFA  552

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++ N +EANQFTV NFI G +W+ +T +PF+ 
Sbjct  553  LDTLYYGEYNNRGPGSNTSARVTWPGYRVIKNATEANQFTVRNFIQGNEWLSSTDIPFFS  612

Query  82   NLT  74
            + +
Sbjct  613  DFS  615



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   410 bits (1054),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 213/243 (88%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAVVG GFI KGIT EN AGP KHQAVALRSG+DLS F+  SFVAYQDT
Sbjct  359  VDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGADLSAFYQCSFVAYQDT  418

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAA V QNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  419  LYVHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYARKPNPNQKNLFTAQGREDPNQNT  478

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI+NCKVAAAADLIPV+S FKNYLGRPWK+YSRTV++ S +  LIDPAGWLEWDG FA
Sbjct  479  GISIINCKVAAAADLIPVKSEFKNYLGRPWKKYSRTVYLNSLMEDLIDPAGWLEWDGNFA  538

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG+NTS RV WPGYR++ N++EA+QFTV NFI G +W+ + G+PF+ 
Sbjct  539  LDTLYYGEYNNRGPGANTSRRVTWPGYRVITNSTEASQFTVANFIQGNEWLTSLGIPFFS  598

Query  82   NLT  74
             L+
Sbjct  599  GLS  601



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   409 bits (1051),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  325  VDGWTTFRSATVAVVGGGFIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDT  384

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYARKP   QKNIFTAQGREDPNQNT
Sbjct  385  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARKPNDGQKNIFTAQGREDPNQNT  444

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DLIPV+S+FK YLGRPWKEYSRTV++ SN+   +DPAGWLEW+G FA
Sbjct  445  GISILNCKVTAASDLIPVKSTFKTYLGRPWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFA  504

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRG GS T+ARV WPGYR++N S EA+QFTVG FI G +W+ +TG+P++ 
Sbjct  505  LSTLYYGEYLNRGNGSGTTARVTWPGYRVINNSTEASQFTVGAFIQGNEWLNSTGIPYFA  564

Query  82   NLT  74
             L+
Sbjct  565  GLS  567



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 216/245 (88%), Gaps = 1/245 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDGWTTFRSATVAVVG GFI  GITIENYAG  KHQAVALRSG+D S F+  SFV YQDT
Sbjct  315  IDGWTTFRSATVAVVGNGFIATGITIENYAGAVKHQAVALRSGADFSAFYRCSFVGYQDT  374

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYV+S RQF+R CD+YGTVDFIFGNAAVVFQNC+LYAR+P+ NQ+NIFTAQGREDPNQNT
Sbjct  375  LYVYSNRQFFRQCDIYGTVDFIFGNAAVVFQNCSLYARRPLDNQQNIFTAQGREDPNQNT  434

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAAAADL+PV + F+ YLGRPWK+YSRTV++LS + S++DP GWLEW+G FA
Sbjct  435  GISILNCKVAAAADLLPVVTQFQTYLGRPWKQYSRTVYLLSKIESVVDPKGWLEWNGTFA  494

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQNRGPGSNTS RV WPGY ++N+S EA+QFTV NFI G  W+P++G+PFY+
Sbjct  495  LSTLYYGEYQNRGPGSNTSGRVNWPGYHVINSSAEASQFTVENFIQGSLWLPSSGLPFYL  554

Query  82   NLTAS  68
            NLTA+
Sbjct  555  NLTAT  559



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   408 bits (1049),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSG+D S F+  SFV YQDT
Sbjct  336  VDGWTTFRSATVAVVGBGFIAKGITFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDT  395

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVV QNCNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  396  LYVHSLRQFYRECDVYGTVDFIFGNAAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNT  455

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV A +DLIPV+S+F  YLGRPWKEYSRTV++ S +  L+DPAGWLEW+G FA
Sbjct  456  GISILNCKVTAGSDLIPVKSNFTTYLGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFA  515

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++N+S EA+QFTVG FI G  W+ +T +P+++
Sbjct  516  LSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSVEASQFTVGEFIQGSDWLNSTNIPYFL  575

Query  82   NLTA  71
             LT+
Sbjct  576  GLTS  579



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   407 bits (1045),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 210/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAV+G GFI KGIT EN AGPEKHQAVALRSG+D S FF  SFV YQDT
Sbjct  311  VDGWTTFQSATVAVLGEGFIAKGITFENSAGPEKHQAVALRSGADFSAFFRCSFVGYQDT  370

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYAR+P  NQKN+FTAQGREDPNQNT
Sbjct  371  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARRPNENQKNLFTAQGREDPNQNT  430

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCK+AAA+DLIPV+SSFK+YLGRPWK YSRTV++ S +  LIDPAGWLEW+  FA
Sbjct  431  GISIFNCKIAAASDLIPVKSSFKSYLGRPWKTYSRTVYLKSYIEDLIDPAGWLEWNDTFA  490

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYRI+N+S EA+QFTV  FI G  W+  TG+PF  
Sbjct  491  LDTLYYGEYMNRGPGSNTSARVTWPGYRIINSSTEASQFTVAQFIQGNDWLNTTGIPFLS  550

Query  82   NLT  74
             L+
Sbjct  551  GLS  553



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   407 bits (1046),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SFVAYQDT
Sbjct  318  VDGFTTFRSATVAVVGEGFIAKGITFENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDT  377

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQ+CNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  378  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNT  437

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCK+AAAADL+PV+SSFK YLGRPWKEYSRTV M S +   +DPAGWLEW+G FA
Sbjct  438  GISILNCKIAAAADLVPVKSSFKTYLGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFA  497

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++N+S EA QFT+  FI G +W+ ++ +PF +
Sbjct  498  LSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSTEATQFTIEPFIQGNEWLNSSNIPFAL  557

Query  82   NL  77
             L
Sbjct  558  GL  559



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   407 bits (1047),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 187/243 (77%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI +GIT EN AGP KHQAVA RSGSD S F+  SFV YQDT
Sbjct  335  VDGWTTFRSATVAVVGDGFIAQGITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDT  394

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVV QNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  395  LYVHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNT  454

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILN KVAAA+DL+PV++ FK YLGRPWKEYSRTV+M S +  L++PAGWLEW+G FA
Sbjct  455  GISILNSKVAAASDLVPVKAMFKTYLGRPWKEYSRTVYMKSYIDDLVEPAGWLEWNGTFA  514

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++N+S EANQFTVG FI G +W+ AT +P+++
Sbjct  515  LSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSAEANQFTVGPFIQGNEWLNATNIPYFI  574

Query  82   NLT  74
             LT
Sbjct  575  GLT  577



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAVVG GFI KGIT EN AGP+KHQAVALRSG+D S F+  SFV YQDT
Sbjct  229  VDGWTTFQSATVAVVGAGFIAKGITFENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDT  288

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  289  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNT  348

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCK+AAAADLIPV+SSFK+YLGRPWK YSRTV + S +  LIDPAGWLEW+  FA
Sbjct  349  GISILNCKIAAAADLIPVKSSFKSYLGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFA  408

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG+NT+ RV WPGYR++N+S EA QFTVG FI G  W+ +TG+PF+ 
Sbjct  409  LDTLYYGEYMNRGPGANTNGRVTWPGYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFS  468

Query  82   NL  77
             L
Sbjct  469  GL  470



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+ + ITIEN AGP KHQAVALR G+DLS F+  SFVAYQDT
Sbjct  316  VDGWTTFRSATVAVVGDGFLARDITIENSAGPSKHQAVALRVGADLSAFYRCSFVAYQDT  375

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGTVDFIFGNAAVV Q+CNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  376  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQSCNLYARKPDPNQKNIFTAQGREDPNQNT  435

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DLIPVQS+F  YLGRPWK+YSRTVFM S LGSLIDPAGWLEWDG+FA
Sbjct  436  GISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSRTVFMQSFLGSLIDPAGWLEWDGDFA  495

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N+GPGSNTS RV WPGYR++ + +EA+ FTV +FI G QW+ AT VPF  
Sbjct  496  LSTLYYGEYMNQGPGSNTSRRVTWPGYRVITSAAEASNFTVASFIQGDQWLGATSVPFTS  555

Query  82   NL  77
             L
Sbjct  556  GL  557



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAVVG GFI KGIT EN AGP+KHQAVALRSG+D S F+  SFV YQDT
Sbjct  320  VDGWTTFQSATVAVVGAGFIAKGITFENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDT  379

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYARKP  NQKN+FTAQGREDPNQNT
Sbjct  380  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNT  439

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCK+AAAADLIPV+SSFK+YLGRPWK YSRTV + S +  LIDPAGWLEW+  FA
Sbjct  440  GISILNCKIAAAADLIPVKSSFKSYLGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFA  499

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG+NT+ RV WPGYR++N+S EA QFTVG FI G  W+ +TG+PF+ 
Sbjct  500  LDTLYYGEYMNRGPGANTNGRVTWPGYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFS  559

Query  82   NL  77
             L
Sbjct  560  GL  561



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSAT AVVG+ FI + ++ EN AGP KHQAVALRSG+DLS F+  SFV YQDT
Sbjct  298  VDGWTTFRSATFAVVGSNFIARDMSFENSAGPSKHQAVALRSGADLSAFYRCSFVGYQDT  357

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVV Q+CNLYAR+P  NQ+N+FTAQGR DPNQNT
Sbjct  358  LYVHSLRQFYRECDVYGTVDFIFGNAAVVLQDCNLYARRPNPNQRNLFTAQGRVDPNQNT  417

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCKVAAAADLIPVQSSFKNYLGRPWK+YSRT+FM S++G LIDPAGW EW G+FA
Sbjct  418  GISIQNCKVAAAADLIPVQSSFKNYLGRPWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFA  477

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG++TS RVKWPGYR++N +SEA+QFTV +FI G +W+PA+ V FY 
Sbjct  478  LSTLYYGEYMNRGPGADTSNRVKWPGYRVINSSSEASQFTVASFIQGNEWLPASNVAFYA  537

Query  82   NL  77
             L
Sbjct  538  GL  539



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   405 bits (1040),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTFRSATVAVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SFVAYQDT
Sbjct  318  VDGFTTFRSATVAVVGEGFIAKGITFENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDT  377

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQ+CNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  378  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNT  437

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCK+AAAADL+PV+SSFK YLGRPWKEYSRTV M S +   +DPAGWLEW+G FA
Sbjct  438  GISILNCKIAAAADLVPVKSSFKTYLGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFA  497

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGS+TSARV WPGYR++N+S EA QFT+  FI G +W+ ++ +PF +
Sbjct  498  LSTLYYGEYLNRGPGSSTSARVTWPGYRVINSSTEATQFTIEPFIQGNEWLNSSNIPFAL  557

Query  82   NL  77
             L
Sbjct  558  GL  559



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI + +T EN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  319  VDGWTTFRSATVAVVGNGFIARDMTFENSAGPNKHQAVALRSGSDLSAFYRCSFVGYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCD+YGTVDFIFGNAAVVFQNCNLYAR+P  NQKNIFTAQGR+DPNQNT
Sbjct  379  LYVHSLRQFYRDCDIYGTVDFIFGNAAVVFQNCNLYARRPNDNQKNIFTAQGRQDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
             ISIL+ KV AA+DLIPV+SSFK YLGRPWKEYSRTVF+ S L  LIDPAGWLEW G+FA
Sbjct  439  XISILDSKVTAASDLIPVKSSFKTYLGRPWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG+NTS+RV WPGYR++N+S EA+QFTV +FI G +W+ +TGVP++ 
Sbjct  499  LTTLYYGEYMNRGPGANTSSRVSWPGYRVINSSTEASQFTVASFIQGNEWLSSTGVPYFS  558

Query  82   NL  77
             L
Sbjct  559  GL  560



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   404 bits (1037),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 216/243 (89%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDGWTTF+SAT AVVG+ FI KGIT EN AGP KHQAVA+RSG+D S F+N SFVAYQDT
Sbjct  307  IDGWTTFQSATFAVVGSNFIAKGITFENSAGPSKHQAVAVRSGADFSAFYNCSFVAYQDT  366

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYARKP  NQ+N+FTAQGR+DPNQNT
Sbjct  367  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARKPDPNQQNLFTAQGRQDPNQNT  426

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI+N K+AAAADLIPV+SSFK+YLGRPWK+YSRTV++ S +  LIDPAGWL W+G FA
Sbjct  427  GISIINSKIAAAADLIPVKSSFKSYLGRPWKQYSRTVYLQSLIEDLIDPAGWLPWNGTFA  486

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY+NRGPGSNTSARV WPGYR++ NT+EA+QFTV NFI G  W+ +TG+PF+ 
Sbjct  487  LDTLYYGEYKNRGPGSNTSARVTWPGYRVITNTTEASQFTVRNFIQGNDWLNSTGIPFFP  546

Query  82   NLT  74
            +L+
Sbjct  547  DLS  549



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   404 bits (1038),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 184/243 (76%), Positives = 216/243 (89%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+S+T AVVG  FI KGIT EN AGP KHQAVA+R+G+D S F+  SFVAYQDT
Sbjct  315  VDGWTTFQSSTFAVVGDKFIAKGITFENSAGPSKHQAVAVRNGADFSAFYQCSFVAYQDT  374

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAAVVFQNCNLYARKP   QKN+FTAQGREDPNQNT
Sbjct  375  LYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNCNLYARKPDPKQKNLFTAQGREDPNQNT  434

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCK+AAAADLIPVQS+FK+YLGRPWK+YSRTV++ S + +LIDPAGWLEW+G FA
Sbjct  435  GISILNCKIAAAADLIPVQSTFKSYLGRPWKKYSRTVYLNSFIDNLIDPAGWLEWNGTFA  494

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TL+YGEY+NRGPGSNTSARV WPGY+++ N +EA+QFTV  FI G +W+ +TGVPF++
Sbjct  495  LDTLFYGEYKNRGPGSNTSARVTWPGYKVITNATEASQFTVRQFIQGNEWLNSTGVPFFL  554

Query  82   NLT  74
            +L+
Sbjct  555  DLS  557



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT ENYAGP KHQAVALRS SD S F+  SF+ YQDT
Sbjct  317  VDGWTTFRSATVAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDT  376

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGT+DFIFGNAAVVFQNCNLYARKP +NQ+NIFTAQGREDPNQNT
Sbjct  377  LYVHSLRQFYRDCDVYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNT  436

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DLIPV SSF+ YLGRPWK YSRTVF+ S +G LI+P GWLEW+G FA
Sbjct  437  GISILNCKVEAASDLIPVLSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFA  496

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNT+ RV WPGYR++ N +EA+QFTV  FI G  W+ +T +PF+ 
Sbjct  497  LDTLYYGEYLNRGPGSNTTMRVTWPGYRVITNATEASQFTVERFIQGSSWLNSTEIPFFS  556

Query  82   NLT  74
             LT
Sbjct  557  GLT  559



>gb|AAF35897.1|AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
Length=277

 Score =   393 bits (1010),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/243 (75%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF+SATVAVVG GFI KG+T EN AGP KHQAVALR+G+D S F+  SFVAYQDT
Sbjct  35   VDGWTTFQSATVAVVGDGFIAKGVTFENSAGPSKHQAVALRNGADFSAFYQCSFVAYQDT  94

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAA V QNCNLYARKP  NQ+N+FTAQGREDPNQ+T
Sbjct  95   LYVHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYARKPNKNQRNLFTAQGREDPNQST  154

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI+NCKVAAAADLIPV+S F+NYLGRPWK YSRTVF+ S +  LI+PAGWLEW+G FA
Sbjct  155  GISIINCKVAAAADLIPVKSEFRNYLGRPWKMYSRTVFLNSLMEDLIEPAGWLEWNGTFA  214

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG+NTS RV WPGYR++ N++EA+QFTV NFI G +W+ + G+PF+ 
Sbjct  215  LDTLYYGEYNNRGPGANTSGRVTWPGYRVITNSTEASQFTVQNFIQGNEWLNSYGIPFFS  274

Query  82   NLT  74
             LT
Sbjct  275  GLT  277



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/243 (76%), Positives = 212/243 (87%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + GWTTFRSATVAVVG GF+ KGIT EN AGP+ HQAVALRSGSDLS F+  SFV YQDT
Sbjct  315  VGGWTTFRSATVAVVGNGFVAKGITFENSAGPDMHQAVALRSGSDLSAFYQCSFVGYQDT  374

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNC++YARKP +NQ+NIFTAQGREDPNQNT
Sbjct  375  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCSIYARKPNSNQQNIFTAQGREDPNQNT  434

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI+N KV AAADLIPV+ SFK YLGRPWKEYSRTVF+ S +  ++DP GWLEW+G FA
Sbjct  435  GISIMNSKVTAAADLIPVKKSFKTYLGRPWKEYSRTVFLRSYIDDVVDPVGWLEWNGAFA  494

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTSARV WPGYR++N T+EA+QFTV  FI G +W+ ATG+PF++
Sbjct  495  LSTLYYGEYMNRGPGSNTSARVTWPGYRVINSTTEASQFTVRPFIQGSEWLNATGIPFFL  554

Query  82   NLT  74
             L+
Sbjct  555  GLS  557



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT ENYAGP KHQAVALRS SD S F+  SF+ YQDT
Sbjct  351  VDGWTTFRSATVAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDT  410

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGT+DFIFGNAAVVFQNCNLYARKP +NQ+NIFTAQGREDPNQNT
Sbjct  411  LYVHSLRQFYRECDIYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNT  470

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DLIPV SSF+ YLGRPWK +SRTVF+ S +G L++P GWLEW+G FA
Sbjct  471  GISILNCKVEAASDLIPVLSSFRTYLGRPWKLHSRTVFLRSFIGQLVEPVGWLEWNGTFA  530

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNT+ RV WPGYR++ N +EA+QFTV  FI G  W+ +TG+PF+ 
Sbjct  531  LDTLYYGEYLNRGPGSNTTGRVTWPGYRVITNATEASQFTVEEFIQGSSWLNSTGIPFFS  590

Query  82   NLTA  71
             LT+
Sbjct  591  GLTS  594



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT ENYAGP KHQAVALRS SD S F+  SF+ YQDT
Sbjct  370  VDGWTTFRSATVAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDT  429

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYRDCDVYGT+DFIFGNAAVVFQNCNLYARKP +NQ+NIFTAQGREDPNQNT
Sbjct  430  LYVHSLRQFYRDCDVYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNT  489

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DLIPV SSF+ YLGRPWK YSRTVF+ S +G LI+P GWLEW+G FA
Sbjct  490  GISILNCKVEAASDLIPVLSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFA  549

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNT+ RV WPGYR++ N +EA+QFTV  FI G  W+ +T +PF+ 
Sbjct  550  LDTLYYGEYLNRGPGSNTTMRVTWPGYRVITNATEASQFTVERFIQGSSWLNSTEIPFFS  609

Query  82   NLT  74
             LT
Sbjct  610  GLT  612



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   402 bits (1034),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/243 (77%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVGTGFI KGIT ENYAGP KHQAVALRS SD S F+  SF+ YQDT
Sbjct  347  VDGWTTFRSATVAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDT  406

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGT+DFIFGNAAVVFQNCNLYARKP +NQ+NIFTAQGREDPNQNT
Sbjct  407  LYVHSLRQFYRECDVYGTIDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNT  466

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV AA+DLIPV SSF+ YLGRPWK YSRTVF+ S +G LI+P GWLEW+G FA
Sbjct  467  GISILNCKVEAASDLIPVLSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFA  526

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNT+ RV WPGYR++ N +EA+QFTV  FI G  W+ +T +PF+ 
Sbjct  527  LDTLYYGEYLNRGPGSNTTMRVTWPGYRVITNATEASQFTVEGFIQGSSWLNSTEIPFFS  586

Query  82   NLT  74
             LT
Sbjct  587  GLT  589



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   400 bits (1029),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 208/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI + +TIEN AGP KHQAVALRSGSDLS F+  SFV YQDT
Sbjct  341  VDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQDT  400

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLYAR+P ANQKNIFTAQGREDPNQNT
Sbjct  401  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARRPNANQKNIFTAQGREDPNQNT  460

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKV  AADL PV+SSF  YLGRPWKEYSRTVF+ S L  LI+PAGWLEW G F 
Sbjct  461  GISILNCKVTLAADLSPVKSSFHTYLGRPWKEYSRTVFIGSYLDDLINPAGWLEWSGNFG  520

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N+GPGS+T+ RVKWPGYR++N+S EA QFTV +FI G  W+ +TG+P+  
Sbjct  521  LSTLYYGEYMNKGPGSDTTNRVKWPGYRVINSSTEATQFTVASFIQGGGWLSSTGIPYSA  580

Query  82   NLT  74
             L+
Sbjct  581  GLS  583



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   399 bits (1026),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 208/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTFRSATVAVVG GFI KGITIEN AGP KHQAVALRSGSDLS F+  SFVAYQDT
Sbjct  318  VDGFTTFRSATVAVVGNGFIAKGITIENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDT  377

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAA VFQ CNLYARKP  NQKNIFTAQGREDPNQNT
Sbjct  378  LYVHSLRQFYRECDIYGTVDFIFGNAAAVFQACNLYARKPNPNQKNIFTAQGREDPNQNT  437

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILN K+AAAADLIP++SSFK YLGRPWKE+SRTV M S +   +DPAGWLEW+G FA
Sbjct  438  GISILNSKIAAAADLIPLKSSFKTYLGRPWKEFSRTVIMRSYIDDSVDPAGWLEWNGTFA  497

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRG GSNTSARV WPGYR++N+S EA+QFT G FI G  W+ +T +PF +
Sbjct  498  LSTLYYGEYLNRGAGSNTSARVTWPGYRVINSSTEADQFTAGAFIQGNDWLNSTDIPFSL  557

Query  82   NL  77
             L
Sbjct  558  GL  559



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   399 bits (1026),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVA+VG GF+++ +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  324  VDGWTTFRSATVAIVGNGFLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CDVYGT+DFIFGNA VV QNCNLYARKP++NQKNIFTAQGREDPNQNT
Sbjct  384  LYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCKVAAA+DL PVQS+F  YLGRPWK YSRTV+M S L SLI+PAGWLEWDG+FA
Sbjct  444  GISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGS+T+ RVKWPGYR++N+S EA+ FTV +FI G QW+ +T VPF  
Sbjct  504  LSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTA  563

Query  82   NL  77
             L
Sbjct  564  GL  565



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   399 bits (1025),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVA+VG GF+++ +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  323  VDGWTTFRSATVAIVGNGFLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  382

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CDVYGT+DFIFGNA VV QNCNLYARKP++NQKNIFTAQGREDPNQNT
Sbjct  383  LYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNT  442

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCKVAAA+DL PVQS+F  YLGRPWK YSRTV+M S L SLI+PAGWLEWDG+FA
Sbjct  443  GISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFA  502

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGS+T+ RVKWPGYR++N+S EA+ FTV +FI G QW+ +T VPF  
Sbjct  503  LSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTA  562

Query  82   NL  77
             L
Sbjct  563  GL  564



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVA+VG GF+++ +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  324  VDGWTTFRSATVAIVGNGFLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CDVYGT+DFIFGNA VV QNCNLYARKP++NQKN+FTAQGREDPNQNT
Sbjct  384  LYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNCNLYARKPLSNQKNVFTAQGREDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCKVAAA+DL PVQS+F  YLGRPWK YSRTV+M S L SLI+PAGWLEWDG+FA
Sbjct  444  GISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGS+T+ RVKWPGYR++N+S EA+ FTV +FI G QW+ +T VPF  
Sbjct  504  LSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTA  563

Query  82   NL  77
             L
Sbjct  564  GL  565



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   394 bits (1012),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GF+++ ITIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  325  VDGWTTFRSATVAVVGDGFLMRDITIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  384

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+C+VYGTVDFIFGNAAVV QNCNLYARKP+ NQ+NIFTAQGREDPNQNT
Sbjct  385  LYVHSLRQFYRECNVYGTVDFIFGNAAVVLQNCNLYARKPLPNQQNIFTAQGREDPNQNT  444

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAAADLIPVQ++F  YLGRPWKEYSRTVFM S L SLI PAGWLEW+G FA
Sbjct  445  GISIQRCKVAAAADLIPVQANFSTYLGRPWKEYSRTVFMQSYLDSLISPAGWLEWNGSFA  504

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNTS+RV WPG+R++ + +EA+ FT   F+ G QW+ +T VPF +
Sbjct  505  LSTLYYGEYMNRGPGSNTSSRVAWPGFRVIGDAAEASNFTAAAFVQGDQWLGSTSVPFSL  564

Query  82   NL  77
             L
Sbjct  565  GL  566



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   377 bits (967),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = -2

Query  763  AVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVHSLRQFYRD  584
            AVVG GFI KGIT EN AGP KHQAVALRSG+D S F+  SFV YQDTLYVHSLRQFYR+
Sbjct  7    AVVGDGFIAKGITFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRE  66

Query  583  CDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISILNCKVAAA  404
            CDVYGTVDFIFGNAAVV QNCNLYARKP  NQKNIFTAQGREDPNQNTGISILNCKV A 
Sbjct  67   CDVYGTVDFIFGNAAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAG  126

Query  403  ADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNR  224
            +DLIPV+S+F  YLGRPWKEYSRTV++ S +  L+DPAGWLEW+G FAL TLYYGEY NR
Sbjct  127  SDLIPVKSNFTTYLGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNR  186

Query  223  GPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTA  71
            GPGSNTSARV WPGYR++N+S EA+QFTVG FI G  W+ +T +P+++ LT+
Sbjct  187  GPGSNTSARVTWPGYRVINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGLTS  238



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   399 bits (1026),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTT++SATVAV G GFI  GITIENYAGPEKHQAVALR G+D+S F+  SFV YQDT
Sbjct  712  VDGWTTYQSATVAVAGQGFIATGITIENYAGPEKHQAVALRCGADMSAFYQCSFVGYQDT  771

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYV SLRQFYR+CD+YGTVDF+FGNAAVVFQN NLYAR+P+A Q+NIFTAQGR+DPNQNT
Sbjct  772  LYVFSLRQFYRECDIYGTVDFVFGNAAVVFQNSNLYARRPLAVQQNIFTAQGRDDPNQNT  831

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISILNCKVAA +DL+PV S F  YLGRPWK YSRTV++LSN+ S++DPAGWLEW+G F 
Sbjct  832  GISILNCKVAAGSDLLPVISQFHTYLGRPWKAYSRTVYLLSNMESVVDPAGWLEWNGTFG  891

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNT+ RV WPGYR++N+S EA  F V NFI G QW+P TG+PFY+
Sbjct  892  LSTLYYGEYSNRGPGSNTTGRVNWPGYRVINSSTEAGLFAVDNFIQGSQWLPLTGLPFYL  951

Query  82   NLTA  71
            +LTA
Sbjct  952  SLTA  955



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   387 bits (993),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 209/241 (87%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG+TTFRSAT+AVVG GFI K +T+ENYAGP KHQAVALRSGSD S F+  SF+ YQDTL
Sbjct  335  DGYTTFRSATLAVVGAGFIAKDLTVENYAGPAKHQAVALRSGSDFSAFYRCSFIGYQDTL  394

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y HSLRQFYR+CD+YGTVDFIFGNAAVVFQ CNLYAR P+ NQKN++TAQ R+DPNQNTG
Sbjct  395  YTHSLRQFYRECDIYGTVDFIFGNAAVVFQLCNLYARTPLPNQKNVYTAQSRKDPNQNTG  454

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISILNCKVA AADL   ++++K +LGRPWK+YSRT+FMLS +  ++DPAGWLEW G+FAL
Sbjct  455  ISILNCKVAPAADLAANKTAYKTFLGRPWKDYSRTIFMLSYIDDVVDPAGWLEWSGDFAL  514

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY+NRGPG+NTSARV WPGY ++ N+S+A+ FTVG FILG +W+ + G+P+Y++
Sbjct  515  STLYYGEYKNRGPGANTSARVTWPGYNVINNSSDASNFTVGKFILGGEWLQSYGIPYYLD  574

Query  79   L  77
            L
Sbjct  575  L  575



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   373 bits (958),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 196/230 (85%), Gaps = 1/230 (0%)
 Frame = -2

Query  763  AVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVHSLRQFYRD  584
            AVVG GF+ + ITIEN AGP KHQAVALR G+DLS F+  SFV YQDTLYVHSLRQFYRD
Sbjct  10   AVVGDGFLARDITIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRD  69

Query  583  CDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISILNCKVAAA  404
            CDVYGTVDFIFG+AAVVFQNCNLYARKP  NQKNIFTAQGREDPNQNTGISI  CKVAAA
Sbjct  70   CDVYGTVDFIFGDAAVVFQNCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAA  129

Query  403  ADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNR  224
            +DLIPVQS+F  YLGRPWK+YSRTVFM S LGSLI+PAGWLEWDG+FAL TLYYGEY N 
Sbjct  130  SDLIPVQSNFSTYLGRPWKQYSRTVFMQSYLGSLINPAGWLEWDGDFALSTLYYGEYMNL  189

Query  223  GPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            GPGSNTS RV WPGYR++ + +EA+ FTV +FI G QW+ AT VPF   L
Sbjct  190  GPGSNTSRRVTWPGYRVITSAAEASNFTVQSFIQGDQWLGATSVPFTSGL  239



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   373 bits (958),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = -2

Query  772  ATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVHSLRQF  593
            ++ AVVG GF+++ ITIEN AGP K QAVALR G+DLS F+  SFV YQDTLYVHSLRQF
Sbjct  6    SSAAVVGDGFLMRDITIENAAGPSKLQAVALRVGADLSAFYKCSFVGYQDTLYVHSLRQF  65

Query  592  YRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISILNCKV  413
            YR+CDVYGT+DFIFG+AAVV QNCNLYARKPM+NQ+N+FTAQGREDPNQNTGISI  CKV
Sbjct  66   YRECDVYGTIDFIFGDAAVVLQNCNLYARKPMSNQQNVFTAQGREDPNQNTGISIHKCKV  125

Query  412  AAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEY  233
            AAAADLIPVQS+F  YLGRPWKE+SRTVFM S L +LIDPAGWLEW+G+FAL TLYYGEY
Sbjct  126  AAAADLIPVQSNFSTYLGRPWKEFSRTVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEY  185

Query  232  QNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             NRGPGSNT+ RVKWPGYR++N T+EA+ FTV +FI G QW+ +T VPF   L
Sbjct  186  MNRGPGSNTTGRVKWPGYRVINSTAEASNFTVTSFIQGDQWLGSTSVPFTSGL  238



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 204/242 (84%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  185  VDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  244

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+R+CD+YGT+DFIFGN+AVVFQ+CNLYAR+P+ NQ N++TAQGREDPNQNT
Sbjct  245  LYVHSLRQFFRECDIYGTIDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNT  304

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DL+ VQSSFK YLGRPWK+YSRTVFM S L S+++PAGWLEW G FA
Sbjct  305  GISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFA  364

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQN GPG++TS RVKW GYR++ + SEA+ FTVGNFI G  W+  T VPF V
Sbjct  365  LDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTV  424

Query  82   NL  77
             L
Sbjct  425  GL  426



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   380 bits (976),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 204/242 (84%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  343  VDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  402

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+R+CD+YGT+DFIFGN+AVVFQ+CNLYAR+P+ NQ N++TAQGREDPNQNT
Sbjct  403  LYVHSLRQFFRECDIYGTIDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNT  462

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DL+ VQSSFK YLGRPWK+YSRTVFM S L S+++PAGWLEW G FA
Sbjct  463  GISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFA  522

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQN GPG++TS RVKW GYR++ + SEA+ FTVGNFI G  W+  T VPF V
Sbjct  523  LDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTV  582

Query  82   NL  77
             L
Sbjct  583  GL  584



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 204/242 (84%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  324  VDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+R+CD+YGT+DFIFGN+AVVFQ+CNLYAR+P+ NQ N++TAQGREDPNQNT
Sbjct  384  LYVHSLRQFFRECDIYGTIDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DL+ VQSSFK YLGRPWK+YSRTVFM S L S+++PAGWLEW G FA
Sbjct  444  GISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQN GPG++TS RVKW GYR++ + SEA+ FTVGNFI G  W+  T VPF V
Sbjct  504  LDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTV  563

Query  82   NL  77
             L
Sbjct  564  GL  565



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score =   379 bits (973),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 203/241 (84%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATVAV+G GFI KGIT EN AGP K+QAVALRSGSDLS F+  SFVAYQDTL
Sbjct  317  DGHTTFRSATVAVMGDGFIAKGITFENSAGPSKNQAVALRSGSDLSAFYKCSFVAYQDTL  376

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHSLRQFYR+CD+YGTVD IFGNAA VFQ C+LYARKP  +Q+N+FTAQGR DPNQNTG
Sbjct  377  YVHSLRQFYRECDIYGTVDCIFGNAAAVFQACSLYARKPNPDQENVFTAQGRADPNQNTG  436

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISILNCK+ A +DLIPV SSFK YLGRPWKEYSRTV M S +  L+DPAGWLEW+G FAL
Sbjct  437  ISILNCKIRADSDLIPVISSFKTYLGRPWKEYSRTVIMRSYIDDLVDPAGWLEWNGNFAL  496

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGE+ NRGPGS+TS RV WPGYR++ + ++ANQFTVG FI G QW+ +T +PF + 
Sbjct  497  NTLYYGEFLNRGPGSDTSRRVTWPGYRVITSFADANQFTVGAFIQGNQWLNSTDIPFNLG  556

Query  79   L  77
            L
Sbjct  557  L  557



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 196/232 (84%), Gaps = 1/232 (0%)
 Frame = -2

Query  769  TVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVHSLRQFY  590
            T+AVVG GFI KGIT EN AGP KHQAVALRSGSDLS F+  SF+ YQDTLY HSLRQFY
Sbjct  321  TLAVVGNGFIAKGITFENSAGPSKHQAVALRSGSDLSTFYKCSFIGYQDTLYAHSLRQFY  380

Query  589  RDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISILNCKVA  410
            R+CDVYGT+DFIFGNAAVV QNCN YAR+P  NQ NIFTAQGREDPNQNTGISILNCKV 
Sbjct  381  RECDVYGTIDFIFGNAAVVLQNCNFYARRPNPNQHNIFTAQGREDPNQNTGISILNCKVT  440

Query  409  AAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQ  230
            AA+DL PV+SSFK YLGRPWKEYSRTVFM S +  L+DPAGWLEW+  FAL TLYYGEY 
Sbjct  441  AASDLSPVKSSFKTYLGRPWKEYSRTVFMKSYIDDLVDPAGWLEWNATFALTTLYYGEYM  500

Query  229  NRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            N GPGSNTSARV WPGYR++N+S EA++F+V  FI G +W+ +T VP++ NL
Sbjct  501  NHGPGSNTSARVTWPGYRVINSSVEASRFSVDAFIQGGEWLNSTQVPYFANL  552



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   369 bits (946),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 202/242 (83%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F   SFV YQDT
Sbjct  165  VDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFHRCSFVGYQDT  224

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+R+CD+YGTVDFIFGN+AVVFQ+CNLYAR+P+ NQ N +TAQGREDPNQNT
Sbjct  225  LYVHSLRQFFRECDIYGTVDFIFGNSAVVFQSCNLYARRPLPNQSNAYTAQGREDPNQNT  284

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DL  VQSSFK YLGRPWK+YSRTVFM S L S+++PAGWLEW+G FA
Sbjct  285  GISIQKCKVAAASDLAAVQSSFKTYLGRPWKQYSRTVFMQSQLDSVVNPAGWLEWNGNFA  344

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQN G G++T+ RVKW GYR++ ++SEA+ FTVG+FI G  W+  T VPF V
Sbjct  345  LDTLYYGEYQNTGDGASTANRVKWKGYRVITSSSEASTFTVGSFIDGDVWLAGTSVPFSV  404

Query  82   NL  77
             L
Sbjct  405  GL  406



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 197/242 (81%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  335  VDGYTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  394

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+RDCD+YGT+DF+FGNAAVV Q CNLYARKP+ NQ NIFTAQGREDPNQNT
Sbjct  395  LYVHSLRQFFRDCDIYGTIDFVFGNAAVVLQGCNLYARKPLPNQSNIFTAQGREDPNQNT  454

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAAADL+   SS K YLGRPWK+YSRTVF+ S L SLI PAGWLEWDG FA
Sbjct  455  GISIHRCKVAAAADLLQSSSSTKTYLGRPWKQYSRTVFLQSELDSLIAPAGWLEWDGNFA  514

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N GPG+ TS RVKW GYR++ + +EA+ FTVG+FI G  W+  T +PF  
Sbjct  515  LDTLYYGEYMNTGPGAGTSGRVKWKGYRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTT  574

Query  82   NL  77
             L
Sbjct  575  GL  576



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   364 bits (935),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDG TTFRSATVA+VG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  187  IDGSTTFRSATVALVGNNFLGRDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  246

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+RDCD+YGT+DFIFGNAAVVFQ+CNLYARKP+ NQ NIFTAQGREDPNQNT
Sbjct  247  LYVHSLRQFFRDCDIYGTIDFIFGNAAVVFQSCNLYARKPLPNQSNIFTAQGREDPNQNT  306

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DL   +SS K YLGRPWK+YSRTVF+ S L SLIDPAGWLEW+G FA
Sbjct  307  GISIQRCKVAAASDLAGQESSTKTYLGRPWKQYSRTVFLQSELDSLIDPAGWLEWNGSFA  366

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N G G+ T+ RVKW GYR++ + +EA+ FTVG+FI G  W+  T +PF  
Sbjct  367  LDTLYYGEYMNTGAGAGTAGRVKWKGYRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTT  426

Query  82   NL  77
             L
Sbjct  427  GL  428



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   357 bits (917),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 196/240 (82%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  21   GFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLY  80

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  81   VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  140

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL PV SSFK YLGRPWKEYSRTV++ + L +L+D AGWLEWDG FAL 
Sbjct  141  SIHNSRVMAATDLKPVLSSFKTYLGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALN  200

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPGS+TS RVKW GYR++ + +EA++F+V NFI GQ W+PATGVPF   L
Sbjct  201  TLYYGEYKNFGPGSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  260



>gb|EMT27728.1| Pectinesterase [Aegilops tauschii]
Length=389

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 196/242 (81%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            ID +TTFRSAT+AV+GTGF+ + +T+EN AGP KHQAVALR  +DLS F+  SF  YQDT
Sbjct  147  IDNYTTFRSATLAVIGTGFLARDLTVENAAGPAKHQAVALRVNADLSAFYRCSFAGYQDT  206

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCDVYGTVDF+FG+AAVV QNCNLYAR+P   QKN+FTAQGREDPNQNT
Sbjct  207  LYAHSLRQFYRDCDVYGTVDFVFGDAAVVLQNCNLYARRPGPGQKNVFTAQGREDPNQNT  266

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GI++  CK+AAAADL+PVQ++F +YLGRPWK YSRTVFM S + SL+ P GWLEW+G FA
Sbjct  267  GIAVQGCKIAAAADLVPVQANFSSYLGRPWKTYSRTVFMQSKMESLVHPRGWLEWNGTFA  326

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY NRGPG+NTSARV WPGYR++ T ++A  FT   FI G  W+ +T  P+ +
Sbjct  327  LDTLYYAEYMNRGPGANTSARVAWPGYRVITTAADAGNFTAQAFIQGDLWLNSTSFPYSL  386

Query  82   NL  77
             L
Sbjct  387  GL  388



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 197/242 (81%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  325  VDGSTTFRSATVAVVGNNFLARDLTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  384

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+R+CD+YGT+DF+FGN+A V Q+CNLYAR+P+ NQ NI+TAQGR DPNQNT
Sbjct  385  LYVHSLRQFFRECDIYGTIDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNT  444

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAA+DL  VQSSFK YLGRPWK+YSRTVFM S L S+++PAGWL WDG FA
Sbjct  445  GISIQKCKVAAASDLAAVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLAWDGTFA  504

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQN GPG+ TS RV W GYR++ + SEA+ FTVG+FI G  W+  T +PF  
Sbjct  505  LDTLYYGEYQNTGPGAGTSGRVTWKGYRVITSASEASTFTVGSFIDGDVWLAGTSIPFSA  564

Query  82   NL  77
             L
Sbjct  565  GL  566



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 195/240 (81%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATVAV G GFI + +T +N AGP+KHQAVALRSGSDLSVF+  SF  YQDTL
Sbjct  290  DGSTTFRSATVAVTGGGFIARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTL  349

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+ QKN  TAQGR+DPN+NTG
Sbjct  350  YVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRKDPNENTG  409

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N +V AA+DL PVQ SFK YLGRPW++YSRTVFM ++L SLIDPAGWLEW G FAL
Sbjct  410  ISIHNSRVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGNFAL  469

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             TLYYGEY N G G++TS RVKWPG+ +++ S+A +FTVGNF+ G  WI A GVPF   L
Sbjct  470  STLYYGEYMNTGAGASTSRRVKWPGFHVMSASDAGKFTVGNFLGGGSWIAAAGVPFTSGL  529



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 196/241 (81%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI + +T EN AGP+K QAVALRSGSDLSVF+  SF  YQDTL
Sbjct  276  DGSTTFRSATFAVTGDGFIARDMTFENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTL  335

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYR+CD+YGTVDFIFG+AAVV QNCN++ RKPM+ QKN  TAQGR DPN+NTG
Sbjct  336  YVYSQRQFYRNCDIYGTVDFIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTG  395

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI +  V AA+DL PVQ SF+ YLGRPW+EYSRTVFM ++L SLIDPAGWLEW G FAL
Sbjct  396  ISIHDSAVTAASDLKPVQGSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFAL  455

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY N GPG++TS RVKWPGY ++ + +EA++FTVGNF+ G  WIPAT VPF   
Sbjct  456  STLYYGEYMNTGPGADTSQRVKWPGYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTSG  515

Query  79   L  77
            L
Sbjct  516  L  516



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTFRSATVAVVG  FI + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  320  VDGYTTFRSATVAVVGNNFIARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  379

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+RDCDVYGTVDF+FGN+AVV Q C+LYAR+P+A Q N +TAQGR DPNQNT
Sbjct  380  LYVHSLRQFFRDCDVYGTVDFVFGNSAVVLQGCSLYARRPLAGQSNTYTAQGRTDPNQNT  439

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GIS+  CKV+AA+DL  VQSSF+ YLGRPW++YSRTVFM S + S+++PAGWLEW+G FA
Sbjct  440  GISVQRCKVSAASDLAAVQSSFRTYLGRPWQQYSRTVFMESQMDSVVNPAGWLEWNGNFA  499

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEYQN G G+ TS RVKW GYR++ + SEA+ FTVG+FI G  W+P T VPF  
Sbjct  500  LDTLYYGEYQNTGAGAATSNRVKWKGYRVITSASEASAFTVGSFIDGDVWLPRTSVPFST  559

Query  82   NL  77
             L
Sbjct  560  GL  561



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 197/240 (82%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  278  GFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  337

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAV+ QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  338  VHSQRQFYKECYIYGTVDFIFGNAAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  397

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A++DL PV SSFK YLGRPWKEYSRTVF+ + L SL+DPAGWLEWDG FAL 
Sbjct  398  SIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALN  457

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPG++T  RVKW GYR++ +S EA++FTV NFI G+ W+PATGVPFY  L
Sbjct  458  TLYYGEYRNSGPGASTRGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   360 bits (925),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 195/240 (81%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  236  GSTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  295

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C V+GTVDFIFGNAAVV QNC +YAR+PM  QKN  TAQGR DPNQNTGI
Sbjct  296  VHSQRQFYKECYVFGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGI  355

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A+ADL+PV  SF+++LGRPWKEYSRTVFM + L SL+DPAGWLEWDG FAL 
Sbjct  356  SIHNSRVMASADLVPVLGSFRSFLGRPWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALN  415

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPGS+TS RV+W GYR++ + +EA +FTV NFI GQ W+PATGVPF   L
Sbjct  416  TLYYGEYRNTGPGSSTSRRVRWRGYRVITSAAEAGRFTVANFIAGQSWLPATGVPFTAGL  475



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVA VG GFI +G+TI N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  21   GSTTFNSATVAAVGDGFIGRGLTIRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLY  80

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  81   VHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGI  139

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  VQSS K YLGRPWKEYSRTVFM + L SLI+PAGW+EW G FALK
Sbjct  140  SIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALK  199

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ ++SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  200  TLYYGEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  259



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 196/240 (82%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+   F  YQDTLY
Sbjct  284  GYTTFNSATVAVTGEGFIAQGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLY  343

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAA V QNC +YAR+PM+ QKN  TAQGR DPNQNTGI
Sbjct  344  VHSQRQFYKECYIYGTVDFIFGNAAAVLQNCMIYARRPMSKQKNTITAQGRTDPNQNTGI  403

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AAADL PV SSFK YLGRPWK+YSRTVFM + L SL+DPAGWLEWDG+FAL 
Sbjct  404  SIHNSRVMAAADLKPVLSSFKTYLGRPWKQYSRTVFMQTYLDSLVDPAGWLEWDGDFALN  463

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GP ++TS RVKW GYR++ ++SEA+QFTV NFI GQ W+PATGV F   L
Sbjct  464  TLYYGEYRNLGPAASTSRRVKWSGYRVITSSSEASQFTVANFIAGQSWLPATGVRFTAGL  523



>gb|EMS45437.1| Pectinesterase [Triticum urartu]
Length=311

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 195/242 (81%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +D +TTFRSAT+AV+GTGF+ + +T+EN AGP KHQAVALR  +DLS F+  SF  YQDT
Sbjct  69   VDNYTTFRSATLAVIGTGFLARDLTVENAAGPAKHQAVALRVNADLSAFYRCSFAGYQDT  128

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCDVYGTVDF+FG+AAVV QNC+LYAR+P   QKN+FTAQGREDPNQNT
Sbjct  129  LYAHSLRQFYRDCDVYGTVDFVFGDAAVVLQNCSLYARRPGPGQKNVFTAQGREDPNQNT  188

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GI++  CK+AAAADL+PV S+F +YLGRPWK YSRTVFM S + SL+ P GWLEW+G FA
Sbjct  189  GIAVQGCKIAAAADLVPVLSNFSSYLGRPWKTYSRTVFMQSKMESLVHPRGWLEWNGTFA  248

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY NRGPG+NTSARV WPGYR++ + ++A  FT   FI G  W+ +T  P+ +
Sbjct  249  LDTLYYAEYMNRGPGANTSARVAWPGYRVITSDADAGNFTAQAFIQGDLWLNSTSFPYTL  308

Query  82   NL  77
             L
Sbjct  309  GL  310



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTFRSATVAVVG  F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  322  VDGYTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  381

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+RDCDVYGT+DF+FGNAAVV Q CNLYARKP+ NQ NIFTAQGREDPNQNT
Sbjct  382  LYVHSLRQFFRDCDVYGTIDFVFGNAAVVLQGCNLYARKPLPNQSNIFTAQGREDPNQNT  441

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI  CKVAAAADL   QSS K YLGRPWK+YSRTV++ S L SL+DPAGWLEW+G FA
Sbjct  442  GISIQRCKVAAAADLAAAQSSTKTYLGRPWKQYSRTVYLQSELDSLVDPAGWLEWNGSFA  501

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N GPG+ TS RVKW GYR++ + +EA+ FTVGNFI G  W+  T +PF  
Sbjct  502  LDTLYYGEYMNTGPGAGTSGRVKWKGYRVITSAAEASAFTVGNFIDGDLWLAGTSIPFTT  561

Query  82   NL  77
             L
Sbjct  562  GL  563



>ref|XP_004307817.2| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 195/242 (81%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSG+DLSVF+  SF  YQDT
Sbjct  277  VGGSTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDT  336

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS RQFY++C +YGTVDFIFGNAAVV QNC +YARKPM+ QKN  TAQGR DPNQNT
Sbjct  337  LYTHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNT  396

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + ++ AAADL PV  S K +LGRPWK YSRTVF+ S L SL+DPAGWLEWDG FA
Sbjct  397  GISIHDSRIMAAADLAPVIKSVKTFLGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFA  456

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N+GPGS TS RVKW GYR++ ++SEA++FTVGN I G  W+PATGVPF  
Sbjct  457  LKTLYYGEYKNKGPGSGTSGRVKWGGYRVITSSSEASKFTVGNLIAGSSWLPATGVPFTS  516

Query  82   NL  77
             L
Sbjct  517  GL  518



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 197/243 (81%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +D  TTFRSAT+AVVGTGF+ + IT+EN AGP KHQAVALR  +DLS F+  SF  YQDT
Sbjct  337  VDNSTTFRSATLAVVGTGFLARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDT  396

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCD+YGTVDFIFG+AAVV QNCNLYAR+P  NQKN+FTAQGREDPNQNT
Sbjct  397  LYAHSLRQFYRDCDIYGTVDFIFGDAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNT  456

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GI+I  CKVAAAADL+PVQ++F +YLGRPWK YSRTVF+ S + SLI P GWLEW+G FA
Sbjct  457  GIAIQGCKVAAAADLVPVQANFSSYLGRPWKTYSRTVFLQSKIDSLIHPRGWLEWNGSFA  516

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY NRG G++TSARV WPGY +L N ++A  FTV NF+ G  W+ ++  P+ +
Sbjct  517  LDTLYYAEYMNRGDGADTSARVSWPGYHVLTNATDAANFTVLNFVQGDLWLNSSSFPYIL  576

Query  82   NLT  74
             L+
Sbjct  577  GLS  579



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 197/243 (81%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +D  TTFRSAT+AVVGTGF+ + IT+EN AGP KHQAVALR  +DLS F+  SF  YQDT
Sbjct  337  VDNSTTFRSATLAVVGTGFLARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDT  396

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCD+YGTVDFIFG+AAVV QNCNLYAR+P  NQKN+FTAQGREDPNQNT
Sbjct  397  LYAHSLRQFYRDCDIYGTVDFIFGDAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNT  456

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GI+I  CKVAAAADL+PVQ++F +YLGRPWK YSRTVF+ S + SLI P GWLEW+G FA
Sbjct  457  GIAIQGCKVAAAADLVPVQANFSSYLGRPWKTYSRTVFLQSKIDSLIHPRGWLEWNGSFA  516

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY NRG G++TSARV WPGY +L N ++A  FTV NF+ G  W+ ++  P+ +
Sbjct  517  LDTLYYAEYMNRGDGADTSARVSWPGYHVLTNATDAANFTVLNFVQGDLWLNSSSFPYIL  576

Query  82   NLT  74
             L+
Sbjct  577  GLS  579



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   358 bits (920),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 195/238 (82%), Gaps = 1/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTFRSATVAVVG+ F+ + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDT
Sbjct  231  VDGSTTFRSATVAVVGSNFLARDLTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDT  290

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQF+R+CD+YGT+DF+FGN+A V Q+CNLYAR+P+ NQ NI+TAQGR DPNQNT
Sbjct  291  LYVHSLRQFFRECDIYGTIDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNT  350

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GIS+  C+ AAA+DL  VQSSF+ YLGRPWK+YSRTVF+ S L S++DPAGWL WDG FA
Sbjct  351  GISVQKCRGAAASDLAAVQSSFRTYLGRPWKQYSRTVFIQSELDSVVDPAGWLAWDGTFA  410

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYR-ILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EYQN GPG+ TS RV W GYR +++ SEA+ FTVG+FI G  W+  T +PF
Sbjct  411  LDTLYYAEYQNTGPGAGTSGRVSWMGYRGVISASEASTFTVGSFIDGDVWLAGTSIPF  468



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 193/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI  GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  216  GSTTFNSATVAVTGEGFIASGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  275

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            +HS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN  TAQGR DPNQNTGI
Sbjct  276  IHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGI  335

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PV SSFK +LGRPWK+YSRTVF+ + L SL+DPAGWLEWDG FAL 
Sbjct  336  SIHNSRVMAASDLKPVLSSFKTFLGRPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALN  395

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GP S+TS RVKW GYR++ + +EA+QFTV NFI G+ W+PATGVPF   L
Sbjct  396  TLYYGEYKNMGPASSTSGRVKWRGYRVITSATEASQFTVANFIAGRSWLPATGVPFSSGL  455



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   360 bits (924),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 193/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATV V   GFI +GITI N AGPE HQAVALRSG+DLSVF+  SF AYQDTLY
Sbjct  291  GSTTFESATVIVTAEGFIARGITIRNTAGPENHQAVALRSGADLSVFYRCSFEAYQDTLY  350

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++CD+YGT+DFIFGNAA V Q+C +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  351  VHSQRQFYKECDIYGTIDFIFGNAAAVLQDCKIYARRPMVKQKNVVTAQGRTDPNQNTGI  410

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A+ DL+PV  SF+++LGRPWK YSRTV+M + + SLIDP GWLEWDG FAL 
Sbjct  411  SIHNSRVMASPDLVPVLGSFRSFLGRPWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALD  470

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPGSNT+ RV W GYR++ N SEA+ FTV NFI GQ W+PATGVPF   L
Sbjct  471  TLYYGEYRNSGPGSNTTRRVNWSGYRVITNASEASTFTVANFIAGQSWLPATGVPFTAGL  530



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 196/242 (81%), Gaps = 1/242 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG+TT+RSATVAV G GFI + IT EN AG  KHQAVALR GSD S F+  SF  YQDTL
Sbjct  360  DGYTTYRSATVAVNGNGFIARDITFENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTL  419

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHSLRQFYR+C+VYGTVDFIFGNAAVV QNCNL+ARKP+ANQ+ ++TAQGR+DPN+NTG
Sbjct  420  YVHSLRQFYRECNVYGTVDFIFGNAAVVLQNCNLFARKPLANQQIVYTAQGRQDPNENTG  479

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI NC+V AA+DLIPV+ SF  YLGRPW++YSRTVFM S LG LI PAGWLEW+G FAL
Sbjct  480  ISIQNCQVIAASDLIPVKRSFPAYLGRPWRQYSRTVFMQSYLGDLIQPAGWLEWNGNFAL  539

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGE+ NRGPG+  + RV+WPGYR + +S EA QFTV  FI G  W+P+TGV +   
Sbjct  540  NTLYYGEFMNRGPGAGVANRVRWPGYRAIRSSNEAKQFTVSQFIKGDSWLPSTGVKYVSG  599

Query  79   LT  74
             T
Sbjct  600  FT  601



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 192/236 (81%), Gaps = 0/236 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATVAV    F+ + +T EN AGP+KHQAVALRSGSDLSVF+  SF  YQDTL
Sbjct  292  DGSTTFRSATVAVTRDRFMARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTL  351

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+ Q+N  TAQGR DPN+NTG
Sbjct  352  YVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQRNTLTAQGRTDPNENTG  411

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N +V AA+DL P+Q SFK YLGRPW++YSRTVFM ++L SLIDP GWLEW G FAL
Sbjct  412  ISIHNSRVTAASDLRPLQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFAL  471

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             TLYYGEY N G G++TS RVKWPG+ +++ S+A +FTVGNF+ G  WIPATGVPF
Sbjct  472  STLYYGEYMNTGVGASTSQRVKWPGFHVMSASDAGKFTVGNFLGGDTWIPATGVPF  527



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 196/240 (82%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  281  GFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  341  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  400

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL PV SSFK YLGRPWKEYSRTV++ + L +L+D AGWLEWDG FAL 
Sbjct  401  SIHNSRVMAATDLKPVLSSFKTYLGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALN  460

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPGS+TS RVKW GYR++ + +EA++F+V NFI GQ W+PATGVPF   L
Sbjct  461  TLYYGEYKNFGPGSSTSGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  520



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 196/240 (82%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  278  GFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  337

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNT I
Sbjct  338  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTPI  397

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A++DL PV SSFK YLGRPWKEYSRTVF+ + L SL+DPAGWLEWDG FAL 
Sbjct  398  SIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALN  457

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPG++T  RVKW GYR++ +S EA++FTV NFI G+ W+PATGVPFY  L
Sbjct  458  TLYYGEYRNFGPGASTRGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 195/236 (83%), Gaps = 1/236 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  280  GSTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  339

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM+ QKN  TAQGR DPNQNTGI
Sbjct  340  VHSERQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMSGQKNTITAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL PV SSFK+YLGRPWK+YSRTV++ + L +LIDPAGWLEWDG FAL 
Sbjct  400  SIHNSRVMAAPDLKPVLSSFKSYLGRPWKQYSRTVYLQTYLDTLIDPAGWLEWDGNFALS  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY+N GP + TS RVKWPGYR++ ++SEA++FTV NFI GQ W+P+TGVPF
Sbjct  460  TLYYGEYKNLGPAAWTSGRVKWPGYRVITSSSEASKFTVANFIAGQSWLPSTGVPF  515



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 194/240 (81%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFR+ATVAV G GFI + +T EN AGP+KHQAV+LRSGSDLSVF+  SF  YQDTL
Sbjct  290  DGSTTFRTATVAVTGDGFIARDMTFENTAGPQKHQAVSLRSGSDLSVFYRCSFKGYQDTL  349

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+ Q+N  TAQGR DPN+NTG
Sbjct  350  YVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQQNTVTAQGRTDPNENTG  409

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N +V AA+DL PVQ SFK YLGRPW++YSRTVFM ++L SL+DPAGWLEW G FAL
Sbjct  410  ISIHNSRVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLVDPAGWLEWSGNFAL  469

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             TLYYGEY N G G++TS RVKWPG+ +++ S+A +FTV NF+ G  WI ATGVPF   L
Sbjct  470  STLYYGEYMNIGGGASTSRRVKWPGFHVMSASDAGKFTVENFLGGGSWIAATGVPFTSGL  529



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 198/244 (81%), Gaps = 2/244 (1%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVG-TGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQD  623
            +D  TTFRSAT+AV G TGF+ + IT+EN AGP KHQAVALR  +DLS F+  SF  YQD
Sbjct  334  VDNSTTFRSATLAVGGGTGFLARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQD  393

Query  622  TLYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQN  443
            TLY HSLRQFYRDCD+YGTVDFIFG+AAVV QNCNLYAR+P  NQKN+FTAQGREDPNQN
Sbjct  394  TLYAHSLRQFYRDCDIYGTVDFIFGDAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQN  453

Query  442  TGISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEF  263
            TGI++  CKVAAAADL+PVQ++F +YLGRPWK YSRTVFMLS + SLI P GWLEW+G F
Sbjct  454  TGIAVQGCKVAAAADLLPVQANFSSYLGRPWKTYSRTVFMLSKIESLIHPRGWLEWNGSF  513

Query  262  ALKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFY  86
            AL TLYY EY NRGPG++TSARV WPGY +L N S+A  FTV +F+ G  W+ ++  P+ 
Sbjct  514  ALDTLYYAEYMNRGPGADTSARVSWPGYHVLTNASDAANFTVLSFVQGDLWLNSSSFPYI  573

Query  85   VNLT  74
            + L+
Sbjct  574  LGLS  577



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   348 bits (893),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +GI+  N AG + HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  21   GSTTFKSATVAVVGDGFIARGISFRNTAGAQNHQAVALRSGSDLSVFYQCSFEGYQDTLY  80

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVVFQ+CN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  81   VHSERQFYRECDIYGTVDFIFGNAAVVFQSCNIYARNP-PNKTNTITAQGRTDPNQNTGI  139

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SILN +V AA+DL PVQSS K YLGRPWKEYSRTVFM + L  LI+PAGW+ W G FAL 
Sbjct  140  SILNSRVTAASDLKPVQSSVKTYLGRPWKEYSRTVFMKTFLDGLINPAGWMPWSGNFALN  199

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RV W GY ++ + +EA++FTVGNFI G  W+PAT VPF   L
Sbjct  200  TLYYGEYANTGPGSSTAKRVNWKGYHVITSATEASKFTVGNFIAGSSWLPATNVPFTSGL  259



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 195/243 (80%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG+TTF SAT AV G GF+ + +T +N AGP KHQAVALR GSDLS F   +F  YQDT
Sbjct  342  VDGYTTFHSATAAVTGKGFVARDMTFKNTAGPTKHQAVALRVGSDLSAFLRCTFEGYQDT  401

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDF+FGNAAVV QNCN+ ARKP ANQK ++TAQGREDPNQNT
Sbjct  402  LYVHSLRQFYRECDVYGTVDFVFGNAAVVLQNCNIMARKPSANQKIMYTAQGREDPNQNT  461

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC+++A +DL+  +SSF+ YLGRPWK+YSRTV + S+L  LI PAGW EWDG FA
Sbjct  462  GISIQNCRLSATSDLVAAKSSFQVYLGRPWKQYSRTVILQSHLDDLIHPAGWHEWDGNFA  521

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPG+ T+ RVKW G+R++ ++SEANQFTV  F+ G  W+PATGV +  
Sbjct  522  LSTLYYGEYMNRGPGAATANRVKWGGHRVITSSSEANQFTVNQFLQGDSWLPATGVQYTA  581

Query  82   NLT  74
              T
Sbjct  582  GFT  584



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   356 bits (913),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 193/242 (80%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+   F  YQDT
Sbjct  241  VGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDT  300

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHS RQFY++C VYGTVDFIFGNAAVV QNC +YAR+PM  QKN  TAQGR DPNQNT
Sbjct  301  LYVHSQRQFYKECYVYGTVDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNT  360

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V A +DL PV SS K YLGRPWKEYSRTVF+ S L +L+DPAGWLEWDG FA
Sbjct  361  GISIHDSRVMAGSDLKPVLSSVKTYLGRPWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFA  420

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPGS+TS RV W GY ++ ++SEA++FTVGNFI G  W+PAT VPF  
Sbjct  421  LKTLYYGEYKNTGPGSSTSGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTA  480

Query  82   NL  77
             L
Sbjct  481  GL  482



>gb|AFI23415.1| pectin methylesterase [Coffea arabica]
Length=325

 Score =   350 bits (898),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            GWTTFRS+TVAVVG GFI +GITIENYAGP +HQAVALRSGSDLS F+  SF+ YQDTLY
Sbjct  127  GWTTFRSSTVAVVGDGFIARGITIENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLY  186

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHSLRQFYR+CDVYGTVDFIFGNAAVVFQ CNLYAR+P  NQ+N+FTAQGREDPNQNTGI
Sbjct  187  VHSLRQFYRECDVYGTVDFIFGNAAVVFQLCNLYARRPNPNQQNLFTAQGREDPNQNTGI  246

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SILNCKVAAAADL+PV SSF++YLGRPWKEYSRTV++LSN+ SLIDPAGWL W+G FAL 
Sbjct  247  SILNCKVAAAADLLPVLSSFRSYLGRPWKEYSRTVYLLSNMESLIDPAGWLPWNGSFALS  306

Query  253  TLYYGEYQNRGPGS  212
            TL+YGEY+NRGPGS
Sbjct  307  TLFYGEYKNRGPGS  320



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 193/241 (80%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI + +T +N AGP KHQAVALRSGSDLSVF+  SF  YQDTL
Sbjct  275  DGSTTFRSATFAVTGDGFIARDMTFQNTAGPHKHQAVALRSGSDLSVFYRCSFEGYQDTL  334

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y++S RQFYR+CDVYGTVDFIFG+AAVV QNC++Y RKPM+ QKN  TAQGR DPN+NTG
Sbjct  335  YIYSQRQFYRNCDVYGTVDFIFGDAAVVLQNCSMYVRKPMSGQKNTVTAQGRTDPNENTG  394

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI +  V AA++L PVQ SFK YLGRPWK+YSRTVFM ++L  LIDPAGWLEW G FAL
Sbjct  395  ISIHDSAVTAASELKPVQGSFKTYLGRPWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFAL  454

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY N G G++TS RVKWPGY ++ + +EA++FTV NF+ G  WIPATGV F   
Sbjct  455  STLYYGEYMNTGAGADTSQRVKWPGYHVITSATEASKFTVANFLSGNSWIPATGVAFTSG  514

Query  79   L  77
            L
Sbjct  515  L  515



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 194/240 (81%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT  N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  281  GSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVD+IFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  341  VHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PAGW+EWDG+FALK
Sbjct  400  IIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALK  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+TS RVKW GY +L + SE ++FTVGNF+ G  W+P+TGVPF   L
Sbjct  460  TLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 189/237 (80%), Gaps = 1/237 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI K IT EN AGP+KHQAVALRSGSD SVF++ SF  YQDTL
Sbjct  303  DGSTTFRSATFAVSGEGFIAKDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTL  362

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGTVDFIFGNA VVFQNCN+Y RKPM+ QKN  TAQ R DPN+NTG
Sbjct  363  YVYSQRQFYRDCDIYGTVDFIFGNAVVVFQNCNIYVRKPMSGQKNTVTAQARTDPNENTG  422

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I N +V AA+DL PVQ SFK+YLGRPW+EYSRTV + SNL  LIDPAGWL W G FAL
Sbjct  423  IIIHNSRVTAASDLRPVQGSFKSYLGRPWQEYSRTVILKSNLDGLIDPAGWLPWSGNFAL  482

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
             TLYY EY N G G++T  RVKWPGY ++   ++A +FTVGNF+ G  WIPATGVPF
Sbjct  483  STLYYAEYMNSGSGASTGDRVKWPGYHVITKVTDAGKFTVGNFLAGDSWIPATGVPF  539



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 195/240 (81%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAV G GFI +GIT  N AGP+ HQAVALRSG+DLSVF+   F  YQDTLY
Sbjct  280  GSTTFKSATVAVTGGGFIARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLY  339

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++CD+YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  340  VHSQRQFYKECDIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A++DL PV SSFK +LGRPWK YSRTVF+ + L SL+D AGWLEWDG FAL 
Sbjct  400  SIHNSRVMASSDLRPVLSSFKTFLGRPWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALN  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPG++TS RVKW GYR++ + +EA++FT  NFI G+ W+PATGVPF   L
Sbjct  460  TLYYGEYRNSGPGASTSGRVKWRGYRVITSATEASRFTAANFIAGRSWLPATGVPFSSGL  519



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 191/238 (80%), Gaps = 1/238 (0%)
 Frame = -2

Query  787  TTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVH  608
            TTF SATVAV G GFI + +T EN AGP  HQAVALR GSD SVF+  SF  YQDTLYVH
Sbjct  357  TTFHSATVAVTGKGFIARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVH  416

Query  607  SLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISI  428
            SLRQF+RDCD+YGTVDFIFGNAAVVFQNCNLYARKP+ NQ+ ++TAQGR+DPNQNTGISI
Sbjct  417  SLRQFFRDCDIYGTVDFIFGNAAVVFQNCNLYARKPLENQQIMYTAQGRQDPNQNTGISI  476

Query  427  LNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTL  248
             NC+V A +D+  V+SSFK YLGRPWKEYSRTVF+ S L  LI PAGWLEW+  FAL TL
Sbjct  477  HNCRVTADSDMAAVKSSFKTYLGRPWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTL  536

Query  247  YYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            YYGEY N GPG+ T+ RV WPGYR++ + +EA+QFTV  FI G  W+P+TGV +   L
Sbjct  537  YYGEYMNTGPGAGTANRVNWPGYRVITSATEASQFTVNQFIEGDTWLPSTGVEYSSGL  594



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   355 bits (911),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 195/240 (81%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSG+DLSVF+   F  YQDTLY
Sbjct  281  GSTTFNSATVAVTGGGFIARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++CD+YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR D NQNTGI
Sbjct  341  VHSQRQFYKECDIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQNTGI  400

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A++DL PV SSFK +LGRPWKEYSRTVF+ + L SL+D AGWLEWDG FAL 
Sbjct  401  SIHNSRVMASSDLRPVLSSFKTFLGRPWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALN  460

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPG++TS RVKW GYR++ + +EA++FTV NFI G+ W+PATGVPF   L
Sbjct  461  TLYYGEYRNSGPGASTSGRVKWRGYRVITSATEASRFTVANFIAGRSWLPATGVPFSSGL  520



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   355 bits (911),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 189/239 (79%), Gaps = 0/239 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSATVAV G GFI + +T EN AGP+ HQAVALRSGSDLSV +  SF  YQDTLY
Sbjct  288  GSTTFRSATVAVSGGGFIARDMTFENSAGPQNHQAVALRSGSDLSVLYGCSFKGYQDTLY  347

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYRDCD+YGT DFI GNAA VFQNCN+Y RKP++ QKN  TAQ R DPNQNTGI
Sbjct  348  VHSQRQFYRDCDIYGTQDFICGNAAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQNTGI  407

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL  VQ SFK YLGRPW++YSRTVFM ++L SLIDPAGWLEW G FAL 
Sbjct  408  SIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALS  467

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGE+ N G G++TS RV WPGYR++++ EA +FTVG+F+ G  WI A GVPF   L
Sbjct  468  TLYYGEFMNSGAGASTSGRVTWPGYRVMSSEEAGEFTVGSFLGGGSWIAAAGVPFTSGL  526



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVA VG GFI +G+TI N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  275  GSTTFNSATVAAVGDGFIGRGLTIRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLY  334

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  335  VHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGI  393

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  VQSS K YLGRPWKEYSRTVFM + L SLI+PAGW+EW G FALK
Sbjct  394  SIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALK  453

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ ++SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  454  TLYYGEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  513



>gb|KJB41089.1| hypothetical protein B456_007G090100 [Gossypium raimondii]
Length=519

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 193/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT  N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  281  GSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVD+IFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  341  VHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PAGW+EWDG FALK
Sbjct  400  IIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGNFALK  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+TS RVKW GY +L + SE ++FTVGNF+ G  W+P+TGVPF   L
Sbjct  460  TLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 194/240 (81%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT  N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  281  GSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVD+IFGNAAVVFQ+CN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  341  VHSERQFYRECDIYGTVDWIFGNAAVVFQDCNIYARNP-PNKTNTVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PAGW+EWDG+FALK
Sbjct  400  IIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALK  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+TS RVKW GY +L + SE ++FTVGNF+ G  W+P+TGVPF   L
Sbjct  460  TLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 194/240 (81%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALR+GSDLSVF+   F  YQDTLY
Sbjct  279  GFTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLY  338

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  339  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  398

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL+PV S FK +LGRPWKEYSRTV+M + L SL+DPAGWLEW G FAL 
Sbjct  399  SIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALN  458

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+YGEY+N GP ++TS RVKW GYR++ + +EA++FTVG+FI G  W+PATGVPF   L
Sbjct  459  TLFYGEYKNIGPAASTSGRVKWRGYRVITSATEASKFTVGSFITGNSWLPATGVPFRSGL  518



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 194/240 (81%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALR+GSDLSVF+   F  YQDTLY
Sbjct  279  GFTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLY  338

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  339  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  398

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL+PV S FK +LGRPWKEYSRTV+M + L SL+DPAGWLEW G FAL 
Sbjct  399  SIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALN  458

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+YGEY+N GP ++TS RVKW GYR++ + +EA++FTVG+FI G  W+PATGVPF   L
Sbjct  459  TLFYGEYKNIGPAASTSGRVKWRGYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 194/240 (81%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI +GIT  N AGP+ HQAVALR+GSDLSVF+   F  YQDTLY
Sbjct  279  GFTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLY  338

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  339  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  398

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL+PV S FK +LGRPWKEYSRTV+M + L SL+DPAGWLEW G FAL 
Sbjct  399  SIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALN  458

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+YGEY+N GP ++TS RVKW GYR++ + +EA++FTVG+FI G  W+PATGVPF   L
Sbjct  459  TLFYGEYKNIGPAASTSGRVKWRGYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   352 bits (903),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 191/240 (80%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV   GFI K +T EN AGP+KHQAVA RSGSDLSV +  SF  YQDTL
Sbjct  276  DGSTTFRSATFAVAADGFIAKDLTFENTAGPQKHQAVAFRSGSDLSVLYRCSFKGYQDTL  335

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y +S RQFYR+CD+YGTVDFIFGNAA V QNCN+Y RKPM++QKN  TAQGR DPNQNTG
Sbjct  336  YTYSQRQFYRECDIYGTVDFIFGNAAAVLQNCNIYVRKPMSSQKNTITAQGRTDPNQNTG  395

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            +SI + KV+A++DL  VQ+SFK YLGRPWKEYSRTVFM + L +LIDP+GWL+W G FAL
Sbjct  396  LSIHDSKVSASSDLKAVQNSFKTYLGRPWKEYSRTVFMKTALDNLIDPSGWLQWSGNFAL  455

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            +TLYYGEY N G G+ T +RVKW G+ +++ SEA +FTVG+FI G  WIP TG+P+   L
Sbjct  456  RTLYYGEYMNSGAGAVTKSRVKWSGFHVMSASEAAKFTVGSFISGGSWIPNTGLPYTSGL  515



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 197/242 (81%), Gaps = 10/242 (4%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTFRSATVAVVG GFI KGIT EN+AGP KHQAVALRSGSD S F+  SFV YQDT
Sbjct  314  VDGWTTFRSATVAVVGNGFIAKGITFENFAGPTKHQAVALRSGSDHSAFYLCSFVGYQDT  373

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHS RQF+R+CD+YGTVDFIFGNAAVVFQNCNLYARKP  NQKNI+TAQGREDP    
Sbjct  374  LYVHSFRQFFRECDIYGTVDFIFGNAAVVFQNCNLYARKPNPNQKNIYTAQGREDPK---  430

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
               +++ +   AADLIP +++ K YLGRPWK YSRTVF+ S +   +DPAGWLEW+G+FA
Sbjct  431  ---VVSVR---AADLIPAKAAVKTYLGRPWKAYSRTVFIKSYIDDAVDPAGWLEWNGDFA  484

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY NRGPGSNT+ RVKW GYR++N+S EA++FTVG F+ G  W+ +T +PF +
Sbjct  485  LDTLYYGEYMNRGPGSNTTNRVKWAGYRVINSSTEASKFTVGPFVQGDAWLNSTKIPFSL  544

Query  82   NL  77
             L
Sbjct  545  GL  546



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   352 bits (903),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 192/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G+TTF SATVAV G GFI  GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  289  GFTTFNSATVAVTGEGFIAMGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  348

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C +YGTVDFIFGNAAVV QNC +  R+PM  Q N+ TAQGR DPNQNTGI
Sbjct  349  VHSQRQFYRECYIYGTVDFIFGNAAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGI  408

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V A++DL PVQSSFK +LGRPWKEYSRTV++ + L +L+DPAGW+EW G FAL 
Sbjct  409  SIHNCRVMASSDLKPVQSSFKTFLGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALN  468

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY+N GP S+T+ RVKW GYR++ N SEA++FTVGNFI G  W+PATGVPF
Sbjct  469  TLYYGEYRNFGPASSTARRVKWRGYRVITNPSEASRFTVGNFISGGSWLPATGVPF  524



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   352 bits (902),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 191/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF    F  YQDTLY
Sbjct  284  GSTTFDSATVAVTGDGFIAQGITFRNTAGPQNHQAVALRSGSDLSVFHRCGFEGYQDTLY  343

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN  TAQGR DPNQNTGI
Sbjct  344  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGI  403

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PV SSFK YLGRPWK+YSRTVF+ + L SL+DPAGWLEWDG FA  
Sbjct  404  SIHNSRVMAASDLRPVLSSFKTYLGRPWKQYSRTVFIQTYLDSLVDPAGWLEWDGNFAFN  463

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPGS+TS RVKW GY ++ N +EA++FTV NFI G+ W+PAT VPF   L
Sbjct  464  TLYYGEYKNSGPGSSTSRRVKWRGYHVITNPTEASRFTVANFIAGRSWLPATNVPFAAGL  523



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   352 bits (903),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 190/240 (79%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATVAV G GFI + +T EN AGP+KHQAVALRSGSDLSVF+  S   YQDTL
Sbjct  290  DGSTTFRSATVAVTGGGFIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSLKGYQDTL  349

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+ QKN  TAQGR DPN+NTG
Sbjct  350  YVYSQRQFYRDCDIYGTVDFIFGDAVAVIQNCNIYVRKPMSGQKNTVTAQGRTDPNENTG  409

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N +V AA+DL  VQ SFK YLGRPW++YSRTVFM ++L SLIDPAGWLEW G FAL
Sbjct  410  ISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFAL  469

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             TLYYGEY N G G++T  RVKW GY +++ ++A +FTVG+F+ G  WI + GVPF   L
Sbjct  470  STLYYGEYMNTGAGASTGGRVKWAGYHVMSAADAGKFTVGSFLGGGSWIGSAGVPFTSGL  529



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT  N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  281  GSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVD+IFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  341  VHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PA W+EWDG FALK
Sbjct  400  IIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPADWMEWDGNFALK  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+TS RVKW GY +L + SE ++FTVGNF+ G  W+P+TGVPF   L
Sbjct  460  TLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 191/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  277  GSTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKNI TAQGR DPNQNTGI
Sbjct  337  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGI  396

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL PV SSFK +LGRPWKEYSRTVFM + L SL+DPAGW EWDG+FAL 
Sbjct  397  SIHNSRVMAANDLTPVLSSFKTFLGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALN  456

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GP + TS RV W GYR++ + +EA++FTV NFI G+ W+P TG+PF   L
Sbjct  457  TLYYGEYKNIGPAAPTSRRVTWKGYRVITSATEASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+   F  YQDT
Sbjct  276  VGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDT  335

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHS RQFY++C VYGTVDFIFGNAAVV QNC +YAR+PM  QKN  TAQGR DPNQNT
Sbjct  336  LYVHSQRQFYKECYVYGTVDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNT  395

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V A +DL PV SS K YLGRPWKEYSRTVF+ S L +L+D AGWLEWDG FA
Sbjct  396  GISIHDSRVMAGSDLKPVLSSVKTYLGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFA  455

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPGS+T  RV W GY ++ ++SEA++FTVGNFI G  W+PAT VPF  
Sbjct  456  LKTLYYGEYKNTGPGSSTRGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTA  515

Query  82   NL  77
             L
Sbjct  516  GL  517



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 193/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  277  GSTTFKSATVAVVGDGFIARDITFRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C++YGTVDFIFGNAAVVFQNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSERQFYRECNIYGTVDFIFGNAAVVFQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA++L  VQSS K YLGRPWKEYSRTVFM + L SLI+PAGW+EW+G FALK
Sbjct  396  SIHNCRVTAASELKRVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALK  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T  RVKW GYR++ + SEA++FTVG+ I G  W+PATGVPF   L
Sbjct  456  TLYYGEYMNTGPGSSTKNRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  515



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 192/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  284  GSTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  343

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YAR+PM  QKN+ TAQGR DPNQNTGI
Sbjct  344  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGI  403

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A+ DL PV SSFK YLGRPWK+YSRTV++ + L SL+DPAGWLEWDG+FAL 
Sbjct  404  SIHNSRVMASPDLKPVLSSFKTYLGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALN  463

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GP ++TS RV W GYR++ +S EAN+FTV NFI G  W+PA+ VPF   L
Sbjct  464  TLYYGEYKNVGPSASTSGRVTWRGYRVITSSTEANRFTVANFIAGGSWLPASSVPFTSGL  523



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 196/241 (81%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTF SAT AV G GFI +G+T +N AGP+K+QAVA RS SDLS ++  SF  YQDTL
Sbjct  275  DGSTTFSSATFAVTGDGFIARGMTFQNTAGPQKNQAVAFRSSSDLSAYYQCSFEGYQDTL  334

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDC++YGTVDFIFG+AAVVFQNC++Y RKPM+ QKN  TAQGR DPN+NTG
Sbjct  335  YVYSQRQFYRDCNIYGTVDFIFGDAAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNENTG  394

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI +  V AA+DL PVQ SF+ YLGRPW++YSRTV+M ++L SLIDPAGWLEW+G+FAL
Sbjct  395  ISIHDSAVTAASDLKPVQGSFQTYLGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFAL  454

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY N G G++TS RV WPGY ++ ++  A+QFTVGNF+ G  WIPATGVP+  +
Sbjct  455  STLYYGEYMNTGAGADTSRRVNWPGYHVITSAAVASQFTVGNFLSGGSWIPATGVPYTSD  514

Query  79   L  77
            L
Sbjct  515  L  515



>gb|KHN35618.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   345 bits (884),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSATVAVVG GFI +GIT  N AG + HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  121  GTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLY  180

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C++YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  181  VHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGI  239

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQ+S + YLGRPWK+YSRTVFM + L  LI+P+GW+EW G FAL 
Sbjct  240  SIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALN  299

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T  RVKWPGYR++   SEA++F+V NFI G  W+PAT VP+  +L
Sbjct  300  TLYYGEYMNTGPGSSTGRRVKWPGYRVITRASEASKFSVANFIAGNAWLPATKVPYTPSL  359



>emb|CAN60506.1| hypothetical protein VITISV_022717 [Vitis vinifera]
Length=260

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 185/241 (77%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV G  F+   IT  N AGPEKHQAVA+R+ +DLS F+  SF  YQDT
Sbjct  19   VDGWTTFNSATFAVSGERFVAIDITFRNTAGPEKHQAVAVRNNADLSTFYRCSFEGYQDT  78

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDC VYGTVDFIFGN+A +FQNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  79   LYAHSLRQFYRDCIVYGTVDFIFGNSACIFQNCNLYARKPMPNQKNAFTAQGRMDPNQNT  138

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  NYLGRPWK+YSRTV+M S +GSLIDP GWLEW+G   
Sbjct  139  GISIHNCTIEAAPDLAMDLNSTLNYLGRPWKQYSRTVYMQSYIGSLIDPXGWLEWNGTVG  198

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYYGE++N GPG+NTS RV+WPGY ++N S+A  FTV NF +G  W+    +PFY  
Sbjct  199  LDTLYYGEFENYGPGANTSMRVQWPGYTLMNASQAVNFTVYNFTMGDTWLTNLDIPFYGG  258

Query  79   L  77
            L
Sbjct  259  L  259



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+  +F  YQDTLY
Sbjct  287  GSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLY  346

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YARKPM  QKN  TAQGR DPNQNTGI
Sbjct  347  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGI  406

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A  DL PV+S+ K YLGRPWKEYSRTVFM + + SL+DPAGWLEWDG+FAL 
Sbjct  407  SIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALN  466

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY N GPGS  S RVKW GY ++ N +EA++FTV NFI GQ W+P T VPF
Sbjct  467  TLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLPDTEVPF  522



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT  N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  281  GSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVD+IFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  341  VHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PAGW+EWD +FA K
Sbjct  400  IIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDDDFAPK  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+TS RVKW GY +L + SE ++FTVGNF+ G  W+P+TGVPF   L
Sbjct  460  TLYYAEYMNTGPGSSTSNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   350 bits (897),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/241 (68%), Positives = 193/241 (80%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI + +T +N AGP+KHQAVALRSGSDLSVF+  SF  YQDTL
Sbjct  282  DGSTTFRSATFAVSGGGFIARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTL  341

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYR+CD+YGTVDFIFG+A VVFQ+CN+Y RKPM+ Q+N  TAQGR D N+NTG
Sbjct  342  YVYSQRQFYRNCDIYGTVDFIFGDAVVVFQSCNIYVRKPMSGQQNTVTAQGRTDHNENTG  401

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N  V AA+DL PVQ SFK YLGRPW++YSRTVFM ++L SLI+PAGWLEW G F L
Sbjct  402  ISIHNSIVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGL  461

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYY EY N G G++TS RV WPGY ++ ++SEA++FTVG F+ G  WIPATGVPF   
Sbjct  462  STLYYAEYMNTGAGADTSKRVNWPGYHVIASSSEASKFTVGGFLSGDSWIPATGVPFSFG  521

Query  79   L  77
            L
Sbjct  522  L  522



>gb|KHN25547.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   344 bits (882),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 193/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSATVAVVG GFI +GIT  N AG + HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  121  GTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLY  180

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C++YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  181  VHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGI  239

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQ+S + YLGRPWK+YSRTVFM + L  LI+PAGW+EW G FAL 
Sbjct  240  SIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALD  299

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GYR++ + SEA++F+V NFI G  W+P+T VPF  +L
Sbjct  300  TLYYGEYMNTGPGSSTARRVKWSGYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL  359



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   349 bits (896),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 192/237 (81%), Gaps = 1/237 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI +G+T +N AGPEK+QAVA RS SDLSV++  SF  YQDTL
Sbjct  275  DGSTTFRSATFAVTGDGFIARGMTFQNTAGPEKYQAVAFRSSSDLSVYYQCSFEGYQDTL  334

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS +QFYR+C++YGT+DFIFG+A VVFQNCN+Y RKPM  QKN  TAQGR D   +TG
Sbjct  335  YVHSKQQFYRNCNIYGTIDFIFGDATVVFQNCNIYVRKPMTGQKNTVTAQGRTDERTDTG  394

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI +  V AA DL PVQSSF+ YLGRPWK+YSRTV+M + L SLIDPAGWLEWDG+FAL
Sbjct  395  ISIHDSVVTAAPDLKPVQSSFQTYLGRPWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFAL  454

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPF  89
            KTLYYGEY N G G++TS RV WPGY ++ + +EA+QFTVGNF+ G  WIPATGVP+
Sbjct  455  KTLYYGEYMNTGAGADTSQRVTWPGYHVITSAAEASQFTVGNFLSGNSWIPATGVPY  511



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SA VAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  200  GSTTFNSARVAVVGDGFIARDITFRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLY  259

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C++YGTVDFIFGNAAVVFQNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  260  VHSERQFYRECNIYGTVDFIFGNAAVVFQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGI  318

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA++L  VQSS K YLGRPWKEYSRTVFM + L SLI+PAGW+EW+G FALK
Sbjct  319  SIHNCRVTAASELKRVQSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALK  378

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T  RVKW GYR++ + SEA++FTVG+ I G  W+PATGVPF   L
Sbjct  379  TLYYGEYMNTGPGSSTKNRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  438



>emb|CBI24284.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   340 bits (872),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 188/240 (78%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +G+T  N AG   HQ+VALRSGSDLSV++  SF  YQDTLY
Sbjct  21   GSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQSVALRSGSDLSVYYQCSFEGYQDTLY  80

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             +S RQFYR CD+YGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  81   TYSERQFYRGCDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGI  139

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +CKV AA+DL PVQ S K YLGRPWKEYSRTVF+ + L SLI+ AGWLEW G FAL 
Sbjct  140  SIHDCKVTAASDLKPVQGSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGNFALN  199

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N G GS+TS RVKW GY ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  200  TLYYGEYMNTGDGSSTSGRVKWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  259



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 186/237 (78%), Gaps = 1/237 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI KG+T EN AGP+KHQAVALRSGSD SVF+  SF  YQDTL
Sbjct  289  DGSTTFRSATFAVSGQGFIAKGMTFENTAGPQKHQAVALRSGSDFSVFYGCSFKGYQDTL  348

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGT+DFIFG+A  V QNCN+Y R+PM  QKN  TAQGR+DPN+NTG
Sbjct  349  YVYSQRQFYRDCDIYGTIDFIFGDAVAVLQNCNIYVRRPMNGQKNTVTAQGRKDPNENTG  408

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I N  V A +D+ PVQ SFK YLGRPW++YSRT+FM SNL  LIDPAGWL W G FAL
Sbjct  409  IVIHNSNVMATSDMRPVQGSFKTYLGRPWQKYSRTLFMKSNLDGLIDPAGWLPWSGNFAL  468

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
             TLYYGEY N G G++T+ RV WPGY ++   ++A +FTVGNF+ G  WIP TGVPF
Sbjct  469  STLYYGEYMNTGSGASTARRVNWPGYHVITKATDAGKFTVGNFLAGDSWIPGTGVPF  525



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 192/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI  GIT  N AGPE HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  288  GSTTFNSATVAVTGQGFIAMGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLY  347

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQ Y++C +YGTVDFIFGNAAVV QNC ++AR+PM NQ N+ TAQGR DPNQNTGI
Sbjct  348  VHSQRQLYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDNQNNVVTAQGRTDPNQNTGI  407

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N ++ A++DL+PV SSFK +LGRPWK+YSRTV++ S + +L+DPAGW+EW G FAL 
Sbjct  408  SIHNSRIMASSDLVPVLSSFKTFLGRPWKQYSRTVYLTSYIDTLVDPAGWMEWSGNFALD  467

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPGS+T+ RV W GYR++  +SEA+QFTVG FI G  W+PATGVPF   L
Sbjct  468  TLYYGEYKNYGPGSSTANRVNWGGYRVITKSSEASQFTVGKFISGDSWLPATGVPFKSGL  527



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG  FI + ITI N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  272  GATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLY  331

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN++ARKP  N+ N  TAQGR DPNQNTGI
Sbjct  332  VHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQNTGI  390

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I NC+V AA+DL PVQSS K +LGRPWK+YSRTV++ + L SLI+PAGW+EW G+FAL 
Sbjct  391  IIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALN  450

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+T+ RVKW GY +L + S+ +QFTVGNFI G  W+PAT VPF   L
Sbjct  451  TLYYAEYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 192/240 (80%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF S TV V G GFI +GIT  N AGP+ HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  235  GSTTFNSGTVVVTGEGFIAQGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLY  294

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC ++AR+PM  QK   TAQGR DPNQNTGI
Sbjct  295  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGI  354

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PV  +FK +LGRPWK+YSRTVFM + L SL+DPAGWLEWDG+FAL 
Sbjct  355  SIHNSRVMAASDLRPVLGTFKTFLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGDFALS  414

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPG++TS+RVKW GYR++ N++EA +F+V NFI G+ W+PAT VPF   L
Sbjct  415  TLYYGEYRNAGPGASTSSRVKWSGYRVITNSNEAARFSVENFIAGRSWLPATNVPFRAGL  474



>ref|XP_006853048.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
 gb|ERN14515.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
Length=532

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTF SAT AVVG GF+   +T  N AGPEKHQAVA+R+G+DLSVF++ S   YQDT
Sbjct  289  VDGSTTFNSATFAVVGQGFVAMDMTFRNTAGPEKHQAVAVRNGADLSVFYHCSVEGYQDT  348

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGT+DFIFGNAAVVFQNCNLYAR PMA+Q N+FTAQGR DPNQNT
Sbjct  349  LYTHSLRQFYRECDIYGTIDFIFGNAAVVFQNCNLYARMPMASQNNVFTAQGRTDPNQNT  408

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SILNC V A++D     SS  +YLGRPWKEYSRTV+M S + SLID +GWL W G+FA
Sbjct  409  GTSILNCSVTASSDFAWNSSSVNSYLGRPWKEYSRTVYMKSFIDSLIDSSGWLPWSGDFA  468

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYR-ILNTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGE+ N GPG++TS RV WPGY  I+N ++A  FTV NFI+G  W+PAT V F+ 
Sbjct  469  LNTLYYGEFNNSGPGADTSKRVSWPGYHAIMNVTDAGNFTVSNFIMGDVWLPATSVEFHA  528

Query  82   NL  77
             L
Sbjct  529  GL  530



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 190/236 (81%), Gaps = 0/236 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFR+ATV V G GF+ + +T EN AGP+KHQAVALRSGSDLSVF++ SF  YQDTL
Sbjct  287  DGSTTFRTATVGVTGDGFMARDMTFENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTL  346

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV+S RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+ QKN  TAQGR DPN+NTG
Sbjct  347  YVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTG  406

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N +V AA+DL  VQ SFK YLGRPW++YSRTVFM ++L SL+D AGWLEW G+FAL
Sbjct  407  ISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLVDRAGWLEWSGKFAL  466

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             +LYYGEY N GPG++TS RV W G+ +++  +A +FTVG+F+ G  WI A GVPF
Sbjct  467  SSLYYGEYMNTGPGASTSGRVNWEGFHVMSADDAGKFTVGSFLGGGSWIAAAGVPF  522



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+  +F  YQDTLY
Sbjct  332  GSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLY  391

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YARKPM  QKN  TAQGR DPNQNTGI
Sbjct  392  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGI  451

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A  DL PV+S+ K YLGRPWKEYSRTVFM + + SL+DPAGWLEWDG+FAL 
Sbjct  452  SIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALN  511

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY N GPGS  S RVKW GY ++ N +EA++FTV NFI GQ W+P T VPF
Sbjct  512  TLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLPDTEVPF  567



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 189/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT +N AGPE HQAVALRSG+DLSVF+  +F  YQDTLY
Sbjct  332  GSTTFNSATVAVTGEGFIARGITFQNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLY  391

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YARKPM  QKN  TAQGR DPNQNTGI
Sbjct  392  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGI  451

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A  DL PV+S+ K YLGRPWKEYSRTVFM + + SL+DP GWLEWDG+FAL 
Sbjct  452  SIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPTGWLEWDGDFALN  511

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY N GPGS  S RVKW GY ++ N++EA++FTV NFI GQ W+P T VPF
Sbjct  512  TLYYGEYNNIGPGSPISQRVKWKGYHVISNSTEASEFTVQNFIAGQSWLPNTEVPF  567



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF++ SF  YQDT
Sbjct  278  VGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDT  337

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS RQFY+DC VYGTVDFIFGNAAVV QNC +YARKPM+ QKN  TAQGR DPNQNT
Sbjct  338  LYTHSQRQFYKDCYVYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNT  397

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V AA D      S K +LGRPWKEYSRTVFM S L +L+DPAGWLEW G FA
Sbjct  398  GISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFA  457

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPG+ TS RVKW GYR++ ++SEA++FTV NFI G  W+PAT VPF  
Sbjct  458  LKTLYYGEYKNIGPGAPTSGRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTA  517

Query  82   NL  77
             L
Sbjct  518  GL  519



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +G+T  N AG   HQAVALRSGSDLSV++  SF  YQDTLY
Sbjct  274  GSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLY  333

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             +S RQFYR+CD+YGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  334  TYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGI  392

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +CKV AA+DL PVQSS K YLGRPWKEYSRTVF+ + L SLI+ AGWLEW G+FAL 
Sbjct  393  SIHDCKVTAASDLKPVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALN  452

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RVKW GY ++ +S EA +FT GNFI G  W+P+T VPF   L
Sbjct  453  TLYYGEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTNVPFTSGL  512



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +G+T  N AG   HQAVALRSGSDLSV++  SF  YQDTLY
Sbjct  274  GSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLY  333

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             +S RQFYR+CD+YGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  334  TYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGI  392

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +CKV AA+DL PVQSS K YLGRPWKEYSRTVF+ + L SLI+ AGWLEW G+FAL 
Sbjct  393  SIHDCKVTAASDLKPVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALN  452

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RVKW GY ++ +S EA +FT GNFI G  W+P+T VPF   L
Sbjct  453  TLYYGEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTNVPFTSGL  512



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 193/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GF+ + IT  N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  277  GSTTFKSATVAVVGDGFVAQDITFRNTAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  +QSS K YLGRPWK+YSRTVFM + L SL++ AGW+EWDG FAL 
Sbjct  396  SIHNCKVTAASDLKSIQSSVKTYLGRPWKQYSRTVFMKTYLDSLVNSAGWMEWDGNFALD  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GY ++ + +EA +FTVG+F++G  W+PATGVP+   L
Sbjct  456  TLYYGEYVNTGPGSSTANRVKWVGYHVITSATEAAKFTVGSFLVGGSWLPATGVPYTSGL  515



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF++ SF  YQDT
Sbjct  278  VGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDT  337

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS RQFY+DC VYGTVDFIFGNAAVV QNC +YARKPM+ QKN  TAQGR DPNQNT
Sbjct  338  LYTHSQRQFYKDCYVYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNT  397

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V AA D      S K +LGRPWKEYSRTVFM S L +L+DPAGWLEW G FA
Sbjct  398  GISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFA  457

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPG+ TS RVKW GYR++ ++SEA++FTV NFI G  W+PAT VPF  
Sbjct  458  LKTLYYGEYKNIGPGAPTSRRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTA  517

Query  82   NL  77
             L
Sbjct  518  GL  519



>ref|XP_011046483.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Populus euphratica]
Length=569

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 186/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDGWTTF S+T AV G  F+   IT  N AGPEKHQAVALR+ +DLS F+  SF  YQDT
Sbjct  328  IDGWTTFNSSTFAVSGERFVGVDITFRNTAGPEKHQAVALRNNADLSTFYRCSFEGYQDT  387

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAA VFQNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  388  LYVHSLRQFYRECDVYGTVDFIFGNAAAVFQNCNLYARKPMLNQKNAFTAQGRTDPNQNT  447

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL   ++S  N+LGRPWKEYSRTV M S +G LI P GWLEW+G   
Sbjct  448  GISIHNCTIEAAPDLAMDRNSTLNFLGRPWKEYSRTVIMQSYIGELIQPVGWLEWNGTVG  507

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L T+YYGE+QN GPG+NTS RV+WPG+ ++NT++A  FTV NF +G  W+P T VPF
Sbjct  508  LDTIYYGEFQNYGPGANTSRRVQWPGFNLMNTTQAVNFTVYNFTMGDTWLPYTDVPF  564



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = -2

Query  751  TGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVHSLRQFYRDCDVY  572
            T  + + +TIEN AGP KHQAVALR G+DLS F+  SFV YQDTLYVHSLRQF+R+CD+Y
Sbjct  1    TASLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIY  60

Query  571  GTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISILNCKVAAAADLI  392
            GT+DF+FGN+AVV Q+CNLYAR+P+A+Q NI+TAQGR DPNQNTGISI  CKVAAA+DL 
Sbjct  61   GTIDFVFGNSAVVLQSCNLYARRPLASQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLA  120

Query  391  PVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGS  212
             VQ+SF+ YLGRPWK+YSRTV++ S L S++DP GWLEWDG FAL TLYYGEYQN G G+
Sbjct  121  AVQTSFRTYLGRPWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGA  180

Query  211  NTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            +TS RVKW GYR++ ++SEA+ FTVG+FI G  W+  T +PF   L
Sbjct  181  STSNRVKWKGYRVISSSSEASTFTVGSFIDGDVWLAGTSIPFSTGL  226



>ref|XP_007199770.1| hypothetical protein PRUPE_ppa003639mg [Prunus persica]
 gb|EMJ00969.1| hypothetical protein PRUPE_ppa003639mg [Prunus persica]
Length=560

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV   GF+   +T  N AG  KHQAVA+R+G+DLS F++ SF AYQDT
Sbjct  319  VDGWTTFNSATFAVTAPGFVAVNMTFRNTAGAIKHQAVAVRNGADLSTFYSCSFEAYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R PM+ Q N  TAQGR DPNQNT
Sbjct  379  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRLPMSGQFNAITAQGRTDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    SS K YLGRPWKEYSRTV+M S + S++DPAGW  WDGEFA
Sbjct  439  GTSIHNCTIRAADDLASSNSSTKTYLGRPWKEYSRTVYMQSYIDSVVDPAGWRAWDGEFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNT++RV WPGY ++N ++A  FTV NF+LG  W+P TGVP+
Sbjct  499  LSTLYYAEYNNTGPGSNTTSRVTWPGYHVINATDAANFTVTNFLLGDDWLPQTGVPY  555



>gb|KHN42767.1| Pectinesterase 2 [Glycine soja]
Length=444

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 190/238 (80%), Gaps = 1/238 (0%)
 Frame = -2

Query  787  TTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVH  608
            TTF SATVAV G GFI +GIT  N AGPE HQAVALR G+DLSVF+  +F  YQDTLYVH
Sbjct  205  TTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRCGADLSVFYRCAFEGYQDTLYVH  264

Query  607  SLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISI  428
            S RQFY++C++YGTVDFIFGNAAVVFQ+CN+YAR+PM  QKN  TAQGR DPNQNTGI I
Sbjct  265  SQRQFYKECNIYGTVDFIFGNAAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICI  324

Query  427  LNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTL  248
             N +V AA DL+PV SSFK +LGRPW+EYSRTVF+ + L  L+DPAGWLEW G+FAL TL
Sbjct  325  QNSRVMAAEDLVPVLSSFKTFLGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTL  384

Query  247  YYGEYQNRGPGSNTSARVKWPGYR-ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            YYGEY+N GP  +T  RVKW GY  I + +EA++FTV NFI G+ W+PATG+PF   L
Sbjct  385  YYGEYKNLGPRGSTRGRVKWGGYHAITSATEASKFTVENFIAGKSWLPATGIPFLFGL  442



>gb|KDO85751.1| hypothetical protein CISIN_1g010441mg [Citrus sinensis]
Length=510

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG  FI + ITI N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  272  GATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLY  331

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN++ARKP  N+ N  TAQGR DPNQ+TGI
Sbjct  332  VHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQSTGI  390

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I NC+V AA+DL PVQSS K +LGRPWK+YSRTV++ + L SLI+PAGW+EW G+FAL 
Sbjct  391  IIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALN  450

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+T+ RVKW GY +L + S+ +QFTVGNFI G  W+PAT VPF   L
Sbjct  451  TLYYAEYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57669.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   347 bits (889),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG  FI + ITI N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  272  GATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLY  331

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN++ARKP  N+ N  TAQGR DPNQ+TGI
Sbjct  332  VHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQSTGI  390

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I NC+V AA+DL PVQSS K +LGRPWK+YSRTV++ + L SLI+PAGW+EW G+FAL 
Sbjct  391  IIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALN  450

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+T+ RVKW GY +L + S+ +QFTVGNFI G  W+PAT VPF   L
Sbjct  451  TLYYAEYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   353 bits (906),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+  +F  YQDTLY
Sbjct  503  GSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLY  562

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC +YARKPM  QKN  TAQGR DPNQNTGI
Sbjct  563  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGI  622

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A  DL PV+S+ K YLGRPWKEYSRTVFM + + SL+DPAGWLEWDG+FAL 
Sbjct  623  SIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALN  682

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY N GPGS  S RVKW GY ++ N +EA++FTV NFI GQ W+P T VPF
Sbjct  683  TLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLPDTEVPF  738



>ref|XP_004299718.2| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=575

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 187/237 (79%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DG TTF SAT+AVV  GF+   IT+ N AGP K QAVA+R+G+DLSVF++ SF AYQDT
Sbjct  334  VDGSTTFDSATLAVVAEGFVGVNITVRNTAGPSKMQAVAVRNGADLSVFYSCSFEAYQDT  393

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAA+V QNCNLY R+P+  Q N  TAQGR DPNQNT
Sbjct  394  LYAHSLRQFYRECDIYGTVDFIFGNAALVLQNCNLYPRQPLKGQSNPITAQGRTDPNQNT  453

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AAADL     + K YLGRPWKEYSRTV++ + + SLIDP GWLEWDG+FA
Sbjct  454  GTSIQNCTITAAADLASSNFTVKTYLGRPWKEYSRTVYLQNFMDSLIDPVGWLEWDGDFA  513

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY NRGPGSNTS+RV WPGY I+  ++A  FTV NF++G  W+P TGVP+
Sbjct  514  LSTLYYAEYDNRGPGSNTSSRVTWPGYHIIGATDAANFTVSNFLVGDNWLPQTGVPY  570



>gb|KJB41905.1| hypothetical protein B456_007G127100 [Gossypium raimondii]
Length=559

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 186/241 (77%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV + F+   IT +N AG  KHQAVALRSG+DLS F++ SF  YQDT
Sbjct  318  VDGWTTFNSATFAVVASNFVAVNITFQNTAGAIKHQAVALRSGADLSAFYSCSFEGYQDT  377

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS+RQFYR+CD+YGTVDFIFGNAAVV QNCN+Y R+PM+ Q N  TAQGR DPNQNT
Sbjct  378  LYTHSMRQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRQPMSGQFNAITAQGRTDPNQNT  437

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    +SFK YLGRPWKEYSRTV+M S + +LIDPAGW EWDG+FA
Sbjct  438  GTSIHNCNIMAADDLASSNTSFKTYLGRPWKEYSRTVYMQSFMDNLIDPAGWREWDGDFA  497

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N G GSNTS RV WPGY ++N ++A  FTV +F+LG  W+P TGVP+   
Sbjct  498  LSTLYYAEYDNNGLGSNTSNRVTWPGYHVINATDAINFTVSSFLLGDDWLPDTGVPYNAT  557

Query  79   L  77
            L
Sbjct  558  L  558



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 189/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSAT AVVG GFI + +T  N AGPE HQAVALRSG+DLSVF+  SF  YQDTLY
Sbjct  276  GATTFRSATFAVVGEGFIARDMTFRNTAGPENHQAVALRSGADLSVFYKCSFEGYQDTLY  335

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  336  VHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARNP-PNRTNTLTAQGRTDPNQNTGI  394

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQSS + YLGRPWKEYSRTVFM + L SLI+PAGW+EW G FAL 
Sbjct  395  SIHNSRVTAASDLSPVQSSVRTYLGRPWKEYSRTVFMKTFLDSLINPAGWMEWSGNFALD  454

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPF  89
            TLYYGEY N GPGS+T+ RV W GYR++ + +EA+QFTV NFI G  W+P T VPF
Sbjct  455  TLYYGEYMNTGPGSSTANRVTWKGYRVITSAAEASQFTVQNFISGNSWLPGTNVPF  510



>emb|CDP20872.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +GIT  N AGP+ HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  280  GTTTFKSATVAVVGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLY  339

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY +CDVYGTVD+IFGNAAVVFQNCNLY+R P  N+ N  TAQGR DPNQNTGI
Sbjct  340  VHSQRQFYSECDVYGTVDYIFGNAAVVFQNCNLYSRNP-PNKINTITAQGRTDPNQNTGI  398

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQSS K YLGRPW++YSRTVFM + L  LIDPAGWL W G FAL 
Sbjct  399  SIHNSRVTAASDLKPVQSSVKTYLGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALD  458

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RV W GY ++ + +EA++FTVGNFI G  W+PAT VPF   L
Sbjct  459  TLYYGEYANTGPGSSTANRVSWKGYHLITSATEASKFTVGNFIAGNSWLPATNVPFTSGL  518



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF+SATVAV G GFI +GIT  N AGP+ HQAVALRSGSD SVF+   F  YQDT
Sbjct  283  VGGSTTFKSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDRSVFYRCGFEGYQDT  342

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHS RQFY++C +YGTVDFIFGNAAVV QNC ++AR+PM  QK   TAQGR DPNQNT
Sbjct  343  LYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNT  402

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI N +V AA+DL PV S+FK +LGRPWK+YSRTVFM + L SL+DPAGWLEWDG FA
Sbjct  403  GISIHNSRVMAASDLRPVLSTFKTFLGRPWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFA  462

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY+N GPG++TS RV+W GYR++ N++EA +F+V NFI G+ W+PAT VPF  
Sbjct  463  LNTLYYGEYRNSGPGASTSRRVRWRGYRVITNSNEAAKFSVENFIGGRSWLPATNVPFRA  522

Query  82   NL  77
             L
Sbjct  523  GL  524



>ref|XP_009335708.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Pyrus x bretschneideri]
Length=569

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV  GF+   IT  N AG  KHQAVA+RSG+DLS F++ SF AYQDT
Sbjct  328  VDGWTTFNSATFAVVAPGFVAVNITFRNTAGAIKHQAVAVRSGADLSTFYSCSFEAYQDT  387

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R PM+ Q N  TAQGR DPNQNT
Sbjct  388  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRLPMSGQFNAITAQGRTDPNQNT  447

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    SS K YLGRPWKEYSRTV+M S + SL++P GW  WDG+FA
Sbjct  448  GTSIHNCTIRAADDLASSNSSTKTYLGRPWKEYSRTVYMQSYIDSLVEPVGWRAWDGDFA  507

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNT+ RV WPGY ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  508  LSTLYYAEYNNTGPGSNTTNRVTWPGYHVINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_009335714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Pyrus x bretschneideri]
Length=569

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV  GF+   IT  N AG  KHQAVA+RSG+DLS F++ SF AYQDT
Sbjct  328  VDGWTTFNSATFAVVAPGFVAVNITFRNTAGAIKHQAVAVRSGADLSTFYSCSFEAYQDT  387

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R PM+ Q N  TAQGR DPNQNT
Sbjct  388  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRLPMSGQFNAITAQGRTDPNQNT  447

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    SS K YLGRPWKEYSRTV+M S + SL++P GW  WDG+FA
Sbjct  448  GTSIHNCTIRAADDLASSNSSTKTYLGRPWKEYSRTVYMQSYIDSLVEPVGWRAWDGDFA  507

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNT+ RV WPGY ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  508  LSTLYYAEYNNTGPGSNTTNRVTWPGYHVINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF S TV V G GFI +GIT  N AGPE HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  284  GSTTFNSGTVVVTGEGFIAQGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLY  343

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C +YGTVDFIFGNAAVV QNC ++AR+PM  QK   TAQGR DPNQNTGI
Sbjct  344  VHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGI  403

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PV  +FK YLGRPWK+YSRTV M + L SL+DPAGWLEWDG+FAL 
Sbjct  404  SIHNSRVMAASDLRPVVGTFKTYLGRPWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALN  463

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY+N GPG++TS+RVKWPGYR++ N++EA +F+V N I G  W+PAT VPF   L
Sbjct  464  TLYYGEYRNNGPGASTSSRVKWPGYRVITNSNEAARFSVENLIAGGSWLPATNVPFRAGL  523



>ref|XP_008803383.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=532

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 191/244 (78%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTT+RSAT AV G GFI + +TIEN AGP KHQAVALRS SDLSV++ SSF+ YQDT
Sbjct  289  VDGWTTYRSATFAVSGKGFIARDLTIENTAGPSKHQAVALRSDSDLSVYYRSSFLGYQDT  348

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDC + GTVDF+FGNAA VFQNC L AR+P+ +QKN  TAQGR+DPNQNT
Sbjct  349  LYAHSLRQFYRDCLITGTVDFVFGNAAAVFQNCVLLARRPLPDQKNSVTAQGRKDPNQNT  408

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G S+  C V+A ADL  + +S  +YLGRPWKEYSRTVFM S LG L+ P GWLEW+G FA
Sbjct  409  GFSLQFCNVSAGADLAGLTNSTASYLGRPWKEYSRTVFMQSYLGGLLRPEGWLEWNGNFA  468

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY N GPGS  + RVKWPGYR+L N+++A  FTVG FI G  W+P+TGV +  
Sbjct  469  LDTLYYAEYMNYGPGSGLAGRVKWPGYRVLTNSADAVNFTVGQFIDGNLWLPSTGVKYTS  528

Query  82   NLTA  71
             LTA
Sbjct  529  GLTA  532



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF+SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+   F  YQDT
Sbjct  277  VGGSTTFKSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDT  336

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS RQFYR+C VYGTVDFIFGNAAVVFQNC +YARKPM+ Q+N  TAQGR DPNQNT
Sbjct  337  LYTHSQRQFYRECYVYGTVDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNT  396

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V AA DL     S K +LGRPWKEYSRTVFM S L +L+DPAGWL+W G+FA
Sbjct  397  GISIHDSRVMAALDLESSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLQWSGDFA  456

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPG+ T+ RVKW GYRI+ ++SEA++FTV NFI G  W+PAT  PF  
Sbjct  457  LKTLYYGEYKNIGPGAPTTGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNXPFTA  516

Query  82   NL  77
             L
Sbjct  517  XL  518



>ref|XP_010253281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Nelumbo nucifera]
Length=560

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT+AVVG GF+   IT+ N AG  KHQAVA+R+G+DLS F++ SF  YQDT
Sbjct  319  VDGWTTFNSATLAVVGQGFVAINITVRNTAGAIKHQAVAVRNGADLSTFYSCSFEGYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAA VFQNCN+YAR PM  Q N  TAQGR DPNQNT
Sbjct  379  LYAHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARLPMQGQFNALTAQGRTDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL     + K+YLGRPWKEYSRTV+M S + SLIDPAGW EW G FA
Sbjct  439  GISIHNCNIRAAPDLASSSGTTKSYLGRPWKEYSRTVYMQSIIDSLIDPAGWKEWSGNFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGS T+ RV WPGY ++N ++A  FTV NFILG  W+PAT VP+
Sbjct  499  LSTLYYAEYNNTGPGSVTTDRVSWPGYHLINATDAANFTVSNFILGDSWLPATIVPY  555



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  242  GSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLY  301

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  302  VHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGI  360

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  VQSS K YLGRPW+EYSRTVFM + L SLI+ AGW+EWDG FAL 
Sbjct  361  SIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALD  420

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T++RV W GY ++ + +EA++FTVG+FI G  W+PATGVP+   L
Sbjct  421  TLYYGEYLNTGPGSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  480



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/241 (67%), Positives = 186/241 (77%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATV V G GFI + IT EN AGP+KHQAVALRSGSD SVF++ SF  YQDTL
Sbjct  291  DGTTTFRSATVGVSGKGFIARDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTL  350

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS RQFYRDCD+YGTVDFIFG+A  V QNCN+Y R+PM+ Q N  TAQGR DP++NTG
Sbjct  351  YVHSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRRPMSKQTNTVTAQGRTDPDENTG  410

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I N +V AA DL PVQ SFK+YLGRPWK+YSRTVF+ SN+  LIDPAGWL W G+FAL
Sbjct  411  IVIHNSRVMAAPDLRPVQGSFKSYLGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFAL  470

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY + G G++T  RVKWPGY  + +  EA +FTV NF+ G  WI A GVPF   
Sbjct  471  STLYYGEYMSTGSGASTKGRVKWPGYHTITSPLEAGKFTVENFLAGNSWISAAGVPFESG  530

Query  79   L  77
            L
Sbjct  531  L  531



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG  FI + ITI N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  272  GATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLY  331

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  332  VHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARXP-PNRTNTLTAQGRTDPNQNTGI  390

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I NC+V AA+DL PVQSS K +LGRPWK+YSRTV + + L SLI+PAGW+EW G+FAL 
Sbjct  391  IIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVXIKTFLDSLINPAGWMEWSGDFALN  450

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+T+ RVKW GY +L + S+ +QFTVGNFI G  W+PAT VPF   L
Sbjct  451  TLYYAEYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_003526378.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=528

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 190/238 (80%), Gaps = 1/238 (0%)
 Frame = -2

Query  787  TTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLYVH  608
            TTF SATVAV G GFI +GIT  N AGPE HQAVALR G+DLSVF+  +F  YQDTLYVH
Sbjct  289  TTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRCGADLSVFYRCAFEGYQDTLYVH  348

Query  607  SLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGISI  428
            S RQFY++C++YGTVDFIFGNAAVVFQ+CN+YAR+PM  QKN  TAQGR DPNQNTGI I
Sbjct  349  SQRQFYKECNIYGTVDFIFGNAAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICI  408

Query  427  LNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTL  248
             N +V AA DL+PV SSFK +LGRPW+EYSRTVF+ + L  L+DPAGWLEW G+FAL TL
Sbjct  409  QNSRVMAAEDLVPVLSSFKTFLGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTL  468

Query  247  YYGEYQNRGPGSNTSARVKWPGYR-ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            YYGEY+N GP  +T  RVKW GY  I + +EA++FTV NFI G+ W+PATG+PF   L
Sbjct  469  YYGEYKNLGPRGSTRGRVKWGGYHAITSATEASKFTVENFIAGKSWLPATGIPFLFGL  526



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  277  GSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  VQSS K YLGRPW+EYSRTVFM + L SLI+ AGW+EWDG FAL 
Sbjct  396  SIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALD  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T++RV W GY ++ + +EA++FTVG+FI G  W+PATGVP+   L
Sbjct  456  TLYYGEYLNTGPGSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 189/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +G+T  N AG   HQAVALRSGSDLSV++  SF  YQDTLY
Sbjct  259  GSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLY  318

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             +S RQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  319  TYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYXRNP-PNKINTVTAQGRTDPNQNTGI  377

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +CKV AA+DL  VQSS K YLGRPWKEYSRTVF+ + L SLI+ AGW+EW G+FALK
Sbjct  378  SIHDCKVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALK  437

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  438  TLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  497



>ref|XP_002515774.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF46613.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=571

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 186/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF S+TVAV G  F+   +T  N AGP+KHQAVALR+ +DLS F+  SF  YQDT
Sbjct  327  VDGWTTFNSSTVAVSGERFVAVDVTFRNTAGPQKHQAVALRNNADLSTFYRCSFEGYQDT  386

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGN+A VFQ+CNLYARKP+ NQKN FTAQGR DPNQNT
Sbjct  387  LYVHSLRQFYRECDIYGTVDFIFGNSAAVFQSCNLYARKPLPNQKNAFTAQGRTDPNQNT  446

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  N+LGRPWK+YSRTVFM S +G LI P GWLEW+G   
Sbjct  447  GISIHNCTIEAAPDLAMDLNSTLNFLGRPWKQYSRTVFMQSYIGDLISPVGWLEWNGTVG  506

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYYGE++N GPG+NTS RV+WPGY ++N S+A  FTV NF +G  W+P T +PF
Sbjct  507  LDTLYYGEFENYGPGANTSMRVQWPGYNLMNVSQAANFTVYNFTMGDTWLPETDIPF  563



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  277  GSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  VQSS K YLGRPW+EYSRTVFM + L SLI+ AGW+EWDG FAL 
Sbjct  396  SIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALD  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T++RV W GY ++ + +EA++FTVG+FI G  W+PATGVP+   L
Sbjct  456  TLYYGEYLNTGPGSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/240 (67%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TT+ SAT AV G  FI +GIT  N AGP KHQAVALRS SDLSVF+  SF  YQDTLY
Sbjct  233  GSTTYNSATFAVTGERFIARGITFRNTAGPAKHQAVALRSSSDLSVFYQCSFQGYQDTLY  292

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             HSLRQFYR+C +YGTVDFIFGNAAVVFQNCN+Y R+PM+ QKN  TAQGR DPNQNTGI
Sbjct  293  AHSLRQFYRECKIYGTVDFIFGNAAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQNTGI  352

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA DL PV+SSF+ +LGRP KEYSRTV+M + +  LI PAGWLEW G+FAL+
Sbjct  353  SIQNCRVTAAKDLRPVRSSFQTFLGRPLKEYSRTVYMETYMDDLISPAGWLEWSGDFALE  412

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+YGE++N GPGSNTS RVKW GY I+ + S A +FT    I G+ W+P++G+PF ++L
Sbjct  413  TLFYGEFRNTGPGSNTSKRVKWGGYHIITDPSTALEFTARILIAGEMWLPSSGLPFKLDL  472



>emb|CBI36882.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 182/237 (77%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV  GF+   IT  N AG  KHQAVALRSG+DLS F+  SF AYQDT
Sbjct  325  VDGWTTFNSATFAVVAQGFVAVNITFRNTAGAAKHQAVALRSGADLSTFYLCSFEAYQDT  384

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R P++ Q N  TAQGR DPNQNT
Sbjct  385  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRLPLSGQFNAITAQGRTDPNQNT  444

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL     + K YLGRPWKEYSRTV+M SN+GSLI+P+GW  W G+FA
Sbjct  445  GTSIHNCVIRAADDLAASNGTTKTYLGRPWKEYSRTVYMQSNMGSLINPSGWSIWSGDFA  504

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNTS RV W GY ++  S+A  FTVGNF+LG  W+P TGVP+
Sbjct  505  LSTLYYAEYNNTGPGSNTSNRVTWSGYHVIGPSDAANFTVGNFLLGGDWLPQTGVPY  561



>gb|KJB49890.1| hypothetical protein B456_008G143800 [Gossypium raimondii]
Length=566

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 187/243 (77%), Gaps = 0/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV   F+   +T +N AG  KHQAVALR+G+DLS F++ SF  YQDT
Sbjct  324  VDGWTTFNSATFAVVAPNFVAINMTFQNTAGAIKHQAVALRNGADLSAFYSCSFEGYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCD+YGTVDFIFGNAAVV QNCN+Y R+PM+ Q N  TAQGR DPNQNT
Sbjct  384  LYTHSLRQFYRDCDIYGTVDFIFGNAAVVLQNCNIYPRQPMSGQFNAITAQGRTDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI +C +  A DL    ++FK YLGRPWKEYSRTV+M + +GSLIDPAGW EW+G+FA
Sbjct  444  GISIHDCNIMPADDLASSNTTFKTYLGRPWKEYSRTVYMQNFMGSLIDPAGWREWNGDFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N GPGSNTS+RV W GY  +N ++A  FTV  F+LG  W+P TGVP+  +
Sbjct  504  LSTLYYAEYDNSGPGSNTSSRVTWSGYHTINATDAANFTVSGFLLGNDWLPNTGVPYTAS  563

Query  79   LTA  71
            L A
Sbjct  564  LLA  566



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   344 bits (883),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+   F  YQDTLY
Sbjct  277  GSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  +QSS K YLGRPWK+YSRT+FM + L SL++ AGW+EWDG FAL 
Sbjct  396  SIHNCKVTAASDLKSIQSSVKTYLGRPWKQYSRTIFMKTYLDSLVNSAGWMEWDGNFALD  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GY ++ + +EA +FTVG+F+ G  W+PATGVP+   L
Sbjct  456  TLYYGEYVNTGPGSSTTNRVKWAGYHVITSATEAAKFTVGSFLAGGSWLPATGVPYTSGL  515



>ref|XP_007141001.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
 gb|ESW12995.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
Length=609

 Score =   347 bits (890),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 189/244 (77%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDG TTF +A+ A  G GFI + IT ENYAGP KHQAVALR G+D +V +  + V YQD+
Sbjct  366  IDGMTTFHTASFAASGAGFIARDITFENYAGPAKHQAVALRVGADHAVVYRCNIVGYQDS  425

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
             YVHS RQF+R+CD+YGTVDFIFGNAAVVFQ CN+YARKPMA QKN  TAQ R+DPNQNT
Sbjct  426  CYVHSNRQFFRECDIYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNT  485

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GIS+ NC++  A DL+PV+ SF  YLGRPWK++SRTVFMLS +G  I   GWLEW+G+FA
Sbjct  486  GISMHNCRIQPAPDLVPVKGSFPTYLGRPWKQFSRTVFMLSYMGDHIHSRGWLEWNGDFA  545

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N GPG+    RVKWPGYR++ ++ EAN+FTV  FI G  W+P+TGV F  
Sbjct  546  LDTLYYGEYMNYGPGAGVGQRVKWPGYRVITSAVEANRFTVAQFISGSAWLPSTGVAFAA  605

Query  82   NLTA  71
             L+A
Sbjct  606  GLSA  609



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   344 bits (882),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 189/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVA VG GFI + ITI N AGP+ HQAV+LRSGSDLSVF+  SF  YQDTLY
Sbjct  279  GSTTFNSATVAAVGDGFIARDITIRNTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLY  338

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVD IFGNAAVV QNCN+YAR+P  N+ N  TAQ R DPNQNTGI
Sbjct  339  VHSERQFYRECDIYGTVDVIFGNAAVVLQNCNIYARRP-PNKTNTVTAQSRTDPNQNTGI  397

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PAGW+EWDG FAL 
Sbjct  398  IIHNSRVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTFLDSLINPAGWMEWDGNFALN  457

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N G GS+TS RVKW GY +L + SEA++FTV NF+ G  W+PATGVPF   L
Sbjct  458  TLYYAEYMNTGTGSSTSNRVKWRGYHVLTSASEASKFTVSNFLAGNSWLPATGVPFTSGL  517



>ref|XP_008235120.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Prunus mume]
Length=560

 Score =   345 bits (886),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 183/237 (77%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV   GF+   +T  N AG  KHQAVA+R+G+DLS F++ SF AYQDT
Sbjct  319  VDGWTTFNSATFAVTAPGFVAVNMTFRNTAGAIKHQAVAVRNGADLSTFYSCSFEAYQDT  378

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R PM+ Q N  TAQGR DPNQNT
Sbjct  379  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRLPMSGQFNAITAQGRTDPNQNT  438

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    SS K YLGRPWKEYSRTV+M S + S++DPAGW  WDGEFA
Sbjct  439  GTSIHNCTIRAADDLASSNSSSKTYLGRPWKEYSRTVYMQSYIDSVVDPAGWRAWDGEFA  498

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNT++RV W GY ++N ++A  FTV NF+LG  W+P TGVP+
Sbjct  499  LSTLYYAEYNNTGPGSNTTSRVTWTGYHVINATDAANFTVTNFLLGDDWLPQTGVPY  555



>ref|XP_002268492.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Vitis vinifera]
Length=556

 Score =   345 bits (885),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 182/237 (77%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV  GF+   IT  N AG  KHQAVALRSG+DLS F+  SF AYQDT
Sbjct  315  VDGWTTFNSATFAVVAQGFVAVNITFRNTAGAAKHQAVALRSGADLSTFYLCSFEAYQDT  374

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R P++ Q N  TAQGR DPNQNT
Sbjct  375  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRLPLSGQFNAITAQGRTDPNQNT  434

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL     + K YLGRPWKEYSRTV+M SN+GSLI+P+GW  W G+FA
Sbjct  435  GTSIHNCVIRAADDLAASNGTTKTYLGRPWKEYSRTVYMQSNMGSLINPSGWSIWSGDFA  494

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNTS RV W GY ++  S+A  FTVGNF+LG  W+P TGVP+
Sbjct  495  LSTLYYAEYNNTGPGSNTSNRVTWSGYHVIGPSDAANFTVGNFLLGGDWLPQTGVPY  551



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   342 bits (876),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TT+ SATVAVVG GFI +G+TI N AG   HQAVALRSGSDLSV++  SF  YQDTLY
Sbjct  206  GSTTYNSATVAVVGDGFIARGMTIRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLY  265

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            V+S RQFYR+CD+YGTVDFIFGNAAVVFQ CN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  266  VYSDRQFYRECDIYGTVDFIFGNAAVVFQKCNIYARNP-PNKVNTVTAQGRTDPNQNTGI  324

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +C+V AA+DL  VQSS K YLGRPWKEYSRTVF+ + L SLI+ AGWLEW G+FAL 
Sbjct  325  SIHDCEVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALN  384

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  385  TLYYGEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  444



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/240 (67%), Positives = 189/240 (79%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TT+ SA  AV G  F+ +GIT  N AGP KHQAVALRS SDLSVF   SF  YQDTLY
Sbjct  221  GSTTYNSAAFAVTGEKFMARGITFRNTAGPAKHQAVALRSNSDLSVFHQCSFEGYQDTLY  280

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHSLRQFYR+C+VYGTVDFIFGNAAVVFQ+CN+Y R+PM+ QKN  TAQGR DPNQNTGI
Sbjct  281  VHSLRQFYRECEVYGTVDFIFGNAAVVFQSCNIYVRRPMSQQKNTITAQGRTDPNQNTGI  340

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI  C+V AA DL P QSSF+ +LGRPWKE SRTV+M + +  LI PAGWLEW G FAL+
Sbjct  341  SIQYCRVRAAKDLRPAQSSFETFLGRPWKENSRTVYMETYMDDLISPAGWLEWSGGFALE  400

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+YGE++N GPGSNTS RVKW GY ++ + S A++FT  N I G+ W+P+TGVPF ++L
Sbjct  401  TLFYGEFRNTGPGSNTSKRVKWGGYHVITDPSAASEFTARNLIAGEMWLPSTGVPFTLDL  460



>gb|AGV54687.1| pectinesterase [Phaseolus vulgaris]
Length=606

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 189/244 (77%), Gaps = 1/244 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDG TTF +A+ A  G GFI + IT ENYAGP KHQAVALR G+D +V +  + V YQD+
Sbjct  363  IDGMTTFHTASFAASGAGFIARDITFENYAGPAKHQAVALRVGADHAVVYRCNIVGYQDS  422

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
             YVHS RQF+R+CD+YGTVDFIFGNAAVVFQ CN+YARKPMA QKN  TAQ R+DPNQNT
Sbjct  423  CYVHSNRQFFRECDIYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNT  482

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GIS+ NC++  A DL+PV+ SF  YLGRPWK++SRTVFMLS +G  I   GWLEW+G+FA
Sbjct  483  GISMHNCRIQPAPDLVPVKGSFPTYLGRPWKQFSRTVFMLSYMGDHIHSRGWLEWNGDFA  542

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N GPG+    RVKWPGYR++ ++ EAN+FTV  FI G  W+P+TGV F  
Sbjct  543  LDTLYYGEYMNYGPGAGVGQRVKWPGYRVITSAVEANRFTVAQFISGSAWLPSTGVAFAA  602

Query  82   NLTA  71
             L+A
Sbjct  603  GLSA  606



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 193/242 (80%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF+SATVAV G GFI +GIT  N AGP+ HQAVALRSGSD SVF+   F  YQDT
Sbjct  280  VGGSTTFKSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSDQSVFYRCGFEGYQDT  339

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHS RQFY++C +YGTVDFIFGNAAVV QNC ++AR+PM  QK   TAQGR DPNQNT
Sbjct  340  LYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIFARQPMDKQKITITAQGRTDPNQNT  399

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI N +V AA+DL PV ++FK YLGRPWK+YSRTVFM + L SL+DPAGWLEWDG FA
Sbjct  400  GISIHNSRVMAASDLRPVLNTFKTYLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGNFA  459

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY+N G G++TS RV+W GYR++ N++EA +F+V NFI G+ W+PAT VPF  
Sbjct  460  LNTLYYGEYRNSGAGASTSRRVRWRGYRVITNSNEAAKFSVENFIAGRSWLPATNVPFRA  519

Query  82   NL  77
             L
Sbjct  520  GL  521



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 181/241 (75%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TT+RSAT  V G GFI + +T EN AGP+KHQAVALRS SD SVF+  SF  YQDTL
Sbjct  297  DGSTTYRSATFGVTGEGFIAQDMTFENTAGPQKHQAVALRSSSDHSVFYRCSFKGYQDTL  356

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS RQFYRDCD++GTVDFI G+A  V QNCN+YARKPM+NQ N  TAQ R DPN+NTG
Sbjct  357  YVHSQRQFYRDCDIHGTVDFICGDATAVLQNCNIYARKPMSNQINTITAQSRTDPNENTG  416

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I N ++ AA DL PVQ SFK YLGRPWK+YSRTV M SNL  LIDPAGW  W G FAL
Sbjct  417  IVIHNSRITAAQDLRPVQGSFKTYLGRPWKKYSRTVIMKSNLDGLIDPAGWFPWSGSFAL  476

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY N G G+ T  RV WPGYR++ + +EA +FTVGN + G  WIP TGVPF   
Sbjct  477  STLYYGEYMNSGAGAGTGGRVNWPGYRVIRSATEAGKFTVGNLLAGDSWIPGTGVPFTTG  536

Query  79   L  77
            L
Sbjct  537  L  537



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 191/243 (79%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +D  TT+RSAT+AVVGTGF+ + +T+EN AGP KHQAVALR  +DLS F+  SF  YQDT
Sbjct  356  VDNSTTYRSATLAVVGTGFLARDLTVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDT  415

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCDVYGTVDF+FG+AA V Q C+LYAR+P   QKN+FTAQGREDPNQNT
Sbjct  416  LYAHSLRQFYRDCDVYGTVDFVFGDAAAVLQGCSLYARRPDPRQKNVFTAQGREDPNQNT  475

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GI +   KVAAAADLIPV ++F +YLGRPWK YSRTVF+ + +  LI P GWLEW+G FA
Sbjct  476  GIVVQGGKVAAAADLIPVLANFTSYLGRPWKLYSRTVFIQTKMEELIHPRGWLEWNGSFA  535

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYY EY NRGPG+NTSARV WPGY +L N ++A  FTV NFI G  W+ +T  P+ +
Sbjct  536  LDTLYYAEYMNRGPGANTSARVDWPGYHVLTNATDATNFTVLNFIQGDLWLNSTAFPYTL  595

Query  82   NLT  74
             L+
Sbjct  596  GLS  598



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 193/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSATVAVVG GFI +GIT  N AG + HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  277  GTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C++YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQ+S + YLGRPWK+YSRTVFM + L  LI+PAGW+EW G FAL 
Sbjct  396  SIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALD  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GYR++ + SEA++F+V NFI G  W+P+T VPF  +L
Sbjct  456  TLYYGEYMNTGPGSSTARRVKWSGYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL  515



>ref|XP_002273427.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Vitis vinifera]
 emb|CBI29156.3| unnamed protein product [Vitis vinifera]
Length=567

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 184/238 (77%), Gaps = 0/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV G  F+   IT  N AGPEKHQAVA+R+ +DLS F+  SF  YQDT
Sbjct  326  VDGWTTFNSATFAVSGERFVAIDITFRNTAGPEKHQAVAVRNNADLSTFYRCSFEGYQDT  385

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDC VYGTVDFIFGN+A +FQNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  386  LYAHSLRQFYRDCIVYGTVDFIFGNSACIFQNCNLYARKPMPNQKNAFTAQGRMDPNQNT  445

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  NYLGRPWK+YSRTV+M S +GSLIDP GWLEW+G   
Sbjct  446  GISIHNCTIEAAPDLAMDLNSTLNYLGRPWKQYSRTVYMQSYIGSLIDPVGWLEWNGTVG  505

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFY  86
            L TLYYGE++N GPG+NTS RV+WPGY ++N S+A  FTV NF +G  W+    +PFY
Sbjct  506  LDTLYYGEFENYGPGANTSMRVQWPGYTLMNASQAVNFTVYNFTMGDTWLTNLDIPFY  563



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TT+ SATVAVVG GFI +G+T  N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  275  GSTTYNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVFYQCSFEGYQDTLY  334

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             +S RQFYR+CD+YGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  335  TYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGI  393

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +CKV AA+DL  VQSS K YLGRPWKEYSRTVF+ + L SLI+ AGW+EW G+FALK
Sbjct  394  SIHDCKVTAASDLKAVQSSVKIYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALK  453

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  454  TLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTKVPFTSGL  513



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 189/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +G+T  N AG   HQAVALRSGSDLSV++  SF  YQDTLY
Sbjct  274  GSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLY  333

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             +S RQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  334  TYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYVRNP-PNKINTVTAQGRTDPNQNTGI  392

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +CKV AA+DL  VQSS K YLGRPWKEYSRTVF+ + L SLI+ AGW+EW G+FALK
Sbjct  393  SIHDCKVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALK  452

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  453  TLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  512



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF+SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+   F  YQDT
Sbjct  277  VGGSTTFKSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDT  336

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS RQFYR+C VYGTVDFIFGNAAVVFQNC +YARKPM+ Q+N  TAQGR DPNQNT
Sbjct  337  LYTHSQRQFYRECYVYGTVDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNT  396

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V AA D      S K +LGRPWKEYSRTVFM S L +L+DPAGWL+W G+FA
Sbjct  397  GISIHDSRVMAALDFESSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFA  456

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPG+ T+ RVKW GYRI+ ++SEA++FTV NFI G  W+PAT V F  
Sbjct  457  LKTLYYGEYKNIGPGAPTTGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAA  516

Query  82   NL  77
             L
Sbjct  517  GL  518



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            + G TTF+SATVAV G GFI +GIT  N AGPE HQAVALRSG+DLSVF+   F  YQDT
Sbjct  277  VGGSTTFKSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDT  336

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HS RQFYR+C VYGTVDFIFGNAAVVFQNC +YARKPM+ Q+N  TAQGR DPNQNT
Sbjct  337  LYTHSQRQFYRECYVYGTVDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNT  396

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI + +V AA D      S K +LGRPWKEYSRTVFM S L +L+DPAGWL+W G+FA
Sbjct  397  GISIHDSRVMAALDFESSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFA  456

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY+N GPG+ T+ RVKW GYRI+ ++SEA++FTV NFI G  W+PAT V F  
Sbjct  457  LKTLYYGEYKNIGPGAPTTGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAA  516

Query  82   NL  77
             L
Sbjct  517  GL  518



>ref|XP_008363719.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Malus domestica]
Length=569

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 183/237 (77%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV  GF+   IT  N AG  KHQAVA+RSG+DLS F++ SF AYQDT
Sbjct  328  VDGWTTFNSATFAVVAPGFVAVNITFRNTAGAIKHQAVAVRSGADLSTFYSCSFEAYQDT  387

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R PM+ Q N  TAQGR DPNQNT
Sbjct  388  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRLPMSGQFNAITAQGRTDPNQNT  447

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    SS K YLGRPWKEYSRTV+M S + SL++  GW  WDG+FA
Sbjct  448  GTSIHNCTIRAADDLASSNSSTKTYLGRPWKEYSRTVYMQSYIDSLVEXVGWRAWDGDFA  507

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNT+ RV WPGY ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  508  LSTLYYAEYNNTGPGSNTTNRVTWPGYHVINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 187/240 (78%), Gaps = 4/240 (2%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI + IT +N AGP   QAVALRSGSDLSVF+   F   QDTLY
Sbjct  275  GSTTFNSATVAVVGDGFIAQDITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLY  334

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+Y      ++ N  TAQGR DPNQNTGI
Sbjct  335  VHSDRQFYRECDIYGTVDFIFGNAAVVLQNCNIYVHN---HKTNTVTAQGRSDPNQNTGI  391

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL  VQSS K YLGRPW+EYSRTVFM + L SLIDPAGW+EW G FALK
Sbjct  392  SIHNCKVTAASDLKSVQSSVKTYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALK  451

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RVKW GY ++ + SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  452  TLYYGEYMNTGPGSSTSNRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 184/243 (76%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDG TTF SAT A VG GF+ + +   N AGP+KHQAVALR GSD SV +     AYQDT
Sbjct  314  IDGSTTFNSATFAAVGNGFMAQDMAFVNTAGPQKHQAVALRVGSDQSVLYRCKIAAYQDT  373

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+C + GTVDFIFGNAAVVFQ+C L  RKP ANQKN  TAQGR DPNQNT
Sbjct  374  LYAHSLRQFYRECKISGTVDFIFGNAAVVFQSCILVPRKPGANQKNAITAQGRTDPNQNT  433

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCK+    DL+PV+SSF  YLGRPWKEYSRTVFM S +   I PAGWLEWDG+FA
Sbjct  434  GISIHNCKITPGTDLVPVKSSFPTYLGRPWKEYSRTVFMQSYIDGFIQPAGWLEWDGDFA  493

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYV  83
            LKTLYYGEY N GPGS T  RVKWPGYR++ +  EA++FTVG FI G  W+ +TGV +  
Sbjct  494  LKTLYYGEYMNTGPGSGTGNRVKWPGYRVIKSPQEASKFTVGEFIQGDSWLQSTGVHYVD  553

Query  82   NLT  74
             LT
Sbjct  554  GLT  556



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSAT A VG  FI + +T  N AG + HQAVALRSGSD SVF+  SF  YQDTLY
Sbjct  276  GTTTFRSATFAAVGDNFIARDMTFRNTAGAKNHQAVALRSGSDFSVFYKCSFEGYQDTLY  335

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  336  VHSQRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRSP-PNKTNTITAQGRTDPNQNTGI  394

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA+DL PVQ S K YLGRPWKEYSRTVFM + L SLI+PAGWL W+G FAL 
Sbjct  395  SIHNCRVTAASDLKPVQGSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWLPWNGNFALD  454

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RV W GYR++ +S  A+QFTVG+FI G  W+PAT VPF   L
Sbjct  455  TLYYGEYMNTGPGSSTANRVNWKGYRVITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/239 (70%), Positives = 186/239 (78%), Gaps = 4/239 (2%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI + IT  N AG   HQAVALRSGSD SVF+  SF  YQDTLY
Sbjct  284  GSTTFQSATVAVVGDGFIAQDITFRNTAGASNHQAVALRSGSDQSVFYKCSFEGYQDTLY  343

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR D NQNTGI
Sbjct  344  VHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARDP-PNKTNTITAQGRTDSNQNTGI  402

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA+ L    SS K YLGRPWKEYSRTV M +NLGSLI+PAGWLEW G FALK
Sbjct  403  SIHNCRVTAASSL---SSSVKTYLGRPWKEYSRTVVMKTNLGSLINPAGWLEWSGNFALK  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+TS RVKW GY ++  SEA++FTVGNFI G  W+PAT VP+   L
Sbjct  460  TLYYAEYANTGPGSSTSNRVKWTGYHVIGASEASKFTVGNFIAGGSWLPATNVPYTSGL  518



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 187/237 (79%), Gaps = 1/237 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATVA VG  F+ + IT +N AGP KHQAVALR GSD S F+    +AYQDTL
Sbjct  324  DGSTTFRSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTL  383

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHSLRQFYR+C +YGTVDFIFGNAA V QNC++ AR+P + QKN+ TAQGREDPNQNTG
Sbjct  384  YVHSLRQFYRECFIYGTVDFIFGNAAAVLQNCDILARRPNSGQKNMVTAQGREDPNQNTG  443

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI  C+++A +DL PV+SSF  YLGRPWKEYSRTV M S +  +I+PAGW EW+G FAL
Sbjct  444  ISIHKCRISADSDLAPVKSSFPTYLGRPWKEYSRTVIMQSTISDVINPAGWHEWNGNFAL  503

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPF  89
             TLYYGEYQN G G+ TS RVKW GY+++ + SEA QFTVG+FI G  W+ +TG PF
Sbjct  504  NTLYYGEYQNTGAGAGTSGRVKWKGYKVITSASEAKQFTVGDFINGGSWLGSTGFPF  560



>ref|XP_010269594.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Nelumbo nucifera]
Length=568

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 186/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTF SAT+AVVG GF+   ITI N AGP K QAVA+R+G+DLS F++ SF  YQDTL
Sbjct  328  DGSTTFNSATLAVVGQGFVAVDITIRNTAGPAKGQAVAVRNGADLSTFYSCSFQGYQDTL  387

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+YAR+P   Q N  TAQGR DPNQNTG
Sbjct  388  YTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARQPRKGQGNAITAQGRTDPNQNTG  447

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
             SI NC + AAADL+    + K YLGRPWKEYSRTV+M S + SL++P+GW  W G+FAL
Sbjct  448  TSIQNCSIKAAADLVASNFTTKTYLGRPWKEYSRTVYMQSFIDSLVEPSGWSIWTGDFAL  507

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFY  86
             TLYY EY N GPGSNTS RV WPGY ++N ++A  FTV NFILG  WIPATGVP+Y
Sbjct  508  STLYYAEYNNWGPGSNTSNRVTWPGYHVINATDAANFTVSNFILGDAWIPATGVPYY  564



>ref|XP_011038599.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=531

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 186/241 (77%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSATV V G GFI + +T EN AGP+KHQAVALRSGSD SVF++ SF  YQDTL
Sbjct  291  DGTTTFRSATVGVSGKGFIARDMTFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTL  350

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS RQFYRDCD+YGTVDFIFG+A  V QNCN+Y R+PM+ Q+N  TAQGR DP +NTG
Sbjct  351  YVHSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRRPMSKQENTVTAQGRTDPGENTG  410

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I N +V AA+DL PVQ  FK+YLGRPWK+YSRTVF+ SN+  LIDPAGWL W G+FAL
Sbjct  411  IVIHNSRVMAASDLRPVQGLFKSYLGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFAL  470

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY + G G++T  RVKWPGY  + +  EA +FTV NF+ G  WI A GVPF   
Sbjct  471  STLYYGEYMSTGSGASTKGRVKWPGYHTITSPLEAGKFTVENFLAGNSWISAAGVPFEAG  530

Query  79   L  77
            L
Sbjct  531  L  531



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 188/241 (78%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DGWT + SATVA+ G GF+ KGIT EN+AGP+K QA A RS SD S FF  +F +YQDT+
Sbjct  297  DGWTAYWSATVAIEGDGFLAKGITFENFAGPKKGQAAAFRSRSDKSAFFQCNFSSYQDTM  356

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS RQFYRDCD+YGT+DFIFG+AAVVFQNCNLYARKP   Q N+FTAQGREDP   TG
Sbjct  357  YVHSHRQFYRDCDIYGTIDFIFGDAAVVFQNCNLYARKPNEGQANVFTAQGREDPLGQTG  416

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            +S L C  AAA DL PVQSSFK +LGRPWKE+SRTV M S +G L+DPAGW E+ G   L
Sbjct  417  MSFLGCNFAAAPDLAPVQSSFKTFLGRPWKEFSRTVIMESYIGDLVDPAGWSEFHGSAGL  476

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSE-ANQFTVGNFILGQQWIPATGVPFYVN  80
            +TL+YGEYQNRGPGSN S RVKWPGY+++ +S  A QFTV +FI G QW+  TG P++  
Sbjct  477  RTLFYGEYQNRGPGSNMSDRVKWPGYKVITSSTVAKQFTVESFIQGNQWLNNTGFPYFSG  536

Query  79   L  77
            L
Sbjct  537  L  537



>ref|XP_002874923.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51182.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 185/241 (77%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV    F+   +T  N AGPEKHQAVA+RS +DLS+F++ SF AYQDT
Sbjct  333  VDGWTTFNSATFAVTSLNFVAVNMTFRNTAGPEKHQAVAMRSSADLSIFYSCSFEAYQDT  392

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R+PM NQ N  TAQGR DPNQNT
Sbjct  393  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRQPMQNQFNAITAQGRTDPNQNT  452

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC +  A DL+    + K YLGRPWKEYSRTVFM S +  +++P GW EW+G+FA
Sbjct  453  GISIHNCTIKPADDLVSSNYTVKTYLGRPWKEYSRTVFMQSYIDEVVEPVGWREWNGDFA  512

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N G GSNT+ RV WPGY ++N+++AN FTV NF+LG  W+  +GVP+   
Sbjct  513  LSTLYYAEYNNTGSGSNTTDRVVWPGYHVINSTDANNFTVENFLLGDGWMVQSGVPYISG  572

Query  79   L  77
            L
Sbjct  573  L  573



>emb|CDP17208.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   342 bits (876),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 179/237 (76%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV G GF+   ITI N AG  KHQAVA+R+G+DLS F+N SF  YQDT
Sbjct  270  VDGWTTFNSATFAVTGQGFVGMNITIRNTAGAVKHQAVAVRNGADLSTFYNCSFEGYQDT  329

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFY+ CDVYGTVDFIFGNAAVVFQNCNLY R PM  Q N  TAQGR D NQNT
Sbjct  330  LYTHSLRQFYKQCDVYGTVDFIFGNAAVVFQNCNLYPRLPMQGQFNAITAQGRTDINQNT  389

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL     + K YLGRPWKEYSRTV+M S LGSLIDPAGW  W G+FA
Sbjct  390  GTSIQNCNIMAAPDLASSNGTTKTYLGRPWKEYSRTVYMQSFLGSLIDPAGWTPWSGDFA  449

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGS+T+ RV WPGY ++N ++A  FTV NFILG  W+P TGV +
Sbjct  450  LSTLYYAEYDNSGPGSDTTNRVTWPGYHVINAADAANFTVANFILGDNWLPQTGVTY  506



>ref|XP_007220646.1| hypothetical protein PRUPE_ppa003474mg [Prunus persica]
 gb|EMJ21845.1| hypothetical protein PRUPE_ppa003474mg [Prunus persica]
Length=572

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 183/238 (77%), Gaps = 0/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF S+T AV    FI   IT  N AGP+KHQAVA+R+ +DLS F+  SF  YQDT
Sbjct  330  VDGWTTFNSSTFAVSAERFIAIDITFRNTAGPQKHQAVAVRNNADLSTFYRCSFEGYQDT  389

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFY++CD+YGTVDFIFG+A  VFQ+CNLYARKPMANQKN FTAQGR DPNQNT
Sbjct  390  LYVHSLRQFYKECDIYGTVDFIFGDATAVFQSCNLYARKPMANQKNAFTAQGRSDPNQNT  449

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AAADL    +S  NYLGRPWK YSRTV M S +G LI   GWLEW+G   
Sbjct  450  GISIHNCTIEAAADLALDLNSTLNYLGRPWKLYSRTVIMQSYIGPLISSVGWLEWNGTVG  509

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFY  86
            L TLYYGE+QN GPG+NTS RV+WPGY ++N S+A  FTV NF LG  W+P T +PFY
Sbjct  510  LDTLYYGEFQNHGPGANTSKRVQWPGYNLMNASQAVNFTVLNFTLGDTWLPDTDIPFY  567



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 186/236 (79%), Gaps = 0/236 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            D  T+FRSATV + G GFI + +T EN AGP+KHQAVALRSGSDLSVF+  SF  YQDTL
Sbjct  293  DAGTSFRSATVGITGNGFIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTL  352

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS RQFYR+CD+YGTVDFI+G+A  V QNCN+Y RKPM+ QKN  TAQGR DPN+NTG
Sbjct  353  YVHSNRQFYRNCDIYGTVDFIWGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTG  412

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI N  V A +DL  VQ SFK YLGRPW++YSRTVFM ++L SLIDP GWLEW G FAL
Sbjct  413  ISIHNSLVTATSDLKAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPEGWLEWSGNFAL  472

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             TLYYGE+ N GPG++TS RVKW G+ ++N ++A +FTV +F+ G  WI A GVPF
Sbjct  473  STLYYGEFLNTGPGASTSGRVKWAGFHVMNKADAQKFTVESFLGGSSWIAAAGVPF  528



>ref|XP_008386683.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Malus domestica]
Length=569

 Score =   343 bits (880),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 185/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT+AVV  GF+   IT  N AG  KHQAVA+R+G+DLS F++ SF AYQDT
Sbjct  328  VDGWTTFNSATLAVVAPGFVAVNITFRNTAGAIKHQAVAVRNGADLSTFYSCSFEAYQDT  387

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R PM+ Q N  TAQGR DPNQNT
Sbjct  388  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRLPMSGQFNAITAQGRTDPNQNT  447

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    SS + YLGRPWKEYSRTV+M S + S++DP GW EW+G+FA
Sbjct  448  GTSIHNCTIRAADDLASSNSSTQTYLGRPWKEYSRTVYMQSYIDSVVDPVGWQEWNGDFA  507

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGSNT+ RV W GY ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  508  LTTLYYAEYNNTGPGSNTTNRVTWSGYHVINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +GITI N AGP+ HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  287  GSTTFKSATVAVVGDGFICRGITIRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLY  346

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CDVYGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  347  VHSDRQFYRECDVYGTVDFIFGNAAVVLQNCNIFARDP-PNKTNTVTAQGRTDPNQNTGI  405

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC++ AA+DL   ++S K YLGRPWK+YSRTV M + L SLI P GW+ W G FALK
Sbjct  406  SIHNCRITAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALK  465

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GYR++ + +EA++FT  NFI G  W+PAT VPF   L
Sbjct  466  TLYYGEYLNTGPGSSTANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTSGL  525



>emb|CDY68840.1| BnaCnng60750D, partial [Brassica napus]
Length=435

 Score =   339 bits (869),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 182/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV    F+   IT  N AGPEKHQAVALRS +DLS+F++ SF AYQDT
Sbjct  193  VDGWTTFNSATFAVTSPNFVAVNITFRNTAGPEKHQAVALRSSADLSIFYSCSFEAYQDT  252

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVV QNCNLY R+P+ NQ N  TAQGR DPNQNT
Sbjct  253  LYTHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNLYPRQPLPNQFNAITAQGRTDPNQNT  312

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC +  A DL     + K YLGRPWKEYSRTVFM S +   I+P GW EW+G+FA
Sbjct  313  GTSIHNCTIRPADDLASSNYTVKTYLGRPWKEYSRTVFMQSYMDGFIEPVGWREWNGDFA  372

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N GPGS+T+ RV WPGY ++N+++AN FTV NF+ G +W+  +GVP+   
Sbjct  373  LSTLYYAEYNNTGPGSSTTNRVVWPGYHVINSTDANNFTVSNFLFGDEWMVQSGVPYMAG  432

Query  79   L  77
            L
Sbjct  433  L  433



>ref|XP_007050982.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOX95139.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=562

 Score =   342 bits (878),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 187/241 (78%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV   F+   IT +N AG  KHQAVA+R+G DLS F++ SF  +QDT
Sbjct  321  VDGWTTFNSATFAVVAPNFVAVNITFQNTAGAIKHQAVAVRNGGDLSAFYSCSFEGFQDT  380

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R PM+ Q N  TAQGR DPNQNT
Sbjct  381  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRLPMSGQFNAITAQGRTDPNQNT  440

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI +C + AA DL    ++F+ YLGRPWKEYSRTV+M + +GSLI+PAGW EWDG FA
Sbjct  441  GTSIHDCNIVAADDLASSNTAFQTYLGRPWKEYSRTVYMQNYMGSLINPAGWKEWDGTFA  500

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY NRGPGSNTS+RV W GY ++N ++A  FTV +F+LG  W+P +GVP+  +
Sbjct  501  LSTLYYAEYDNRGPGSNTSSRVSWSGYHVINATDAANFTVSSFLLGDDWLPNSGVPYTAS  560

Query  79   L  77
            L
Sbjct  561  L  561



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   341 bits (874),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 190/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TT+ SATVAVVG GFI +G+TI N AG   HQAVALRSGSDLSV++  SF  YQDTLY
Sbjct  275  GSTTYNSATVAVVGDGFIARGMTIRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLY  334

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            V+S RQFYR+CD+YGTVDFIFGNAAVVFQ CN+YAR P  N+ N  TAQGR DPNQNTGI
Sbjct  335  VYSDRQFYRECDIYGTVDFIFGNAAVVFQKCNIYARNP-PNKVNTVTAQGRTDPNQNTGI  393

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI +C+V AA+DL  VQSS K YLGRPWKEYSRTVF+ + L SLI+ AGWLEW G+FAL 
Sbjct  394  SIHDCEVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALN  453

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RV W GY ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  454  TLYYGEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  513



>ref|XP_002315399.2| hypothetical protein POPTR_0010s25400g [Populus trichocarpa]
 gb|EEF01570.2| hypothetical protein POPTR_0010s25400g [Populus trichocarpa]
Length=574

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 186/242 (77%), Gaps = 5/242 (2%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDGWTTF S+T AV G  F+   +T  N AGPEKHQAVALR+ +DLS F+  SF AYQDT
Sbjct  328  IDGWTTFNSSTFAVSGERFVGIDMTFRNTAGPEKHQAVALRNNADLSTFYRCSFEAYQDT  387

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CDVYGTVDFIFGNAA VFQNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  388  LYVHSLRQFYRECDVYGTVDFIFGNAAAVFQNCNLYARKPMLNQKNAFTAQGRTDPNQNT  447

Query  439  GISILNCKVAAAADLIPVQSSFK-----NYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEW  275
            GISI NC + AA DL   ++S       N+LGRPWKEYSRTV M S +G LI P GWLEW
Sbjct  448  GISIHNCTIEAAPDLAMDRNSTDSNLTLNFLGRPWKEYSRTVIMQSYIGELIQPVGWLEW  507

Query  274  DGEFALKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGV  95
            +G   L T+YYGE+QN GPG+NTS RV+WPG+ ++N ++A  FTV NF +G  W+P T V
Sbjct  508  NGTVGLDTIYYGEFQNYGPGANTSRRVQWPGFNLMNATQAVNFTVYNFTMGDTWLPYTDV  567

Query  94   PF  89
            PF
Sbjct  568  PF  569



>ref|XP_006396438.1| hypothetical protein EUTSA_v10029453mg [Eutrema salsugineum]
 gb|ESQ37891.1| hypothetical protein EUTSA_v10029453mg [Eutrema salsugineum]
Length=524

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGW+TF+SATV V G GFI KGI+  N+AG  KHQAVALRSGSDLS F+  +F  YQDT
Sbjct  283  VDGWSTFQSATVGVKGKGFIAKGISFVNFAGLAKHQAVALRSGSDLSAFYQCAFEGYQDT  342

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHS +QFYR+CD++GTVDFI GNAAVVFQNC+LYARKP  NQK  FTAQ R   +Q T
Sbjct  343  LYVHSAKQFYRECDIFGTVDFICGNAAVVFQNCSLYARKPNFNQKIAFTAQSRNHSDQPT  402

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GIS++NC++ A  DLIPV+++FK YLGRPW+ YSRT  + S +  LIDPAGWLEW  +FA
Sbjct  403  GISMINCRILAGDDLIPVKANFKAYLGRPWRRYSRTTIIKSFIDDLIDPAGWLEWQNDFA  462

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYV  83
            L+TLYYGEY N GPGSN + RVKWPGYR + T+ EA QFTVG FI G  W+ +TG+PF++
Sbjct  463  LETLYYGEYMNEGPGSNMTNRVKWPGYRRMQTAMEATQFTVGPFIDGNTWLNSTGIPFHL  522

Query  82   NL  77
             L
Sbjct  523  GL  524



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 187/240 (78%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI + IT EN AGP++HQAVALRSG+D SVF+  SF+ YQDTL
Sbjct  282  DGSTTFRSATFAVSGDGFIARDITFENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTL  341

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV++ RQFYRDCD+YGT+DFIFG+A  V QNCN+Y RKPM+NQ+N  TAQ R DPN+NTG
Sbjct  342  YVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTG  401

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I NC++ AA DLI VQ SFK +LGRPW++YSRTV M S L  LIDPAGW  W G F L
Sbjct  402  IIIHNCRITAAGDLIAVQGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGL  461

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             +LYY EY N G G++T+ RVKWPG+R++++SEA +FTVGNF+ G  WI  +GVPF   L
Sbjct  462  SSLYYAEYANTGAGASTAGRVKWPGFRLISSSEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 187/240 (78%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G GFI + IT EN AGP++HQAVALRSG+D SVF+  SF+ YQDTL
Sbjct  282  DGSTTFRSATFAVSGDGFIARDITFENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTL  341

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV++ RQFYRDCD+YGT+DFIFG+A  V QNCN+Y RKPM+NQ+N  TAQ R DPN+NTG
Sbjct  342  YVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTG  401

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I NC++ AA DLI VQ SFK +LGRPW++YSRTV M S L  LIDPAGW  W G F L
Sbjct  402  IIIHNCRITAAGDLIAVQGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGL  461

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             +LYY EY N G G++T+ RVKWPG+R++++SEA +FTVGNF+ G  WI  +GVPF   L
Sbjct  462  SSLYYAEYANTGAGASTAGRVKWPGFRLISSSEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>ref|XP_010684347.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=590

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 185/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +D +TTF+SAT AV GTGF+   ITI N AG  KHQAVALRSG+DLS F++ SF  YQDT
Sbjct  349  VDNYTTFQSATFAVTGTGFVAMNITIRNTAGAIKHQAVALRSGADLSAFYSCSFEGYQDT  408

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNA VVFQNCN+Y R PM NQ N  TAQGR DPNQNT
Sbjct  409  LYVHSLRQFYRECDIYGTVDFIFGNANVVFQNCNIYPRLPMENQFNAITAQGRTDPNQNT  468

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL   + + + YLGRPWK+YSRTVFM S + +++DPAGW EWDG FA
Sbjct  469  GISIENCIIRAAEDLADSKGTTRTYLGRPWKQYSRTVFMHSYIDNMVDPAGWREWDGTFA  528

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYYGEY N GPGSN + RV W GY +L+ ++A+ FTV  F+ G +W+P TGVP+
Sbjct  529  LDTLYYGEYNNTGPGSNVTGRVSWVGYHLLSATDASNFTVSTFVFGDEWLPKTGVPY  585



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVA VG GFI +GIT  N AG + HQAVA RSGSDLSVF+  SF  YQDTLY
Sbjct  293  GSTTFKSATVAAVGDGFIARGITFRNTAGAQNHQAVAFRSGSDLSVFYQCSFEGYQDTLY  352

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  353  VHSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRNP-PNKTNTLTAQGRTDPNQNTGI  411

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA DL PVQ S K YLGRPW++YSRTVFM + L SLI+PAGW+ W G FAL 
Sbjct  412  SIHNCRVTAAPDLRPVQGSVKTYLGRPWQKYSRTVFMKTFLDSLINPAGWMPWSGNFALD  471

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GY ++ + SEA++FT G+FI    WIPAT VPF   L
Sbjct  472  TLYYGEYANTGPGSSTANRVKWKGYHVITSASEASRFTPGSFIAANSWIPATNVPFTSGL  531



>ref|XP_006287360.1| hypothetical protein CARUB_v10000558mg [Capsella rubella]
 gb|EOA20258.1| hypothetical protein CARUB_v10000558mg [Capsella rubella]
Length=582

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 184/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV    F+   +T  N AGPEKHQAVALRS +DLS+F++ SF AYQDT
Sbjct  340  VDGWTTFNSATFAVTSPNFVAVNMTFRNTAGPEKHQAVALRSSADLSIFYSCSFEAYQDT  399

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R+PM NQ N  TAQGR DPNQNT
Sbjct  400  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRQPMQNQFNAITAQGRTDPNQNT  459

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC +  A DL+    + K YLGRPWKEYSRTVFM S +   ++P GW EW+G+FA
Sbjct  460  GISIHNCTIRPADDLVSSNYTVKTYLGRPWKEYSRTVFMQSYMDGFVEPVGWREWNGDFA  519

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N G GSNT+ RV WPG+ ++N+++AN FTV NF+LG  W+  +GVP+   
Sbjct  520  LSTLYYAEYNNTGSGSNTTDRVVWPGFHVINSTDANNFTVSNFLLGDGWMVQSGVPYLSG  579

Query  79   L  77
            L
Sbjct  580  L  580



>ref|XP_010260073.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 183/237 (77%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT+AVVG GF+   IT+ N AG  KHQAVA+R+G+DLS F++ SF  YQDT
Sbjct  322  VDGWTTFNSATLAVVGEGFVAINITVRNTAGAIKHQAVAVRNGADLSTFYSCSFEGYQDT  381

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAA VFQ+CN+YAR PM  Q N  TAQGR DPNQNT
Sbjct  382  LYTHSLRQFYRECDIYGTVDFIFGNAAAVFQDCNIYARLPMQGQFNALTAQGRTDPNQNT  441

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA+DL     + K YLGRPWK+YSRTV+M S + SLIDPAGW+ W G+FA
Sbjct  442  GTSIQNCNIRAASDLASSSGTTKTYLGRPWKQYSRTVYMQSFIDSLIDPAGWMAWSGDFA  501

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY EY N GPGS T+ RV WPGY ++N ++A  FTV NF+LG  WIP T VP+
Sbjct  502  LTTLYYAEYNNTGPGSGTTDRVTWPGYHLINATDAANFTVSNFLLGDNWIPTTKVPY  558



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSATVAVVG GFI +GIT  N AG + HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  279  GTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLY  338

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C++YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  339  VHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGI  397

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQ+S + YLGRPWK+YSRTVFM + L  LI+P+GW+EW G FAL 
Sbjct  398  SIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALN  457

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYY EY N GPGS+T  RVKWPGYR++   SEA++F+V NFI G  W+PAT VP+  +L
Sbjct  458  TLYYREYMNTGPGSSTGRRVKWPGYRVMTRASEASKFSVANFIAGNAWLPATKVPYTPSL  517



>ref|XP_006433466.1| hypothetical protein CICLE_v10003641mg [Citrus clementina]
 ref|XP_006472136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Citrus sinensis]
 gb|ESR46706.1| hypothetical protein CICLE_v10003641mg [Citrus clementina]
 gb|KDO81782.1| hypothetical protein CISIN_1g008293mg [Citrus sinensis]
Length=571

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF +AT AVVG GF+   IT  N AGP KHQAVA+R+G+D S F++ SF  YQDT
Sbjct  329  VDGWTTFNTATFAVVGQGFVAVNITFRNTAGPTKHQAVAVRNGADKSTFYSCSFEGYQDT  388

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCD+YGT+DFIFGNAAVVFQNCN+Y R+P+ NQ N  TAQGR DPNQNT
Sbjct  389  LYAHSLRQFYRDCDIYGTIDFIFGNAAVVFQNCNMYPRRPLDNQFNAITAQGRTDPNQNT  448

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    ++ + YLGRPWKEYSRTV+M S + SLIDPAGW EW G+FA
Sbjct  449  GISIHNCTIKAADDLANSINATQTYLGRPWKEYSRTVYMQSFMDSLIDPAGWKEWSGDFA  508

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L T YY E+ N GPGS+T+ RV WPGY ++N ++A  FTV +FI G  W+P TGVPF
Sbjct  509  LNTTYYAEFSNTGPGSDTTNRVTWPGYHVINDTDAECFTVSSFIEGDAWLPETGVPF  565



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SAT AVVG GFI + +T  N AGP+ HQAVALRSG+DLSVF+  SF  YQDTLY
Sbjct  276  GATTFNSATFAVVGDGFIARDMTFRNTAGPQNHQAVALRSGADLSVFYKCSFEGYQDTLY  335

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN+Y R P  N+ N  TAQGR DPNQNTGI
Sbjct  336  VHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNP-PNKTNTLTAQGRTDPNQNTGI  394

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQ S + YLGRPWK+YSRTVFM + L SLI+PAGW+EW G FAL 
Sbjct  395  SIHNSRVTAASDLTPVQGSVRTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGNFALD  454

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RV W GY ++ + +EA+QFTVGNFI G  W+P T VPF   L
Sbjct  455  TLYYGEYMNTGPGSSTANRVNWKGYHVITSPTEASQFTVGNFISGNSWLPGTNVPFTSGL  514



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 188/240 (78%), Gaps = 4/240 (2%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI + IT +N AGP   QAVALRSGSDLSVF+   F   QDTLY
Sbjct  275  GSTTFNSATVAVVGDGFIAQDITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLY  334

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            V+S RQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y      ++ N  TAQGR DPNQNTGI
Sbjct  335  VYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYVHN---HKTNTITAQGRSDPNQNTGI  391

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA+DL  VQSS K YLGRPW+EYSRTVFM + L SLIDPAGW+EW G FALK
Sbjct  392  SIHNCRVTAASDLKSVQSSVKTYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALK  451

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+TS RVKW GY ++ + SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  452  TLYYGEYMNTGPGSSTSNRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 189/240 (79%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF+SATVAVVG GFI +GITI N AGP  HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  311  GSTTFKSATVAVVGDGFICRGITIRNTAGPTNHQAVALRSGSDLSVFYQCSFEGYQDTLY  370

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  371  VHSDRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARDP-PNKTNTVTAQGRSDPNQNTGI  429

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NC+V AA+DL   ++S K YLGRPWK+YSRTV M + L SLI P GW+ W G FALK
Sbjct  430  SIHNCRVTAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALK  489

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPGS+T+ RVKW GYR++ + +EA++FT  NFI G  W+PAT VPF   L
Sbjct  490  TLYYGEYLNTGPGSSTANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTSGL  549



>gb|KDO53806.1| hypothetical protein CISIN_1g0081982mg, partial [Citrus sinensis]
Length=352

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 186/247 (75%), Gaps = 3/247 (1%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDGWTTF S+T AV G  F+   +T +N AGP KHQAVALR+ +DLS F+  SF  YQDT
Sbjct  103  IDGWTTFNSSTFAVSGERFVAVDVTFKNTAGPAKHQAVALRNNADLSSFYRCSFEGYQDT  162

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAA VFQNCN+YARKPM NQKN  TAQGR DPNQNT
Sbjct  163  LYVHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARKPMPNQKNAVTAQGRTDPNQNT  222

Query  439  GISILNCKVAAAADL---IPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDG  269
            GI+I NC + AA D    +   ++  NYLGRPWKE+SRTV+M S +G LI P GWLEW+G
Sbjct  223  GIAIQNCSIVAAPDFAKDLNSTATTLNYLGRPWKEFSRTVYMQSYIGDLISPVGWLEWNG  282

Query  268  EFALKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
               L TLYYGE++N GPG+NT+ RVKWPGY ++N S+A  FTV NF +G  W+P T +PF
Sbjct  283  TVGLDTLYYGEFRNYGPGANTTMRVKWPGYSLMNASQALNFTVYNFTMGDTWLPDTDIPF  342

Query  88   YVNLTAS  68
               L  S
Sbjct  343  CGGLVVS  349



>ref|XP_008375415.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Malus domestica]
Length=326

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 183/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF S+T AV    F+   IT  N AGPEKHQAVA+R+ +DLS F+  SF  YQDT
Sbjct  84   VDGWTTFNSSTFAVSAERFVAIDITFRNTAGPEKHQAVAVRNNADLSTFYRCSFEGYQDT  143

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFY++CD+YGTVDFIFGNAA VFQ+CNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  144  LYVHSLRQFYKECDIYGTVDFIFGNAAAVFQSCNLYARKPMPNQKNAFTAQGRTDPNQNT  203

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  N+LGRPWK +SRTV M S +G LI   GWLEW+G   
Sbjct  204  GISIHNCTIEAAPDLAADLNSTLNFLGRPWKVFSRTVIMQSYIGPLISSVGWLEWNGTVG  263

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TL+YGE+QN GPG+NT+ RV+WPGY ++N ++A  FTV NF LG  W+P T +PFY  
Sbjct  264  LDTLFYGEFQNHGPGANTTGRVQWPGYSLMNVTQAVNFTVLNFTLGNTWLPDTDIPFYGG  323

Query  79   L  77
            L
Sbjct  324  L  324



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 188/240 (78%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTFRSATVAVVG GFI + IT  N AG   HQAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  277  GTTTFRSATVAVVGDGFIAQDITFRNTAGANNHQAVALRSGSDLSVFYRCSFEGYQDTLY  336

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFY++C++YGTVDFIFGNAA VFQNCN++AR P  N+ N  TAQGR DPNQNTGI
Sbjct  337  VHSDRQFYKECNIYGTVDFIFGNAAAVFQNCNIFARNP-PNKVNTITAQGRTDPNQNTGI  395

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA+DL PVQ+S K YLGRPWK+YSRTVFM ++L SLI PAGWLEW G FAL 
Sbjct  396  SIHNSRVTAASDLKPVQNSVKTYLGRPWKQYSRTVFMKTSLDSLIHPAGWLEWSGNFALS  455

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N G GS+T  RVKW GY ++   SEA++FTVGNFI G  W+P+T VPF   L
Sbjct  456  TLYYGEYMNTGLGSSTRNRVKWQGYHVITRASEASKFTVGNFIAGNSWLPSTSVPFTSTL  515



>ref|XP_010088299.1| putative pectinesterase/pectinesterase inhibitor 41 [Morus notabilis]
 gb|EXB33524.1| putative pectinesterase/pectinesterase inhibitor 41 [Morus notabilis]
Length=570

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 184/238 (77%), Gaps = 1/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTT+ SAT AVV  GF+   IT  N AG  KHQAVALR+G+DLS F++ SF AYQDT
Sbjct  327  VDGWTTYNSATFAVVAPGFVAVNITFRNTAGAIKHQAVALRNGADLSTFYSCSFEAYQDT  386

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYRDCD+YGTVDFIFGNAAVVFQNCN+Y R PM NQ N  TAQGR DPNQNT
Sbjct  387  LYTHSLRQFYRDCDIYGTVDFIFGNAAVVFQNCNMYPRLPMQNQFNAITAQGRTDPNQNT  446

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL     + K YLGRPWKEYS TV+M S + S++DPAGW EW+G+FA
Sbjct  447  GISIHNCTIKAADDLAASNGTIKTYLGRPWKEYSTTVYMQSYIDSVVDPAGWREWNGDFA  506

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPF  89
            L T YY EY N GPGS+T+ RV+WPGY ++ N+S+   FTV NF+LG  W+P TGVPF
Sbjct  507  LNTSYYAEYNNTGPGSDTTNRVRWPGYHVIGNSSDVGNFTVFNFLLGDDWLPQTGVPF  564



>ref|XP_002872845.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49104.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=453

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 193/241 (80%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DGWT F SATV V G+GFI K ++  NYAG   HQAVALRS SDLS F+  SF ++QDTL
Sbjct  213  DGWTAFHSATVGVRGSGFIAKDLSFVNYAGLASHQAVALRSSSDLSAFYRCSFESFQDTL  272

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS +QFYR+CD+YGTVDFIFG+A+VVFQNC+LYAR+P  NQK I+TAQGRE+ +Q TG
Sbjct  273  YVHSHKQFYRECDIYGTVDFIFGDASVVFQNCSLYARRPNPNQKIIYTAQGRENSSQPTG  332

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI++ K+ AA DLIPVQ++FK YLGRPW+ YSRTV M S +G L+DPAGWL+W  +FAL
Sbjct  333  ISIISSKILAAPDLIPVQANFKAYLGRPWQLYSRTVIMKSFIGDLVDPAGWLKWKDDFAL  392

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGY-RILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            +TLYYGEY N GPGSN + RV+WPG+ RI    EA QF+VG FI G +W+ +TG+PF ++
Sbjct  393  ETLYYGEYMNEGPGSNMTNRVQWPGFKRIETAEEATQFSVGPFIEGNKWLNSTGIPFTID  452

Query  79   L  77
            L
Sbjct  453  L  453



>gb|KHN16553.1| Pectinesterase 2 [Glycine soja]
Length=415

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDG TTFRSAT AV G GFI + IT EN AGP+KHQAVALRSG+D SVF+  SF  YQDT
Sbjct  175  IDGSTTFRSATFAVDGDGFIARDITFENTAGPQKHQAVALRSGADHSVFYRCSFRGYQDT  234

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYV++ RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+NQ+N  TAQGR DPN+NT
Sbjct  235  LYVYANRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSNQQNTVTAQGRTDPNENT  294

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GI I NC++ AA DL  VQ SF+ +LGRPW++YSRTV M S L  LI PAGW  W G FA
Sbjct  295  GIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTVVMKSALDGLISPAGWFPWSGNFA  354

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TLYY E+ N G G++T  RV W G+R+++++EA +FTVGNF+ G  WIP +GVPF
Sbjct  355  LSTLYYAEHANTGAGASTGGRVDWAGFRVISSTEAVKFTVGNFLAGGSWIPGSGVPF  411



>ref|XP_006396440.1| hypothetical protein EUTSA_v10028546mg [Eutrema salsugineum]
 gb|ESQ37893.1| hypothetical protein EUTSA_v10028546mg [Eutrema salsugineum]
Length=566

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/241 (63%), Positives = 183/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV    F+   IT  N AGPEKHQAVALRS +DLS+F++ SF AYQDT
Sbjct  324  VDGWTTFNSATFAVTSPNFVAVNITFRNTAGPEKHQAVALRSSADLSIFYSCSFEAYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVV QNCNLY R+P+ NQ N  TAQGR DPNQNT
Sbjct  384  LYTHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNLYPRQPLQNQFNAITAQGRTDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC +  A DL+    + K YLGRPWKEYSRTVFM S +   ++P GW EW+G+FA
Sbjct  444  GTSIHNCTIRPAGDLVSSNYTVKTYLGRPWKEYSRTVFMQSYMDGFVEPVGWREWNGDFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYYGEY N G GSNT+ RV WPGY ++N+++A+ FTV NF+ G +W+  +GVP+   
Sbjct  504  LSTLYYGEYNNTGSGSNTTNRVVWPGYHVINSTDASNFTVSNFLFGDEWMVQSGVPYLAG  563

Query  79   L  77
            L
Sbjct  564  L  564



>ref|XP_004135375.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Cucumis sativus]
 gb|KGN52152.1| hypothetical protein Csa_5G612810 [Cucumis sativus]
Length=565

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 185/238 (78%), Gaps = 1/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTT+ S+T  V G GF+   +T  N AGPEKHQAVALR+ +DLS F+  SF  YQDT
Sbjct  321  VDGWTTYNSSTFTVCGDGFVAIDVTFRNTAGPEKHQAVALRNSADLSTFYRCSFEGYQDT  380

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAA VFQ CNLYARKP+ NQKN FTAQGR DPNQNT
Sbjct  381  LYVHSLRQFYRECDIYGTVDFIFGNAAAVFQQCNLYARKPLPNQKNAFTAQGRTDPNQNT  440

Query  439  GISILNCKVAAAAD-LIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEF  263
            GISI NC + AA D ++   ++  NYLGRPWK+YSRTV+M S +G LI P GWLEW+G  
Sbjct  441  GISIHNCTIKAAPDWVMDSNTTTTNYLGRPWKQYSRTVYMQSYIGDLISPVGWLEWNGTV  500

Query  262  ALKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             L+TLYYGEY+N GPG+NTS RV WPG+ +LN ++A  FTV NF +G  W+P T +PF
Sbjct  501  GLETLYYGEYENYGPGANTSLRVNWPGFSLLNVTQAMNFTVYNFTMGDTWLPYTDIPF  558



>ref|XP_008231877.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Prunus mume]
Length=572

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 182/238 (76%), Gaps = 0/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF S+T AV    FI   IT  N AGP+KHQAVA+R+ +DLS F+  SF  YQDT
Sbjct  330  VDGWTTFNSSTFAVSAERFIAIDITFRNTAGPQKHQAVAVRNNADLSTFYRCSFEGYQDT  389

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFY++CD+YGTVDFIFG+A  VFQ+CNLYARKPMANQKN FTAQGR DPNQNT
Sbjct  390  LYVHSLRQFYKECDIYGTVDFIFGDATAVFQSCNLYARKPMANQKNAFTAQGRSDPNQNT  449

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  NYLGRPWK YSRTV M S +G LI   GWLEW+G   
Sbjct  450  GISIHNCTIEAAPDLALDLNSTLNYLGRPWKLYSRTVIMQSYIGPLISSVGWLEWNGTVG  509

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFY  86
            L TLYYGE+QN GPG+NTS RV+WPGY ++N S+A  FTV NF LG  W+P T +PFY
Sbjct  510  LDTLYYGEFQNHGPGANTSKRVQWPGYNLMNASQAVNFTVLNFTLGDTWLPDTDIPFY  567



>ref|XP_008446714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Cucumis melo]
Length=565

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 185/238 (78%), Gaps = 1/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTT+ S+T  V G GF+   +T  N AGPEKHQAVALR+ +DLS F+  SF  YQDT
Sbjct  321  VDGWTTYNSSTFTVCGDGFVAIDVTFRNTAGPEKHQAVALRNSADLSTFYRCSFEGYQDT  380

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAA VFQ CNLYARKP+ NQKN FTAQGR DPNQNT
Sbjct  381  LYVHSLRQFYRECDIYGTVDFIFGNAAAVFQQCNLYARKPLPNQKNAFTAQGRTDPNQNT  440

Query  439  GISILNCKVAAAAD-LIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEF  263
            GISI NC + AA D ++   ++  NYLGRPWK+YSRTV+M S +G LI P GWLEW+G  
Sbjct  441  GISIHNCTIKAAPDWVMDSNTTTTNYLGRPWKQYSRTVYMQSYIGDLISPVGWLEWNGTV  500

Query  262  ALKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             L+TLYYGEY+N GPG+NTS RV WPG+ ++N ++A  FTV NF +G  W+P T +PF
Sbjct  501  GLETLYYGEYENYGPGANTSLRVNWPGFSLMNLTQAMNFTVYNFTMGDTWLPYTDIPF  558



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   339 bits (869),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 187/240 (78%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G  FI +GIT  N AGP+ HQAVALRSG+DLSVFF   F  YQDTLY
Sbjct  280  GSTTFNSATVAVTGERFIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLY  339

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
             HS RQFYR+C +YGT+DFIFGNAAVV QNC +YARKPM  Q+ + TAQGR DPNQNTGI
Sbjct  340  AHSQRQFYRECYIYGTIDFIFGNAAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGI  399

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V AA DL PV  S + YLGRPWKEYSRTV++ S + SL++PAGWLEW G FAL 
Sbjct  400  SIHNSRVMAADDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALN  459

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGE++N GPGS+T+ RVKW GYR++ ++ EA +FTVGNFI G  W+P TGVPF   L
Sbjct  460  TLYYGEFKNYGPGSSTANRVKWKGYRVITSANEAAKFTVGNFIAGNSWLPGTGVPFTAGL  519



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   338 bits (868),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 188/240 (78%), Gaps = 4/240 (2%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT EN AGP   QAVALRSGSDLSVF+  SF   QDTLY
Sbjct  274  GTTTFNSATVAVVGDGFIAQGITFENTAGPTSGQAVALRSGSDLSVFYKCSFEGNQDTLY  333

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAAVV QN N+Y      ++ N  TAQGR DPNQNTGI
Sbjct  334  VHSERQFYRECDIYGTVDFIFGNAAVVIQNSNIYVHN---HKTNTITAQGRTDPNQNTGI  390

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI NCKV AA+DL PVQSS K YLGRPWK+YSRTVFM + L SLI+PAGW+EW G+FALK
Sbjct  391  SIHNCKVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALK  450

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGEY N GPG++T  RV W GY ++ + SEA++F+VGNFI G  W+PAT VPF   L
Sbjct  451  TLYYGEYMNTGPGASTKNRVSWAGYHVITSASEASKFSVGNFIAGGSWLPATNVPFTSGL  510



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   339 bits (869),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 187/240 (78%), Gaps = 1/240 (0%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAV G  FI +GIT  N AGP+ HQAVALRSG+DLSVFF   F  YQDTLY
Sbjct  281  GSTTFNSATVAVTGERFIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLY  340

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+C +YGTVDFIFGN+AVV QNC +YARKPM  Q+ + TAQGR DPNQNTGI
Sbjct  341  VHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGI  400

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
            SI N +V A  DL PV  S + YLGRPWKEYSRTV++ S + SL++PAGWLEW G FAL 
Sbjct  401  SIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALN  460

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TLYYGE++N GPGS+T+ RVKW GYR++ + SEA +FTVG+FI G  W+P TGVPF   L
Sbjct  461  TLYYGEFKNSGPGSSTANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLPGTGVPFTAGL  520



>ref|XP_010273807.1| PREDICTED: pectinesterase-like isoform X3 [Nelumbo nucifera]
Length=581

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SATVAV G  F+   ++  N AGPEKHQAVA+R+ +D+S F+  SF  YQDT
Sbjct  340  VDGWTTFNSATVAVSGERFVAVDMSFRNTAGPEKHQAVAVRNNADVSTFYRCSFEGYQDT  399

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CDVYGTVDFIFGNAA V QNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  400  LYAHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYARKPMPNQKNAFTAQGRTDPNQNT  459

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  N+LGRPWKEYSRTV+M S + SLIDP GWLEW+G   
Sbjct  460  GISIHNCTIGAAPDLAEDLNSTSNFLGRPWKEYSRTVYMQSYIDSLIDPVGWLEWNGTVG  519

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TL+YGE++N GPG+ TS RV+WPGY ++N S+A  FTV NF +G  W+P T +PF
Sbjct  520  LSTLFYGEFENYGPGAITSMRVQWPGYSLMNASQAWNFTVYNFTMGDTWLPYTDIPF  576



>ref|XP_010422609.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Camelina sativa]
Length=580

 Score =   340 bits (873),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 183/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV    F+   +T  N AGPEKHQAVA+RS +DLS+F++ SF AYQDT
Sbjct  338  VDGWTTFNSATFAVTSPNFVAVNMTFRNTAGPEKHQAVAMRSSADLSIFYSCSFEAYQDT  397

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R+PM NQ N  TAQGR DPNQNT
Sbjct  398  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRQPMQNQFNAITAQGRTDPNQNT  457

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC +  A DL     + K YLGRPWKEYSRTV M S +  +++P GW EW+G+FA
Sbjct  458  GISIHNCTIKPADDLASSNYTVKTYLGRPWKEYSRTVVMQSYIDEVVEPVGWREWNGDFA  517

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N G GSNT+ RV WPGY ++N+++AN FTV NF+LG  W+  +GVP+   
Sbjct  518  LSTLYYAEYNNTGSGSNTTDRVVWPGYHVINSTDANNFTVSNFLLGDGWMVQSGVPYLSG  577

Query  79   L  77
            L
Sbjct  578  L  578



>ref|XP_006828613.1| hypothetical protein AMTR_s00129p00074780 [Amborella trichopoda]
 gb|ERM96029.1| hypothetical protein AMTR_s00129p00074780 [Amborella trichopoda]
Length=671

 Score =   343 bits (880),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 186/243 (77%), Gaps = 1/243 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DGWTTF+SAT A  G GF+ + IT EN AGP KHQ VALR GSD SV +  S V YQDTL
Sbjct  429  DGWTTFQSATFAATGPGFMARDITFENTAGPAKHQGVALRLGSDRSVIYRCSIVGYQDTL  488

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y HS RQFYR+ D+YGTVDFIFGNAA VFQ+CNLYARKPM++Q+  +TAQGR+DPNQNTG
Sbjct  489  YAHSNRQFYRETDIYGTVDFIFGNAAAVFQSCNLYARKPMSDQRITYTAQGRKDPNQNTG  548

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
             SI NCK+ AA+DL+PV+SS   YLGRPW+E+SRTV M S L  LI PAGWLEW G FAL
Sbjct  549  FSIHNCKITAASDLVPVKSSIPTYLGRPWQEFSRTVIMQSFLDDLIRPAGWLEWSGNFAL  608

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYR-ILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            K+LYYGEY N+GPG+  S RV+WPGY+  L   +A +FTV  FI G  W+PATGV F   
Sbjct  609  KSLYYGEYMNKGPGAGLSDRVRWPGYKGELTVDDATKFTVAQFISGNSWLPATGVSFDSG  668

Query  79   LTA  71
            L A
Sbjct  669  LIA  671



>ref|XP_010273806.1| PREDICTED: pectinesterase-like isoform X2 [Nelumbo nucifera]
Length=586

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SATVAV G  F+   ++  N AGPEKHQAVA+R+ +D+S F+  SF  YQDT
Sbjct  345  VDGWTTFNSATVAVSGERFVAVDMSFRNTAGPEKHQAVAVRNNADVSTFYRCSFEGYQDT  404

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CDVYGTVDFIFGNAA V QNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  405  LYAHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYARKPMPNQKNAFTAQGRTDPNQNT  464

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  N+LGRPWKEYSRTV+M S + SLIDP GWLEW+G   
Sbjct  465  GISIHNCTIGAAPDLAEDLNSTSNFLGRPWKEYSRTVYMQSYIDSLIDPVGWLEWNGTVG  524

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TL+YGE++N GPG+ TS RV+WPGY ++N S+A  FTV NF +G  W+P T +PF
Sbjct  525  LSTLFYGEFENYGPGAITSMRVQWPGYSLMNASQAWNFTVYNFTMGDTWLPYTDIPF  581



>ref|XP_003541559.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Glycine max]
Length=565

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 185/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF S+T AV G  F+   +T  N AGP+KHQAVALR+ +DLS F+  SF  YQDT
Sbjct  325  VDGWTTFNSSTFAVSGERFVAVDVTFRNTAGPQKHQAVALRNNADLSTFYRCSFEGYQDT  384

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFYR+CD+YGTVDFIFGNAAVVFQ+CN+YARKPM NQKN  TAQGR DPNQNT
Sbjct  385  LYVHSLRQFYRECDIYGTVDFIFGNAAVVFQSCNIYARKPMPNQKNAVTAQGRTDPNQNT  444

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NCK+ AA DL    +S +NYLGRPWK YSRTVFM S +G LI  AGWLEW+G   
Sbjct  445  GISIQNCKIDAAPDLAADLNSTENYLGRPWKVYSRTVFMQSYIGELIQSAGWLEWNGTDG  504

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TL+YGE+QN GPGS+TS RV+W GY +L+ ++A  FTV NF LG  W+P T +P+
Sbjct  505  LSTLFYGEFQNFGPGSDTSKRVQWSGYNLLSATQARNFTVHNFTLGYTWLPDTDIPY  561



>ref|NP_567227.1| Probable pectinesterase/pectinesterase inhibitor 41 [Arabidopsis 
thaliana]
 sp|Q8RXK7.2|PME41_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
41; Includes: RecName: Full=Pectinesterase inhibitor 41; AltName: 
Full=Pectin methylesterase inhibitor 41; Includes: RecName: 
Full=Pectinesterase 41; Short=PE 41; AltName: Full=AtPMEpcrB; 
AltName: Full=Pectin methylesterase 41; Short=AtPME41; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC19280.1| T14P8.14 [Arabidopsis thaliana]
 emb|CAB80726.1| AT4g02330 [Arabidopsis thaliana]
 gb|AAN12975.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82156.1| Probable pectinesterase/pectinesterase inhibitor 41 [Arabidopsis 
thaliana]
Length=573

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/241 (63%), Positives = 185/241 (77%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AV    F+   +T  N AGPEKHQAVA+RS +DLS+F++ SF AYQDT
Sbjct  331  VDGWTTFNSATFAVTSPNFVAVNMTFRNTAGPEKHQAVAMRSSADLSIFYSCSFEAYQDT  390

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQ+CNLY R+PM NQ N  TAQGR DPNQNT
Sbjct  391  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQDCNLYPRQPMQNQFNAITAQGRTDPNQNT  450

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC +  A DL+    + K YLGRPWKEYSRTVFM S +  +++P GW EW+G+FA
Sbjct  451  GISIHNCTIKPADDLVSSNYTVKTYLGRPWKEYSRTVFMQSYIDEVVEPVGWREWNGDFA  510

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N G GS+T+ RV WPGY ++N+++AN FTV NF+LG  W+  +GVP+   
Sbjct  511  LSTLYYAEYNNTGSGSSTTDRVVWPGYHVINSTDANNFTVENFLLGDGWMVQSGVPYISG  570

Query  79   L  77
            L
Sbjct  571  L  571



>emb|CDY18942.1| BnaC04g04080D [Brassica napus]
Length=258

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/240 (67%), Positives = 188/240 (78%), Gaps = 3/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVA VG GF+ +GIT  N AG    QAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  21   GSTTFNSATVAAVGDGFMARGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLY  80

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYRDCDVYGTVDFIFGNAA V QNCN++AR+P + + N  TAQGR D NQNTGI
Sbjct  81   VHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRS-KTNTITAQGRSDRNQNTGI  139

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V AA+DL P+  S K YLGRPW++YSRTVFM ++L SLIDP GWLEW+G FAL 
Sbjct  140  IIHNSRVTAASDLRPILGSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALS  199

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+Y E+QN GPG++TS RVKWPG+R+L + SEA++FTVG+FI G  WIP++ VPF   L
Sbjct  200  TLFYAEFQNTGPGASTSGRVKWPGFRVLRSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  258



>ref|XP_004299720.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Fragaria vesca subsp. vesca]
Length=565

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 179/236 (76%), Gaps = 0/236 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DGWTTF S T AV   GF+   IT +N AGP K QAVA+R+  DLSVF++ SF AYQDTL
Sbjct  325  DGWTTFNSPTFAVAAQGFVAVNITFQNKAGPSKGQAVAVRNDGDLSVFYSCSFEAYQDTL  384

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y HS+RQFYR+CD+YGTVDFIFGNAAV FQNCN+Y R+P+  Q N  TAQGR D NQNTG
Sbjct  385  YTHSMRQFYRECDIYGTVDFIFGNAAVAFQNCNIYPRRPLQGQSNTITAQGRTDVNQNTG  444

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI NC V AAADL     + KNYLGRPWKEYSRT+FM   + S IDPAGWL W+G+FAL
Sbjct  445  ISIQNCTVTAAADLASSTFTVKNYLGRPWKEYSRTIFMQGFIDSFIDPAGWLAWNGDFAL  504

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             TLYY EY N GPGSNT+ RV WPGY ++  +EA  FTV NFILG  W+P TGVP+
Sbjct  505  STLYYAEYNNSGPGSNTNNRVTWPGYHVIGATEAANFTVSNFILGDNWLPQTGVPY  560



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = -2

Query  793  GWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTLY  614
            G TTF SATVAVVG GFI +GIT  N AGP   QAVALRSGSDLSVF+  SF  YQDTLY
Sbjct  275  GATTFNSATVAVVGDGFIARGITFRNTAGPSNGQAVALRSGSDLSVFYQCSFEGYQDTLY  334

Query  613  VHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTGI  434
            VHS RQFYR+CD+YGTVDFIFGNAA VFQNCN++AR+P  N+ N  TAQGR DPNQNTGI
Sbjct  335  VHSNRQFYRECDIYGTVDFIFGNAAAVFQNCNIFARRPR-NKTNTVTAQGRSDPNQNTGI  393

Query  433  SILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALK  254
             I N +V A +DL PV  S K YLGRPW++YSRTVFM + L  LIDP GWLEW+G FAL 
Sbjct  394  VIHNSRVTAGSDLQPVLGSVKTYLGRPWRQYSRTVFMKTFLDGLIDPRGWLEWNGNFALS  453

Query  253  TLYYGEYQNRGPGSNTSARVKWPGYRILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  77
            TL+Y EYQN GPGS+TS RV WPG+R+L   S+A++FTVG+FI G  WIPAT VPF   L
Sbjct  454  TLFYAEYQNTGPGSSTSGRVTWPGFRVLTAASDASRFTVGSFIAGNSWIPATNVPFTSGL  513



>ref|XP_010273805.1| PREDICTED: pectinesterase-like isoform X1 [Nelumbo nucifera]
Length=591

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 184/237 (78%), Gaps = 0/237 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SATVAV G  F+   ++  N AGPEKHQAVA+R+ +D+S F+  SF  YQDT
Sbjct  350  VDGWTTFNSATVAVSGERFVAVDMSFRNTAGPEKHQAVAVRNNADVSTFYRCSFEGYQDT  409

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CDVYGTVDFIFGNAA V QNCNLYARKPM NQKN FTAQGR DPNQNT
Sbjct  410  LYAHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYARKPMPNQKNAFTAQGRTDPNQNT  469

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL    +S  N+LGRPWKEYSRTV+M S + SLIDP GWLEW+G   
Sbjct  470  GISIHNCTIGAAPDLAEDLNSTSNFLGRPWKEYSRTVYMQSYIDSLIDPVGWLEWNGTVG  529

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
            L TL+YGE++N GPG+ TS RV+WPGY ++N S+A  FTV NF +G  W+P T +PF
Sbjct  530  LSTLFYGEFENYGPGAITSMRVQWPGYSLMNASQAWNFTVYNFTMGDTWLPYTDIPF  586



>ref|XP_010556727.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Tarenaya hassleriana]
Length=566

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 184/238 (77%), Gaps = 0/238 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SA+ AVV   F+   IT  N AGPEKHQAVA+RSG+DLS+F+  SF AYQDT
Sbjct  324  VDGWTTFNSASFAVVAPNFVAVNITFRNTAGPEKHQAVAVRSGADLSIFYGCSFEAYQDT  383

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCN+Y R+P+ NQ N  TAQGR DPNQNT
Sbjct  384  LYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRQPLQNQFNAITAQGRTDPNQNT  443

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC +  A DL+    + K YLGRPWKEYSRTV+M S +   ++P GW EW+G+FA
Sbjct  444  GTSIHNCTIKPADDLVASNFTVKTYLGRPWKEYSRTVYMQSYIDGFVEPVGWREWNGDFA  503

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFY  86
            L TLYY EY N GPGSNT+ RV WPGY ++N+++A  FTV +F+LG  WI  +GVP++
Sbjct  504  LSTLYYAEYNNTGPGSNTTNRVNWPGYHVINSTDAANFTVSSFLLGDDWILQSGVPYF  561



>gb|KHN44643.1| Putative pectinesterase/pectinesterase inhibitor 61 [Glycine 
soja]
Length=610

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 188/243 (77%), Gaps = 1/243 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            IDG TTF SA+ A  G GFI + IT ENYAGP KHQAVALR G+D +V +  + V YQD+
Sbjct  367  IDGMTTFHSASFAASGAGFIARDITFENYAGPAKHQAVALRVGADHAVVYRCNIVGYQDS  426

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
             YVHS RQF+R+C++YGTVDFIFGNAAVVFQ CN+YARKPMA QKN  TAQ R+DPNQNT
Sbjct  427  CYVHSNRQFFRECNIYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNT  486

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GIS+ NC++  A DL PV+ SF  YLGRPWK+YSRTV+++S +G  I P GWLEW+G+FA
Sbjct  487  GISLHNCRILPAPDLAPVKGSFPTYLGRPWKQYSRTVYLVSYMGDHIHPRGWLEWNGDFA  546

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRIL-NTSEANQFTVGNFILGQQWIPATGVPFYV  83
            L TLYYGEY N GPG+    RV+WPGYR++ +T EAN+FTV  FI G  W+P+TGV F  
Sbjct  547  LNTLYYGEYMNYGPGAAVGQRVQWPGYRVIKSTMEANRFTVAQFISGSAWLPSTGVAFAA  606

Query  82   NLT  74
             L+
Sbjct  607  GLS  609



>ref|XP_011079963.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Sesamum indicum]
Length=571

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 184/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF S++ AVVGTGF+   IT  N AG  KHQAVA+R+G+DLS F++ SF AYQDT
Sbjct  330  VDGWTTFNSSSFAVVGTGFVAVNITFRNTAGAIKHQAVAVRNGADLSTFYSCSFEAYQDT  389

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LYVHSLRQFY +CD+YGTVDFIFGNAAVVFQNCNLY R PM+NQ N  TAQGR DPNQNT
Sbjct  390  LYVHSLRQFYVECDIYGTVDFIFGNAAVVFQNCNLYPRLPMSNQFNAITAQGRTDPNQNT  449

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            GISI NC + AA DL     + + YLGRPWKEYSRTV+M S + SLI+PAGW  W G+FA
Sbjct  450  GISIQNCTIRAADDLANSNITIRTYLGRPWKEYSRTVYMQSFMDSLINPAGWTIWSGDFA  509

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L T YY E+ N GPGSNTS RV WPG+ I+N ++A  FTV  F+LG  WIP TG P+   
Sbjct  510  LNTSYYAEFNNSGPGSNTSQRVTWPGFHIINETDAANFTVSAFLLGDDWIPQTGAPYTAG  569

Query  79   L  77
            L
Sbjct  570  L  570



>ref|XP_010069897.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Eucalyptus grandis]
Length=567

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 184/241 (76%), Gaps = 0/241 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV   F+   +T  N AGP KHQAVA+RSG+DLSVF++ SF AYQDT
Sbjct  326  VDGWTTFNSATFAVVAPNFVAVNMTFRNTAGPAKHQAVAVRSGADLSVFYSCSFEAYQDT  385

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR CD+YGTVDFIFGNAAVVFQNCNLY R PM+ Q N+ TAQGR D NQNT
Sbjct  386  LYTHSLRQFYRGCDIYGTVDFIFGNAAVVFQNCNLYPRLPMSGQSNMITAQGRTDVNQNT  445

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFA  260
            G SI NC + AA DL    +S + YLGRPWK YSRTV+M S +GSLI+PAGW  WDG+FA
Sbjct  446  GTSIQNCTIRAADDLASSNTSVQTYLGRPWKLYSRTVYMQSFMGSLINPAGWQIWDGDFA  505

Query  259  LKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVN  80
            L TLYY EY N GPGSNT+ RV WPGY ++N ++A  FTV +F++G  W+P TGV +   
Sbjct  506  LSTLYYAEYDNTGPGSNTTNRVTWPGYHVINATDAANFTVSSFLVGDDWLPQTGVSYTSG  565

Query  79   L  77
            L
Sbjct  566  L  566



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 185/240 (77%), Gaps = 0/240 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTFRSAT AV G  FI + IT EN AGP+KHQAVALRSG+D SVF+  SF  YQDTL
Sbjct  278  DGSTTFRSATFAVSGDNFIARDITFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTL  337

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YV++ RQFYRDCD+YGTVDFIFG+A  V QNCN+Y RKPM+NQ+N  TAQGR DPN+NTG
Sbjct  338  YVYANRQFYRDCDIYGTVDFIFGDAVSVLQNCNIYVRKPMSNQQNSVTAQGRTDPNENTG  397

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            I I NC + AA DL  VQ SF+ YLGRPW++YSRTV M S L  LI+PAGW EW G FAL
Sbjct  398  IIIHNCVITAAGDLKAVQGSFRTYLGRPWQKYSRTVVMKSALDGLINPAGWSEWSGNFAL  457

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  77
             TLYYGEY N G G++T  RVKW G+R++++S+A +FTVG F+ G  WIP +GVPF   L
Sbjct  458  STLYYGEYANTGAGASTGGRVKWGGFRVMSSSDAVKFTVGEFLAGGSWIPGSGVPFDAGL  517



>ref|XP_009111300.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
isoform X2 [Brassica rapa]
Length=525

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 190/241 (79%), Gaps = 1/241 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DGWT F SATV V G+GFI K I+  N AGP KHQAVALRSGSDLS F+  SF +YQDT+
Sbjct  285  DGWTAFNSATVGVRGSGFIAKDISFVNDAGPTKHQAVALRSGSDLSAFYRCSFESYQDTI  344

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            YVHS +QFYR+C++YGTVDFIFG    +FQNC+LYAR+P  NQ+  +TAQGREDP Q TG
Sbjct  345  YVHSHKQFYRECNIYGTVDFIFGQTLTMFQNCSLYARRPNPNQRITYTAQGREDPRQPTG  404

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
            ISI+NCK+ AA DL+PV++ FK YLGRPW+ YSRTV + S +  L+DPAGWL+W  +FAL
Sbjct  405  ISIINCKILAAPDLVPVKTDFKAYLGRPWQLYSRTVIIKSFIDDLVDPAGWLQWKDDFAL  464

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTS-EANQFTVGNFILGQQWIPATGVPFYVN  80
             TLYYGEY N GPGSN + RVKWPG++ + T+ EA QFTVG FI G +W+ +TG+PF ++
Sbjct  465  DTLYYGEYMNEGPGSNMTNRVKWPGFKRIETAVEATQFTVGPFIDGNKWLNSTGIPFTLD  524

Query  79   L  77
            L
Sbjct  525  L  525



>gb|KHN43319.1| Putative pectinesterase/pectinesterase inhibitor 7 [Glycine soja]
Length=346

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 183/242 (76%), Gaps = 1/242 (0%)
 Frame = -2

Query  799  IDGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDT  620
            +DGWTTF SAT AVV  GF+   IT  N AG  KHQAVALRSG+DLS F+N SF  YQDT
Sbjct  103  VDGWTTFNSATFAVVAQGFVAINITFRNTAGAIKHQAVALRSGADLSAFYNCSFEGYQDT  162

Query  619  LYVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNT  440
            LY HSLRQFYR+CD+YGTVDFIFGNAAVV Q+CN+Y R P+ NQ N  TAQGR D NQNT
Sbjct  163  LYTHSLRQFYRNCDIYGTVDFIFGNAAVVLQDCNIYPRLPLQNQFNAITAQGRTDINQNT  222

Query  439  GISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGS-LIDPAGWLEWDGEF  263
            G SI NC + AA+DL     + K YLGRPWK+YSRT++M S +   L+DP GW  W G+F
Sbjct  223  GTSIHNCSITAASDLATSNGTTKTYLGRPWKQYSRTLYMQSFMDDGLVDPEGWKAWSGDF  282

Query  262  ALKTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPFYV  83
            AL TLYY E+ N+GPGSNTS RV WPGY ++N ++A  FTV NFI+G  W+PATGVP+Y 
Sbjct  283  ALDTLYYAEFDNQGPGSNTSNRVTWPGYHVINATDAVNFTVANFIIGDAWLPATGVPYYA  342

Query  82   NL  77
            +L
Sbjct  343  DL  344



>ref|XP_007222884.1| hypothetical protein PRUPE_ppa003581mg [Prunus persica]
 gb|EMJ24083.1| hypothetical protein PRUPE_ppa003581mg [Prunus persica]
Length=564

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 180/236 (76%), Gaps = 0/236 (0%)
 Frame = -2

Query  796  DGWTTFRSATVAVVGTGFILKGITIENYAGPEKHQAVALRSGSDLSVFFNSSFVAYQDTL  617
            DG TTF SAT+AV G GF+   IT+ N AGP K QAVALRSG+DLSVF++ SF  YQDTL
Sbjct  324  DGSTTFNSATLAVTGLGFVAVNITVRNTAGPSKGQAVALRSGADLSVFYSCSFEGYQDTL  383

Query  616  YVHSLRQFYRDCDVYGTVDFIFGNAAVVFQNCNLYARKPMANQKNIFTAQGREDPNQNTG  437
            Y HSLRQFYR+CD+YGTVDFIFGNAAVVFQNCNLY R+P   Q N  TAQGR DPNQNTG
Sbjct  384  YTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRQPNKGQSNAITAQGRTDPNQNTG  443

Query  436  ISILNCKVAAAADLIPVQSSFKNYLGRPWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFAL  257
             SI NC +    DL     + K YLGRPWKEYSRTV+M + + SLIDPAGWL W G+FAL
Sbjct  444  TSIHNCTIKPTPDLASSNFTVKTYLGRPWKEYSRTVYMQTFMASLIDPAGWLAWSGDFAL  503

Query  256  KTLYYGEYQNRGPGSNTSARVKWPGYRILNTSEANQFTVGNFILGQQWIPATGVPF  89
             TLYY EY N GPGSNT+ RV WPGY ++N++ A  FTV NF++G  W+ ATGVP+
Sbjct  504  STLYYAEYNNTGPGSNTTNRVTWPGYHVINSTVAANFTVTNFLMGDNWLAATGVPY  559



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195