BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034D12

Length=752
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57286.1|  V-type proton ATPase subunit                           304   3e-98   Ipomoea nil [qian niu]
ref|XP_009786911.1|  PREDICTED: V-type proton ATPase subunit C          278   2e-88   Nicotiana sylvestris
ref|XP_009618992.1|  PREDICTED: V-type proton ATPase subunit C          277   1e-87   Nicotiana tomentosiformis
ref|XP_006363973.1|  PREDICTED: V-type proton ATPase subunit C-like     275   6e-87   Solanum tuberosum [potatoes]
ref|XP_004235295.1|  PREDICTED: V-type proton ATPase subunit C          273   3e-86   Solanum lycopersicum
emb|CDP15722.1|  unnamed protein product                                269   1e-84   Coffea canephora [robusta coffee]
ref|XP_011073132.1|  PREDICTED: V-type proton ATPase subunit C-like     268   3e-84   Sesamum indicum [beniseed]
ref|XP_011083360.1|  PREDICTED: V-type proton ATPase subunit C-like     264   9e-83   Sesamum indicum [beniseed]
gb|EYU24479.1|  hypothetical protein MIMGU_mgv1a006812mg                262   3e-81   Erythranthe guttata [common monkey flower]
gb|KJB40644.1|  hypothetical protein B456_007G072500                    254   1e-80   Gossypium raimondii
ref|XP_007031994.1|  Vacuolar ATP synthase subunit C (VATC) / V-A...    255   2e-79   Theobroma cacao [chocolate]
gb|KJB40648.1|  hypothetical protein B456_007G072500                    254   4e-79   Gossypium raimondii
gb|KJB76316.1|  hypothetical protein B456_012G082900                    253   1e-78   Gossypium raimondii
gb|KJB76315.1|  hypothetical protein B456_012G082900                    253   2e-78   Gossypium raimondii
ref|XP_002284444.1|  PREDICTED: V-type proton ATPase subunit C is...    253   3e-78   Vitis vinifera
ref|XP_007151733.1|  hypothetical protein PHAVU_004G070900g             252   5e-78   Phaseolus vulgaris [French bean]
ref|XP_010249179.1|  PREDICTED: V-type proton ATPase subunit C-like     251   7e-78   Nelumbo nucifera [Indian lotus]
ref|XP_008231040.1|  PREDICTED: V-type proton ATPase subunit C          250   3e-77   Prunus mume [ume]
ref|XP_006599411.1|  PREDICTED: V-type proton ATPase subunit C-like     249   4e-77   Glycine max [soybeans]
gb|KDP41839.1|  hypothetical protein JCGZ_26857                         249   5e-77   Jatropha curcas
ref|XP_002275510.1|  PREDICTED: V-type proton ATPase subunit C          248   2e-76   Vitis vinifera
gb|KHM99227.1|  V-type proton ATPase subunit C                          247   3e-76   Glycine soja [wild soybean]
ref|XP_003548919.2|  PREDICTED: V-type proton ATPase subunit C-like     247   4e-76   Glycine max [soybeans]
ref|XP_007215551.1|  hypothetical protein PRUPE_ppa007256mg             246   6e-76   Prunus persica
ref|XP_008362171.1|  PREDICTED: V-type proton ATPase subunit C-like     243   7e-76   
gb|AIY85415.1|  V-ATPase subunit C1                                     246   1e-75   Eriobotrya japonica [loquat]
ref|XP_003553974.1|  PREDICTED: V-type proton ATPase subunit C-like     245   2e-75   Glycine max [soybeans]
dbj|BAE98945.1|  vacuolar ATP sythase subunit C                         241   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|ABH07428.1|  vacuolar H+-ATPase subunit C                            245   2e-75   Gossypium hirsutum [American cotton]
ref|XP_011045799.1|  PREDICTED: V-type proton ATPase subunit C-li...    244   3e-75   Populus euphratica
ref|XP_009378027.1|  PREDICTED: V-type proton ATPase subunit C          244   7e-75   Pyrus x bretschneideri [bai li]
ref|XP_010925033.1|  PREDICTED: V-type proton ATPase subunit C-like     243   9e-75   Elaeis guineensis
ref|XP_003624472.1|  V-type proton ATPase subunit C                     243   1e-74   Medicago truncatula
ref|XP_006446960.1|  hypothetical protein CICLE_v10015638mg             243   1e-74   Citrus clementina [clementine]
ref|XP_011468207.1|  PREDICTED: V-type proton ATPase subunit C          243   2e-74   Fragaria vesca subsp. vesca
emb|CDY19421.1|  BnaC05g09300D                                          242   3e-74   Brassica napus [oilseed rape]
ref|NP_001141160.1|  hypothetical protein                               236   4e-74   
ref|XP_004977299.1|  PREDICTED: V-type proton ATPase subunit C-like     242   5e-74   Setaria italica
gb|AFW81322.1|  hypothetical protein ZEAMMB73_736936                    238   5e-74   
ref|XP_006417188.1|  hypothetical protein EUTSA_v10007948mg             241   5e-74   Eutrema salsugineum [saltwater cress]
ref|XP_008379060.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    241   5e-74   
ref|XP_009148561.1|  PREDICTED: V-type proton ATPase subunit C          241   7e-74   Brassica rapa
ref|XP_010066422.1|  PREDICTED: V-type proton ATPase subunit C          241   7e-74   Eucalyptus grandis [rose gum]
ref|NP_563916.1|  V-type proton ATPase subunit C                        241   9e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693540.1|  PREDICTED: V-type proton ATPase subunit C          240   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010939209.1|  PREDICTED: V-type proton ATPase subunit C-li...    240   2e-73   Elaeis guineensis
ref|XP_009386009.1|  PREDICTED: V-type proton ATPase subunit C-like     239   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518129.1|  PREDICTED: V-type proton ATPase subunit C-like     239   4e-73   Glycine max [soybeans]
emb|CDY16036.1|  BnaC08g40870D                                          242   4e-73   Brassica napus [oilseed rape]
ref|XP_010476263.1|  PREDICTED: V-type proton ATPase subunit C-like     239   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010494723.1|  PREDICTED: V-type proton ATPase subunit C          239   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002441755.1|  hypothetical protein SORBIDRAFT_08g001880          238   1e-72   Sorghum bicolor [broomcorn]
ref|XP_009395792.1|  PREDICTED: V-type proton ATPase subunit C-like     238   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493016.1|  PREDICTED: V-type proton ATPase subunit C-like     238   2e-72   Cicer arietinum [garbanzo]
ref|XP_008808181.1|  PREDICTED: V-type proton ATPase subunit C-like     238   2e-72   Phoenix dactylifera
ref|XP_010458722.1|  PREDICTED: V-type proton ATPase subunit C-like     238   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008654564.1|  PREDICTED: hypothetical protein isoform X1         238   2e-72   
ref|XP_008775427.1|  PREDICTED: V-type proton ATPase subunit C-li...    236   4e-72   Phoenix dactylifera
gb|KHN28568.1|  V-type proton ATPase subunit C                          236   5e-72   Glycine soja [wild soybean]
ref|XP_002441624.1|  hypothetical protein SORBIDRAFT_09g030620          236   5e-72   Sorghum bicolor [broomcorn]
gb|KEH23490.1|  vacuolar H+-ATPase subunit C                            236   6e-72   Medicago truncatula
ref|XP_006305100.1|  hypothetical protein CARUB_v10009467mg             236   7e-72   
gb|ABD32569.1|  V-ATPase subunit C                                      235   1e-71   Medicago truncatula
gb|KGN50885.1|  hypothetical protein Csa_5G312840                       235   2e-71   
ref|XP_007161646.1|  hypothetical protein PHAVU_001G086700g             235   2e-71   Phaseolus vulgaris [French bean]
ref|XP_010250562.1|  PREDICTED: V-type proton ATPase subunit C          235   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_004150739.1|  PREDICTED: V-type proton ATPase subunit C-like     235   2e-71   Cucumis sativus [cucumbers]
gb|EMT31457.1|  V-type proton ATPase subunit C                          231   3e-71   
ref|XP_011045798.1|  PREDICTED: V-type proton ATPase subunit C-li...    235   3e-71   Populus euphratica
ref|XP_006655657.1|  PREDICTED: V-type proton ATPase subunit C-like     234   3e-71   Oryza brachyantha
ref|XP_003567787.1|  PREDICTED: V-type proton ATPase subunit C          234   3e-71   Brachypodium distachyon [annual false brome]
ref|XP_008463120.1|  PREDICTED: V-type proton ATPase subunit C          234   5e-71   Cucumis melo [Oriental melon]
ref|XP_010096044.1|  V-type proton ATPase subunit C                     234   5e-71   
gb|KHG11234.1|  V-type proton ATPase subunit C -like protein            232   5e-71   Gossypium arboreum [tree cotton]
ref|XP_006844509.1|  hypothetical protein AMTR_s00016p00139220          233   6e-71   Amborella trichopoda
ref|XP_002512862.1|  vacuolar ATP synthase subunit C, putative          233   8e-71   Ricinus communis
gb|ABG23314.1|  vacuolar proton-ATPase C subunit                        233   1e-70   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001056500.1|  Os05g0593100                                       233   1e-70   
ref|NP_001142247.1|  uncharacterized protein LOC100274416               232   3e-70   Zea mays [maize]
ref|XP_010556324.1|  PREDICTED: V-type proton ATPase subunit C          231   4e-70   Tarenaya hassleriana [spider flower]
gb|EMS67397.1|  V-type proton ATPase subunit C                          231   5e-70   Triticum urartu
gb|ACT34062.1|  vacuolar ATP synthetase subunit C                       231   6e-70   Aegilops tauschii
ref|XP_006369829.1|  Vacuolar ATP synthase subunit C family protein     230   2e-69   
emb|CDX71966.1|  BnaC08g29080D                                          229   4e-69   
ref|XP_009118052.1|  PREDICTED: V-type proton ATPase subunit C-like     229   4e-69   Brassica rapa
gb|KFK43549.1|  hypothetical protein AALP_AA1G141200                    228   6e-69   Arabis alpina [alpine rockcress]
emb|CDY21070.1|  BnaA08g24550D                                          228   7e-69   Brassica napus [oilseed rape]
ref|XP_011001967.1|  PREDICTED: V-type proton ATPase subunit C          228   7e-69   Populus euphratica
ref|XP_009110617.1|  PREDICTED: V-type proton ATPase subunit C-like     228   9e-69   Brassica rapa
ref|NP_001147632.1|  LOC100281241                                       228   9e-69   Zea mays [maize]
ref|XP_010528136.1|  PREDICTED: V-type proton ATPase subunit C-like     228   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_002889973.1|  de-etiolated 3                                     228   1e-68   
ref|XP_010554131.1|  PREDICTED: V-type proton ATPase subunit C-li...    227   2e-68   Tarenaya hassleriana [spider flower]
emb|CDY66539.1|  BnaCnng51300D                                          227   2e-68   Brassica napus [oilseed rape]
ref|XP_006373110.1|  hypothetical protein POPTR_0017s08810g             227   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010554130.1|  PREDICTED: V-type proton ATPase subunit C-li...    227   8e-68   Tarenaya hassleriana [spider flower]
emb|CDY26596.1|  BnaA09g46810D                                          227   5e-66   Brassica napus [oilseed rape]
gb|ADE77882.1|  unknown                                                 213   4e-63   Picea sitchensis
gb|KJB76319.1|  hypothetical protein B456_012G082900                    205   3e-60   Gossypium raimondii
gb|KJB76320.1|  hypothetical protein B456_012G082900                    204   6e-60   Gossypium raimondii
ref|XP_006373109.1|  hypothetical protein POPTR_0017s08810g             202   6e-59   
gb|AGJ98217.1|  DET3                                                    197   3e-58   Petunia x hybrida [garden petunia]
gb|AAO72561.1|  putative vacuolar ATP synthase subunit C                201   4e-58   
gb|KJB40646.1|  hypothetical protein B456_007G072500                    197   1e-57   Gossypium raimondii
gb|KCW64312.1|  hypothetical protein EUGRSUZ_G019431                    198   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010939292.1|  PREDICTED: V-type proton ATPase subunit C-li...    193   1e-55   Elaeis guineensis
ref|XP_001773067.1|  predicted protein                                  192   4e-55   
ref|XP_008775428.1|  PREDICTED: V-type proton ATPase subunit C-li...    182   2e-51   
gb|AFA36545.1|  vacuolar ATP synthetase subunit C                       177   2e-51   Lolium perenne [perennial ryegrass]
ref|XP_010528980.1|  PREDICTED: V-type proton ATPase subunit C-like     174   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_002980160.1|  hypothetical protein SELMODRAFT_111716             177   3e-49   Selaginella moellendorffii
gb|EMT09400.1|  V-type proton ATPase subunit C                          175   2e-48   
ref|XP_010068642.1|  PREDICTED: V-type proton ATPase subunit C-like     142   2e-36   
ref|XP_005651974.1|  vacuolar H+ ATPase V1 sector, subunit C            141   7e-36   Coccomyxa subellipsoidea C-169
gb|KJB40647.1|  hypothetical protein B456_007G072500                    139   2e-35   Gossypium raimondii
gb|KDO47363.1|  hypothetical protein CISIN_1g017251mg                   138   4e-35   Citrus sinensis [apfelsine]
gb|EPS62747.1|  hypothetical protein M569_12043                         137   1e-34   Genlisea aurea
ref|XP_010663792.1|  PREDICTED: V-type proton ATPase subunit C is...    137   2e-34   
gb|KJB76317.1|  hypothetical protein B456_012G082900                    136   2e-34   Gossypium raimondii
ref|XP_008341246.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    133   2e-33   
sp|Q9SCB9.1|VATC_HORVU  RecName: Full=V-type proton ATPase subuni...    134   4e-33   Hordeum vulgare [barley]
gb|ADI46924.1|  ATPvC1m                                                 134   5e-33   Volvox carteri f. nagariensis
ref|XP_002954527.1|  vacuolar ATP synthase, subunit C                   132   2e-32   Volvox carteri f. nagariensis
ref|XP_002503957.1|  H+-or Na+-translocating f-type, v-type and A...    128   7e-31   Micromonas commoda
ref|XP_001696429.1|  vacuolar H+ ATPase V1 sector, subunit C            124   2e-29   Chlamydomonas reinhardtii
ref|XP_005847214.1|  hypothetical protein CHLNCDRAFT_35880              120   5e-28   Chlorella variabilis
gb|KJB40645.1|  hypothetical protein B456_007G072500                    115   6e-28   Gossypium raimondii
gb|KCW64318.1|  hypothetical protein EUGRSUZ_G01948                     109   2e-26   Eucalyptus grandis [rose gum]
ref|XP_001756840.1|  predicted protein                                  115   2e-26   
ref|XP_009051892.1|  hypothetical protein LOTGIDRAFT_206255             114   6e-26   Lottia gigantea
ref|XP_001814187.1|  PREDICTED: V-type proton ATPase subunit C is...    114   7e-26   Tribolium castaneum [rust-red flour beetle]
ref|XP_008195426.1|  PREDICTED: V-type proton ATPase subunit C is...    114   8e-26   Tribolium castaneum [rust-red flour beetle]
ref|XP_007513767.1|  V-type proton ATPase subunit C 1                   114   1e-25   Bathycoccus prasinos
gb|AIJ50380.1|  V-ATPase subunit C                                      113   1e-25   Pectinophora gossypiella
gb|EFA06700.1|  hypothetical protein TcasGA2_TC009631                   114   1e-25   
emb|CCD60515.1|  subfamily S1B unassigned peptidase (S01 family)        111   4e-25   Schistosoma mansoni
ref|XP_011399399.1|  V-type proton ATPase subunit C                     110   1e-24   Auxenochlorella protothecoides
gb|ABF18462.1|  V-ATPase C subunit                                      110   2e-24   Aedes aegypti
ref|XP_009012372.1|  hypothetical protein HELRODRAFT_156435             109   3e-24   Helobdella robusta
ref|XP_001201267.2|  PREDICTED: V-type proton ATPase subunit C-like     109   4e-24   
gb|KDR10550.1|  V-type proton ATPase subunit C                          109   4e-24   Zootermopsis nevadensis
gb|KFB48532.1|  AGAP005845-PA-like protein                              108   5e-24   Anopheles sinensis
ref|XP_011305233.1|  PREDICTED: V-type proton ATPase subunit C          108   6e-24   Fopius arisanus
ref|XP_001843335.1|  vacuolar ATP synthase subunit C                    109   7e-24   Culex quinquefasciatus
ref|XP_002585525.1|  hypothetical protein BRAFLDRAFT_60009              107   1e-23   Branchiostoma floridae
emb|CAX70572.1|  Vacuolar H+ ATPase 44kD C subunit                      107   1e-23   Schistosoma japonicum
ref|XP_008480724.1|  PREDICTED: V-type proton ATPase subunit C          107   1e-23   
gb|ENN78483.1|  hypothetical protein YQE_05047                          106   2e-23   Dendroctonus ponderosae
ref|XP_002423137.1|  vacuolar ATP synthase subunit C, putative          108   2e-23   Pediculus humanus corporis [human body lice]
emb|CAX70571.1|  Vacuolar H+ ATPase 44kD C subunit                      107   2e-23   Schistosoma japonicum
ref|XP_003389520.1|  PREDICTED: V-type proton ATPase subunit C 1-...    107   2e-23   Amphimedon queenslandica
ref|XP_001650489.1|  AAEL005173-PA                                      109   2e-23   
dbj|BAM20425.1|  vacuolar H[+] ATPase 44kD C subunit                    107   2e-23   Papilio polytes
ref|XP_004993351.1|  hypothetical protein PTSG_05481                    106   3e-23   Salpingoeca rosetta
gb|ERL87116.1|  hypothetical protein D910_04516                         106   3e-23   Dendroctonus ponderosae
ref|NP_001023451.1|  Protein VHA-11, isoform a                          106   3e-23   Caenorhabditis elegans [roundworm]
ref|XP_006012217.1|  PREDICTED: V-type proton ATPase subunit C 1-...    106   4e-23   Latimeria chalumnae
ref|XP_006626108.1|  PREDICTED: V-type proton ATPase subunit C 1-...    106   4e-23   Lepisosteus oculatus
ref|NP_958479.1|  V-type proton ATPase subunit C 1-A                    106   4e-23   Danio rerio [leopard danio]
gb|ABO61291.1|  vacuolar ATPase subunit C                               106   4e-23   Lutzomyia longipalpis
emb|CDJ90591.1|  ATPase domain containing protein                       103   4e-23   Haemonchus contortus [red stomach worm]
ref|XP_002645132.1|  C. briggsae CBR-VHA-11 protein                     105   5e-23   Caenorhabditis briggsae
ref|XP_005098193.1|  PREDICTED: V-type proton ATPase subunit C-li...    105   5e-23   Aplysia californica
ref|XP_011504285.1|  PREDICTED: V-type proton ATPase subunit C is...    105   6e-23   Ceratosolen solmsi marchali
ref|XP_005797406.1|  PREDICTED: V-type proton ATPase subunit C 1-...    105   6e-23   Xiphophorus maculatus
ref|XP_004077677.1|  PREDICTED: V-type proton ATPase subunit C 1        105   6e-23   Oryzias latipes [Japanese rice fish]
ref|XP_008559568.1|  PREDICTED: V-type proton ATPase subunit C          105   6e-23   Microplitis demolitor
ref|XP_008420198.1|  PREDICTED: V-type proton ATPase subunit C 1-A      105   6e-23   Poecilia reticulata
ref|XP_009861882.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    105   7e-23   
ref|XP_315870.4|  AGAP005845-PA                                         105   7e-23   Anopheles gambiae str. PEST
ref|XP_001946227.1|  PREDICTED: V-type proton ATPase subunit C          105   8e-23   Acyrthosiphon pisum
ref|XP_001960901.1|  GF11269                                            105   1e-22   Drosophila ananassae
ref|XP_002733333.1|  PREDICTED: V-type proton ATPase subunit C 1-...    105   1e-22   Saccoglossus kowalevskii
gb|EYC06044.1|  hypothetical protein Y032_0078g1163                     105   1e-22   Ancylostoma ceylanicum
ref|XP_011144745.1|  PREDICTED: V-type proton ATPase subunit C          105   1e-22   Harpegnathos saltator
emb|CAF93730.1|  unnamed protein product                                104   1e-22   Tetraodon nigroviridis
ref|XP_003094835.1|  CRE-VHA-11 protein                                 104   1e-22   Caenorhabditis remanei
ref|XP_007547766.1|  PREDICTED: V-type proton ATPase subunit C 1-...    104   2e-22   Poecilia formosa
ref|XP_006219905.1|  PREDICTED: V-type proton ATPase subunit C-like     104   2e-22   
gb|ACO11255.1|  Vacuolar proton pump subunit C                          104   2e-22   Caligus rogercresseyi
ref|NP_001005772.2|  V-type proton ATPase subunit C 1-B                 103   2e-22   Danio rerio [leopard danio]
gb|EYC06045.1|  hypothetical protein Y032_0078g1163                     103   3e-22   Ancylostoma ceylanicum
ref|XP_011268884.1|  PREDICTED: V-type proton ATPase subunit C          103   3e-22   Camponotus floridanus
ref|XP_010768583.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   3e-22   Notothenia coriiceps [yellowbelly rockcod]
gb|EFN75043.1|  Vacuolar proton pump subunit C                          103   3e-22   Camponotus floridanus
ref|XP_008211658.1|  PREDICTED: V-type proton ATPase subunit C is...    103   4e-22   
ref|XP_010751636.1|  PREDICTED: V-type proton ATPase subunit C 1-A      103   4e-22   Larimichthys crocea [croceine croaker]
ref|NP_001040138.1|  vacuolar ATPase subunit C                          103   4e-22   Bombyx mori [silk moth]
sp|Q9U5N1.1|VATC_MANSE  RecName: Full=V-type proton ATPase subuni...    103   5e-22   Manduca sexta [Carolina sphinx]
gb|EGT48628.1|  CBN-VHA-11 protein                                      103   5e-22   Caenorhabditis brenneri
gb|EZA45856.1|  S-methyl-5'-thioadenosine phosphorylase-like prot...    104   5e-22   
gb|EFX90034.1|  hypothetical protein DAPPUDRAFT_205240                  103   5e-22   Daphnia pulex
gb|EGI57447.1|  V-type proton ATPase subunit C                          103   5e-22   Acromyrmex echinatior
gb|EHJ73191.1|  hypothetical protein KGM_01090                          103   5e-22   
ref|XP_009170324.1|  hypothetical protein T265_06723                    103   5e-22   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_008290531.1|  PREDICTED: V-type proton ATPase subunit C 1        102   5e-22   Stegastes partitus
ref|XP_011067212.1|  PREDICTED: V-type proton ATPase subunit C          102   6e-22   Acromyrmex echinatior
ref|XP_003444114.1|  PREDICTED: V-type proton ATPase subunit C 1-...    102   6e-22   Oreochromis niloticus
gb|ESA12183.1|  hypothetical protein GLOINDRAFT_185994                  102   7e-22   
ref|XP_011504284.1|  PREDICTED: V-type proton ATPase subunit C is...    104   7e-22   Ceratosolen solmsi marchali
gb|ETN59245.1|  vacuolar ATP synthase subunit C                         104   7e-22   Anopheles darlingi [American malaria mosquito]
ref|XP_003965909.1|  PREDICTED: V-type proton ATPase subunit C 1-...    102   8e-22   Takifugu rubripes [tiger puffer]
ref|XP_001647617.1|  AAEL015594-PA                                      101   9e-22   
ref|XP_010898239.1|  PREDICTED: V-type proton ATPase subunit C 1-...    102   9e-22   
ref|XP_010771260.1|  PREDICTED: V-type proton ATPase subunit C 1        102   1e-21   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011332476.1|  PREDICTED: V-type proton ATPase subunit C is...    102   1e-21   
ref|XP_007249407.1|  PREDICTED: V-type proton ATPase subunit C 1-...    102   1e-21   Astyanax mexicanus [blind cave fish]
ref|XP_007886138.1|  PREDICTED: V-type proton ATPase subunit C 1        102   1e-21   Callorhinchus milii [Australian ghost shark]
ref|XP_010883498.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    101   1e-21   Esox lucius
ref|XP_011332474.1|  PREDICTED: V-type proton ATPase subunit C is...    102   1e-21   Ooceraea biroi
ref|XP_001418773.1|  F-ATPase family transporter: protons (vacuolar)    101   1e-21   Ostreococcus lucimarinus CCE9901
gb|AAB51350.1|  C subunit of V-ATPase                                   101   1e-21   Amblyomma americanum
dbj|GAA48137.1|  V-type proton ATPase subunit C 1-A                     103   1e-21   Clonorchis sinensis [oriental liver fluke]
ref|XP_008321927.1|  PREDICTED: V-type proton ATPase subunit C 1        101   2e-21   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010744926.1|  PREDICTED: V-type proton ATPase subunit C 1-...    101   2e-21   
ref|XP_007550565.1|  PREDICTED: V-type proton ATPase subunit C 1-A      101   2e-21   Poecilia formosa
gb|AAB62571.1|  V-ATPase C subunit                                      101   2e-21   Drosophila melanogaster
ref|XP_005803508.1|  PREDICTED: V-type proton ATPase subunit C 1-...    101   2e-21   Xiphophorus maculatus
ref|XP_007550566.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   2e-21   Poecilia formosa
ref|XP_010883497.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    100   3e-21   Esox lucius
ref|XP_003459431.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   3e-21   Oreochromis niloticus
ref|XP_002015982.1|  GL11349                                            100   3e-21   Drosophila persimilis
ref|XP_008329974.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   3e-21   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006636047.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   3e-21   Lepisosteus oculatus
ref|XP_002940167.1|  PREDICTED: V-type proton ATPase subunit C 2        100   3e-21   Xenopus tropicalis [western clawed frog]
ref|NP_477266.1|  vacuolar H[+] ATPase 44kD subunit, isoform A          100   3e-21   Drosophila melanogaster
ref|XP_003701871.1|  PREDICTED: V-type proton ATPase subunit C-like     102   3e-21   
ref|XP_005917491.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   3e-21   Haplochromis burtoni
ref|XP_005728447.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   4e-21   Pundamilia nyererei
gb|KFM68542.1|  V-type proton ATPase subunit C                          100   4e-21   Stegodyphus mimosarum
ref|XP_001360460.2|  GA20788                                            100   5e-21   
ref|XP_002107808.1|  hypothetical protein TRIADDRAFT_19844              100   5e-21   Trichoplax adhaerens
emb|CEF60497.1|  V-type proton ATPase subunit C 2                       100   5e-21   Strongyloides ratti
ref|NP_725564.1|  vacuolar H[+] ATPase 44kD subunit, isoform C          100   5e-21   Drosophila melanogaster
ref|XP_008304955.1|  PREDICTED: V-type proton ATPase subunit C 1-A    99.8    6e-21   Stegastes partitus
ref|XP_008211656.1|  PREDICTED: V-type proton ATPase subunit C is...    102   6e-21   Nasonia vitripennis
ref|XP_003395428.1|  PREDICTED: v-type proton ATPase subunit C-like     100   6e-21   
emb|CDS17048.1|  V type proton ATPase subunit C 1 A                   99.8    8e-21   Echinococcus granulosus
ref|XP_002408654.1|  C subunit of V-ATPase, putative                  99.4    9e-21   
emb|CEG71831.1|  hypothetical protein RMATCC62417_07500               99.4    1e-20   Rhizopus microsporus
ref|XP_001975366.1|  GG22273                                          99.8    1e-20   
ref|XP_003741777.1|  PREDICTED: V-type proton ATPase subunit C 1-...  99.0    1e-20   Galendromus occidentalis
emb|CDJ04792.1|  V type proton ATPase subunit C 1 A                   99.0    1e-20   
gb|EUB62465.1|  V-type proton ATPase subunit C 1-A                    99.0    1e-20   Echinococcus granulosus
ref|XP_003968986.1|  PREDICTED: V-type proton ATPase subunit C 1-...  99.0    1e-20   Takifugu rubripes [tiger puffer]
ref|XP_011414828.1|  PREDICTED: V-type proton ATPase subunit C 1-...  99.0    1e-20   Crassostrea gigas
gb|EKC32287.1|  V-type proton ATPase subunit C 1                      99.0    2e-20   
ref|XP_004340673.1|  Vtype proton ATPase subunit C, putative          98.6    2e-20   Acanthamoeba castellanii str. Neff
ref|XP_002092223.1|  GE14069                                          99.8    2e-20   
ref|XP_003488765.1|  PREDICTED: V-type proton ATPase subunit C-like     100   2e-20   
ref|XP_003055517.1|  H+-or Na+-translocating f-type, v-type and A...  97.8    3e-20   Micromonas pusilla CCMP1545
ref|XP_002059879.1|  GJ14996                                            100   3e-20   
ref|XP_006677585.1|  hypothetical protein BATDEDRAFT_87040            98.2    3e-20   Batrachochytrium dendrobatidis JAM81
gb|KFH72569.1|  hypothetical protein MVEG_02858                       97.8    4e-20   Mortierella verticillata NRRL 6337
ref|XP_007476197.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.4    4e-20   Monodelphis domestica
ref|XP_002004414.1|  GI19629                                          99.8    4e-20   
gb|KFP57056.1|  V-type proton ATPase subunit C 1                      95.1    5e-20   Cathartes aura
gb|ETE67498.1|  V-type proton ATPase subunit C 1-A                    97.4    5e-20   Ophiophagus hannah
ref|XP_003139516.1|  V-ATPase subunit C family protein                97.4    5e-20   Loa loa
ref|XP_002063006.1|  GK21692                                          99.8    5e-20   
ref|NP_001279559.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...  97.4    5e-20   Callorhinchus milii [Australian ghost shark]
ref|XP_006562159.1|  PREDICTED: V-type proton ATPase subunit C is...  97.4    5e-20   Apis mellifera [bee]
ref|XP_006611433.1|  PREDICTED: V-type proton ATPase subunit C-li...  97.4    5e-20   Apis dorsata [rock honeybee]
ref|XP_007670905.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  97.1    5e-20   
ref|XP_004074259.1|  PREDICTED: V-type proton ATPase subunit C 1-...  97.1    6e-20   Oryzias latipes [Japanese rice fish]
dbj|BAB24526.1|  unnamed protein product                              97.1    7e-20   Mus musculus [mouse]
ref|XP_004533485.1|  PREDICTED: V-type proton ATPase subunit C-li...  97.1    7e-20   Ceratitis capitata [medfly]
ref|XP_010222647.1|  PREDICTED: V-type proton ATPase subunit C 2      96.7    9e-20   Tinamus guttatus
ref|XP_001506621.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  96.7    9e-20   
ref|XP_006562158.1|  PREDICTED: V-type proton ATPase subunit C is...  97.1    1e-19   Apis mellifera [bee]
ref|XP_005174884.1|  PREDICTED: V-type proton ATPase subunit C        96.3    1e-19   Musca domestica
ref|XP_006611432.1|  PREDICTED: V-type proton ATPase subunit C-li...  97.1    1e-19   
ref|XP_004580713.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.5    1e-19   Ochotona princeps [southern American pika]
ref|XP_010954093.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  95.9    1e-19   Camelus bactrianus [camel]
ref|XP_003375717.1|  vacuolar proton pump subunit C                   96.3    1e-19   Trichinella spiralis
ref|XP_009700298.1|  PREDICTED: V-type proton ATPase subunit C 1      95.9    1e-19   Cariama cristata
gb|KFP65965.1|  V-type proton ATPase subunit C 1                      95.9    1e-19   Cariama cristata
gb|EDM16360.1|  rCG60064, isoform CRA_a                               95.1    1e-19   Rattus norvegicus [brown rat]
ref|XP_007423656.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.9    1e-19   Python bivittatus
gb|KFV93235.1|  V-type proton ATPase subunit C 1                      95.1    2e-19   
ref|NP_725565.3|  vacuolar H[+] ATPase 44kD subunit, isoform E        98.6    2e-19   
gb|AAV36859.1|  RE74713p                                              98.6    2e-19   
ref|NP_001088261.1|  V-type proton ATPase subunit C 1                 95.9    2e-19   
ref|XP_004679737.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    2e-19   
ref|XP_004047450.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    2e-19   
ref|XP_011205545.1|  PREDICTED: V-type proton ATPase subunit C        95.9    2e-19   
ref|XP_010071758.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
emb|CDH57929.1|  vacuolar atp synthase subunit c                      95.9    2e-19   
ref|XP_009578275.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    2e-19   
ref|XP_004663083.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    2e-19   
gb|KFO20049.1|  V-type proton ATPase subunit C 1                      95.5    2e-19   
emb|CDH57928.1|  vacuolar atp synthase subunit c                      95.5    2e-19   
ref|XP_003080507.1|  putative vacuolar ATP synthase subunit C (ISS)   95.5    2e-19   
ref|XP_010610418.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
gb|AAA36803.1|  H+ -ATPase C subunit                                  95.1    2e-19   
ref|XP_005367598.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
ref|XP_006982882.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
gb|KFV06900.1|  V-type proton ATPase subunit C 1                      95.1    2e-19   
ref|XP_006241664.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    2e-19   
ref|XP_008051075.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
ref|XP_010017127.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.5    2e-19   
ref|XP_007634426.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
ref|XP_005072734.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_002710769.1|  PREDICTED: V-type proton ATPase subunit C 1      95.5    2e-19   
ref|XP_010017126.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    2e-19   
ref|XP_005150964.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_004011849.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_003509877.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_006145636.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_009812066.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    2e-19   
ref|XP_003940719.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_008849773.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|XP_004436528.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.1    2e-19   
ref|XP_007056164.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    2e-19   
ref|NP_001011992.1|  V-type proton ATPase subunit C 1                 95.1    3e-19   
ref|XP_005010664.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    3e-19   
ref|XP_005306086.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    3e-19   
ref|XP_009890115.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    3e-19   
gb|KFQ53504.1|  V-type proton ATPase subunit C 1                      95.1    3e-19   
ref|XP_005316339.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.7    3e-19   
ref|XP_006122461.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    3e-19   
ref|XP_004768925.1|  PREDICTED: V-type proton ATPase subunit C 1      95.1    3e-19   
ref|XP_006028579.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    3e-19   
ref|XP_004316545.1|  PREDICTED: V-type proton ATPase subunit C 1-...  94.7    3e-19   
emb|CAH93365.1|  hypothetical protein                                 95.1    3e-19   
ref|XP_003782478.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    3e-19   
emb|CAH93171.1|  hypothetical protein                                 95.1    3e-19   
gb|KFQ17703.1|  V-type proton ATPase subunit C 1                      95.1    3e-19   
ref|XP_004457641.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    3e-19   
gb|KGL98694.1|  V-type proton ATPase subunit C 1                      95.1    3e-19   
dbj|BAE40727.1|  unnamed protein product                              95.1    3e-19   
ref|NP_079770.2|  V-type proton ATPase subunit C 1                    95.1    3e-19   
ref|XP_006212224.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    3e-19   
gb|EPZ31995.1|  ATPase, V1 complex, subunit C domain-containing p...  95.1    3e-19   
ref|XP_003696475.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  97.1    3e-19   
ref|XP_008146707.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    3e-19   
ref|XP_004940041.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    3e-19   
gb|KFP35023.1|  V-type proton ATPase subunit C 1                      95.1    3e-19   
ref|XP_002759363.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_005231036.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_009864623.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_005042435.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_009076362.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|NP_001686.1|  V-type proton ATPase subunit C 1                    94.7    3e-19   
ref|XP_004457640.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    3e-19   
ref|XP_009275405.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_005499457.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
gb|EJW79943.1|  V-ATPase subunit C family protein                     94.7    3e-19   
gb|KFO56816.1|  V-type proton ATPase subunit C 1                      95.1    3e-19   
ref|XP_009680642.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_010148071.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_009896480.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
ref|XP_008934370.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    3e-19   
gb|KFW03506.1|  V-type proton ATPase subunit C 1                      94.7    3e-19   
ref|XP_006021843.1|  PREDICTED: V-type proton ATPase subunit C 2      94.7    3e-19   
gb|KFM06053.1|  V-type proton ATPase subunit C 1                      94.7    3e-19   
gb|KFQ75735.1|  V-type proton ATPase subunit C 1                      94.7    3e-19   
gb|AIC48333.1|  ATP6V1C1                                              94.7    3e-19   
ref|XP_004679736.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.7    3e-19   
ref|XP_004356034.1|  H(+)-transporting ATPase                         94.7    3e-19   
ref|XP_006028578.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    4e-19   
ref|XP_010223600.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    4e-19   
gb|KFP15570.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
gb|KFV65544.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
gb|KFQ55181.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
gb|EOB07902.1|  Vacuolar proton pump subunit C 1                      94.7    4e-19   
gb|KFV53281.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
gb|KFV20198.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
gb|KGL84583.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
gb|KFP85886.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
ref|XP_007932996.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.0    4e-19   
ref|XP_004663082.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.7    4e-19   
gb|KFP83640.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
ref|XP_011227437.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    4e-19   
gb|KFZ64730.1|  V-type proton ATPase subunit C 1                      94.7    4e-19   
ref|XP_001899274.1|  V-ATPase subunit C family protein                94.7    4e-19   
ref|XP_008687451.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    4e-19   
ref|NP_989172.1|  V-type proton ATPase subunit C 1                    94.7    4e-19   
ref|XP_009918407.1|  PREDICTED: V-type proton ATPase subunit C 1      94.7    4e-19   
ref|NP_001177134.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...  94.4    4e-19   
ref|XP_007488240.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    5e-19   
gb|KFQ04988.1|  V-type proton ATPase subunit C 1                      94.4    5e-19   
ref|XP_007518917.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    5e-19   
gb|AAC83084.1|  vacuolar adenosine triphosphatase subunit C           94.4    5e-19   
ref|XP_005316338.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    5e-19   
ref|XP_002922648.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    5e-19   
ref|XP_006192890.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    5e-19   
ref|XP_004402384.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    5e-19   
ref|XP_003782477.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    5e-19   
ref|XP_008574309.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_008146706.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    6e-19   
ref|XP_007075876.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_005627900.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_005879352.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|NP_788849.1|  V-type proton ATPase subunit C 1                    94.4    6e-19   
ref|XP_004431292.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_008922269.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_006916693.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    6e-19   
ref|XP_010004766.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_009510884.1|  PREDICTED: V-type proton ATPase subunit C 1      94.4    6e-19   
ref|XP_007463323.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    6e-19   
ref|XP_418370.1|  PREDICTED: V-type proton ATPase subunit C 1 iso...  94.4    6e-19   
ref|XP_006212223.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    6e-19   
ref|XP_004275371.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    6e-19   
ref|XP_001494151.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    6e-19   
ref|XP_010302959.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    6e-19   
gb|KFO11936.1|  V-type proton ATPase subunit C 1                      94.4    6e-19   
ref|XP_004370770.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    6e-19   
gb|ADI40552.1|  lysosomal H+-transporting ATPase 42kDa, V1 subuni...  92.4    7e-19   
ref|XP_006897234.1|  PREDICTED: V-type proton ATPase subunit C 1-...  94.0    7e-19   
emb|CDS06331.1|  hypothetical protein LRAMOSA08859                    94.0    7e-19   
ref|XP_008500896.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    7e-19   
ref|XP_006830685.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    7e-19   
ref|XP_007932994.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.0    7e-19   
ref|XP_001369362.2|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.4    7e-19   
ref|XP_006010910.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  94.0    7e-19   
emb|CDQ00984.1|  Protein Bm13998, isoform h                           94.7    7e-19   
ref|XP_001987444.1|  GH21923                                          96.3    8e-19   
ref|XP_006140884.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    8e-19   
ref|XP_003408473.1|  PREDICTED: V-type proton ATPase subunit C 1      94.0    8e-19   
gb|KFP07692.1|  V-type proton ATPase subunit C 1                      94.0    8e-19   
ref|XP_011181512.1|  PREDICTED: V-type proton ATPase subunit C        94.0    8e-19   
gb|KFW95221.1|  V-type proton ATPase subunit C 1                      94.0    8e-19   
ref|XP_002199030.2|  PREDICTED: V-type proton ATPase subunit C 1      94.7    8e-19   
ref|XP_007427660.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  93.6    8e-19   
ref|XP_004607741.1|  PREDICTED: V-type proton ATPase subunit C 1      93.6    9e-19   
ref|XP_003787440.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.6    9e-19   
gb|ELT96241.1|  hypothetical protein CAPTEDRAFT_179819                93.6    1e-18   
ref|XP_003219499.1|  PREDICTED: V-type proton ATPase subunit C 1      93.6    1e-18   
ref|XP_003760346.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  93.2    1e-18   
ref|XP_007488239.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.0    1e-18   
ref|XP_004903962.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  93.2    1e-18   
ref|XP_003760347.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  93.2    1e-18   
dbj|BAH12829.1|  unnamed protein product                              92.4    1e-18   
gb|KHJ99251.1|  v-ATPase subunit C                                    93.2    1e-18   
gb|ELW68408.1|  V-type proton ATPase subunit C 1                      92.4    2e-18   
gb|ADI40553.1|  lysosomal H+-transporting ATPase 42kDa, V1 subuni...  90.5    2e-18   
emb|CDW54631.1|  V type proton ATPase subunit C                       92.8    2e-18   
gb|EMP39278.1|  V-type proton ATPase subunit C 1                      94.4    2e-18   
ref|XP_003480143.1|  PREDICTED: V-type proton ATPase subunit C 1      92.8    2e-18   
gb|KFO92741.1|  V-type proton ATPase subunit C 1                      92.8    2e-18   
ref|XP_010139291.1|  PREDICTED: V-type proton ATPase subunit C 1      92.4    2e-18   
ref|XP_009321363.1|  PREDICTED: V-type proton ATPase subunit C 1      92.4    2e-18   
ref|XP_009556284.1|  PREDICTED: V-type proton ATPase subunit C 1      92.4    2e-18   
ref|XP_006257984.1|  PREDICTED: V-type proton ATPase subunit C 2      92.4    3e-18   
gb|KFO74013.1|  V-type proton ATPase subunit C 1                      92.4    3e-18   
gb|KFW66441.1|  V-type proton ATPase subunit C 1                      92.4    3e-18   
ref|XP_009029568.1|  hypothetical protein HELRODRAFT_103807           92.4    3e-18   
ref|XP_008528126.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  92.0    3e-18   
ref|XP_008895951.1|  hypothetical protein, variant                    91.7    3e-18   
ref|XP_007933285.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  92.0    3e-18   
gb|EYC06042.1|  hypothetical protein Y032_0078g1163                   92.4    3e-18   
ref|XP_008528125.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  92.0    4e-18   
gb|EPX75285.1|  V-type ATPase V1 subunit C                            92.0    4e-18   
ref|XP_010980173.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  92.0    4e-18   
ref|XP_004665751.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  92.0    4e-18   
ref|XP_008115724.1|  PREDICTED: V-type proton ATPase subunit C 2      92.0    4e-18   
ref|XP_005327420.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  91.7    4e-18   
ref|XP_006760332.1|  PREDICTED: V-type proton ATPase subunit C 1      91.3    4e-18   
ref|XP_004582658.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  91.7    5e-18   
gb|EIE92422.1|  hypothetical protein RO3G_16944                       91.3    5e-18   
gb|EIE80207.1|  hypothetical protein RO3G_04912                       91.3    6e-18   
ref|XP_008895950.1|  hypothetical protein PPTG_03917                  91.7    6e-18   
gb|ELK13979.1|  V-type proton ATPase subunit C 2                      90.5    6e-18   
ref|XP_004310309.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  91.3    7e-18   
gb|EPB87134.1|  hypothetical protein HMPREF1544_06060                 91.3    7e-18   
ref|XP_004887051.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  91.3    7e-18   
gb|EPY75601.1|  V-type proton ATPase subunit C 2 isoform 1            90.9    7e-18   
ref|XP_001503588.2|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.9    7e-18   
ref|XP_001505940.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.9    8e-18   
ref|XP_010627354.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.9    8e-18   
ref|XP_005655333.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.9    9e-18   
ref|XP_008493333.1|  PREDICTED: V-type proton ATPase subunit C 2      90.9    9e-18   
ref|XP_006191924.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.5    1e-17   
gb|EYC06043.1|  hypothetical protein Y032_0078g1163                   91.7    1e-17   
ref|XP_011363427.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  90.5    1e-17   
ref|XP_006910296.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.5    1e-17   
dbj|GAN10975.1|  ATPase V1 complex subunit C                          90.5    1e-17   
gb|EFA81774.1|  H+-transporting ATPase                                90.1    1e-17   
ref|XP_005293177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.5    1e-17   
ref|XP_009068581.1|  PREDICTED: V-type proton ATPase subunit C 2      90.5    1e-17   
ref|XP_005404477.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.1    1e-17   
ref|XP_002196413.1|  PREDICTED: V-type proton ATPase subunit C 2      90.1    1e-17   
ref|XP_005717787.1|  V-type ATP synthase, Subunit V1C                 90.1    1e-17   
ref|XP_009898136.1|  PREDICTED: V-type proton ATPase subunit C 2      90.1    2e-17   
ref|XP_005487252.1|  PREDICTED: V-type proton ATPase subunit C 2      90.1    2e-17   
ref|XP_008063729.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.1    2e-17   
ref|XP_005084999.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  90.1    2e-17   
emb|CEP11726.1|  hypothetical protein                                 90.1    2e-17   
ref|XP_006869522.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.7    2e-17   
ref|XP_009489937.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  87.8    2e-17   
ref|XP_003501279.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.7    2e-17   
ref|XP_007127701.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.7    2e-17   
ref|XP_007456981.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.7    2e-17   
ref|XP_007195714.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.7    2e-17   
ref|XP_008570352.1|  PREDICTED: V-type proton ATPase subunit C 2      90.1    3e-17   
ref|XP_010734712.1|  PREDICTED: V-type proton ATPase subunit C 1-...  88.6    3e-17   
ref|XP_008848335.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.4    3e-17   
ref|XP_008848334.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.4    3e-17   
ref|XP_004274931.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  89.4    3e-17   



>dbj|BAO57286.1| V-type proton ATPase subunit [Ipomoea nil]
Length=376

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET
Sbjct  216  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLSVVLSPSVKSEKRVRSI
Sbjct  276  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLSVVLSPSVKSEKRVRSI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV
Sbjct  336  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  376



>ref|XP_009786911.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana sylvestris]
Length=376

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDNEYALYTVTLF RDADNF+IKARERGFQIRDFE+NPET ESRKQELEKLMQDQETF
Sbjct  217  LYEDNEYALYTVTLFNRDADNFKIKARERGFQIRDFEHNPETQESRKQELEKLMQDQETF  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLSVVL+PS KSEK+VRSIL
Sbjct  277  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLSVVLAPSTKSEKKVRSIL  336

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            ESLCDSSNS +WK+EDEG +  FGGD+E HPYVSFTINLV
Sbjct  337  ESLCDSSNSNFWKSEDEGGMAGFGGDSEAHPYVSFTINLV  376



>ref|XP_009618992.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana tomentosiformis]
Length=376

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDNEYALYTVTLF RDADNF+IKARERGFQIRDFE+NP+T ESRKQELEKLMQDQETF
Sbjct  217  LYEDNEYALYTVTLFNRDADNFKIKARERGFQIRDFEHNPDTQESRKQELEKLMQDQETF  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLSVVL+PS KSEK+VRSIL
Sbjct  277  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLSVVLAPSTKSEKKVRSIL  336

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            ESLCDSSNS +WK+EDEG +  FGGDAE HPYVSFTINL
Sbjct  337  ESLCDSSNSNFWKSEDEGGMAGFGGDAEAHPYVSFTINL  375



>ref|XP_006363973.1| PREDICTED: V-type proton ATPase subunit C-like [Solanum tuberosum]
Length=376

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDNEYALYTVTLF RDADNF+IKARERGFQIRDFE+NPET ESRKQELEKLMQDQETF
Sbjct  217  LFEDNEYALYTVTLFNRDADNFKIKARERGFQIRDFEHNPETQESRKQELEKLMQDQETF  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLSVVL+PS+KSEK+VRSIL
Sbjct  277  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLSVVLAPSIKSEKKVRSIL  336

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            ESLCDSSNS +WK +DEG +  FGGD E HPYVSFTINLV
Sbjct  337  ESLCDSSNSNFWKADDEGGMAGFGGDTEAHPYVSFTINLV  376



>ref|XP_004235295.1| PREDICTED: V-type proton ATPase subunit C [Solanum lycopersicum]
Length=376

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDNEYALYTVTLF RDADNF+ KARERGFQIRDFE+NPET ESRKQELEKLMQDQETF
Sbjct  217  LYEDNEYALYTVTLFNRDADNFKNKARERGFQIRDFEHNPETQESRKQELEKLMQDQETF  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLSVVL+PS+KSEK+VRSIL
Sbjct  277  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLSVVLAPSIKSEKKVRSIL  336

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            ESLCDSSNS +WK +DEG +  FGGD E HPYVSFTINLV
Sbjct  337  ESLCDSSNSNFWKADDEGGMAGFGGDTEAHPYVSFTINLV  376



>emb|CDP15722.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTV LF+RDADNFR KARER FQIRDFEYN ET ESRKQELEKLMQDQE 
Sbjct  216  KLYEDNEYALYTVILFSRDADNFRTKARERAFQIRDFEYNSETQESRKQELEKLMQDQER  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRSSLLQWCYTSYGEVF SWMHFCAVR+FAESILRYGLPPSFLS VLSPSVKSEK+VRSI
Sbjct  276  FRSSLLQWCYTSYGEVFISWMHFCAVRIFAESILRYGLPPSFLSAVLSPSVKSEKKVRSI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDSSNSTYWKTEDEG +  FG DA+ HPYVSFTINL+
Sbjct  336  LEGLCDSSNSTYWKTEDEGPLSGFGADADAHPYVSFTINLI  376



>ref|XP_011073132.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF RDADNFR KARER FQIRDFEYNPET ESRKQELEKL QDQET
Sbjct  216  KLHEDNEYALYTVTLFIRDADNFRTKARERNFQIRDFEYNPETQESRKQELEKLNQDQET  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLSVVLSP  KSEK+VR+I
Sbjct  276  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLSVVLSPPTKSEKKVRNI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC SSNSTYWKTEDEG +G F GD + HPYVSFTINL+
Sbjct  336  LEGLCSSSNSTYWKTEDEGGMGGFAGDTDAHPYVSFTINLI  376



>ref|XP_011083360.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF+RDADNFR KARE+ FQ+RDFEYNPET ESRKQELEKL+QDQET
Sbjct  216  KLHEDNEYALYTVTLFSRDADNFRTKAREKNFQVRDFEYNPETQESRKQELEKLIQDQET  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLSVVLSPSVKSEK+VRSI
Sbjct  276  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLSVVLSPSVKSEKKVRSI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE L DSS+STYWKT+DEG +G F GDA+ HPYV FTINL+
Sbjct  336  LEGLSDSSHSTYWKTDDEGGMGGFAGDADAHPYVCFTINLI  376



>gb|EYU24479.1| hypothetical protein MIMGU_mgv1a006812mg [Erythranthe guttata]
Length=430

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYAL+TVTLF+RDADNFR KARER FQIRDFEYN ET ESRKQELEKLMQDQE+
Sbjct  270  KLHEDNEYALFTVTLFSRDADNFRTKARERSFQIRDFEYNSETQESRKQELEKLMQDQES  329

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLSVVL+PS+KSEK+VRSI
Sbjct  330  LRNSLLQWCYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLSVVLAPSLKSEKKVRSI  389

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC SSNSTYWK EDE  +G FGGD++ HPYVSFT+NLV
Sbjct  390  LEGLCTSSNSTYWKGEDEVGMGGFGGDSDAHPYVSFTVNLV  430



>gb|KJB40644.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=261

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++
Sbjct  100  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLVQDQDS  159

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VLSPS K EK+VRSI
Sbjct  160  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLACVLSPSTKGEKKVRSI  219

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE GA+   GGDA+ +PYVSFTIN+
Sbjct  220  LEGLCDSTNSTYWKTEDEGGAMAGLGGDADTYPYVSFTINI  260



>ref|XP_007031994.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
 gb|EOY02920.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
Length=375

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLIQDQDS  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVF+ESILRYGLPPSFL+ VL+PSVK EK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFSESILRYGLPPSFLACVLAPSVKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE GA+   GGDA+ HPYVSFTIN+
Sbjct  334  LEGLCDSTNSTYWKTEDESGAMAGLGGDADAHPYVSFTINI  374



>gb|KJB40648.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=375

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLVQDQDS  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VLSPS K EK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLACVLSPSTKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE GA+   GGDA+ +PYVSFTIN+
Sbjct  334  LEGLCDSTNSTYWKTEDEGGAMAGLGGDADTYPYVSFTINI  374



>gb|KJB76316.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=352

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+ 
Sbjct  191  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDM  250

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSI
Sbjct  251  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSI  310

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  311  LEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  351



>gb|KJB76315.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76318.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76321.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=375

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+ 
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDM  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  334  LEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  374



>ref|XP_002284444.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Vitis vinifera]
 emb|CBI15738.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVT+F R ADNF+  ARERGFQIRDFEY+PET ESRKQELEKLM DQ+T
Sbjct  214  KLHEDNEYALYTVTIFGRVADNFKTSARERGFQIRDFEYSPETQESRKQELEKLMLDQDT  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLSVVL+PSVKSEK+ RSI
Sbjct  274  IRTSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLSVVLAPSVKSEKKARSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE L DS+NSTYWK+EDE G +G+ GGDA+ HPYVSFTINLV
Sbjct  334  LEGLSDSANSTYWKSEDELGGMGSLGGDADSHPYVSFTINLV  375



>ref|XP_007151733.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
 gb|ESW23727.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
Length=376

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PE+HESRKQEL+KL++DQE+
Sbjct  214  KLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPESHESRKQELDKLIEDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPPSFL+ VL+PSVK+EK+VRSI
Sbjct  274  LRASLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPSFLASVLAPSVKAEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTINLV  268
            LE L DS+NS YWKTEDEG    G   GDA+ HPYVSFTINLV
Sbjct  334  LEGLSDSTNSGYWKTEDEGVGMAGLVAGDADAHPYVSFTINLV  376



>ref|XP_010249179.1| PREDICTED: V-type proton ATPase subunit C-like [Nelumbo nucifera]
Length=375

 Score =   251 bits (642),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALY VTLF R ADNF+  ARERGFQIR+FEY+PET ESRK+ELEKLMQDQET
Sbjct  216  KLHEDNEYALYNVTLFGRVADNFKTSARERGFQIREFEYSPETQESRKRELEKLMQDQET  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLL WCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PS K+EK+VRSI
Sbjct  276  LRGSLLLWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLATVLAPSTKNEKKVRSI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS++STYWK+EDEG VG  GGDA+ HPYVSFTIN++
Sbjct  336  LEGLCDSTHSTYWKSEDEGVVG-LGGDADSHPYVSFTINII  375



>ref|XP_008231040.1| PREDICTED: V-type proton ATPase subunit C [Prunus mume]
Length=376

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+P+ KSEK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRIFAESILRYGLPPSFLACVLAPTTKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS NST+WKT+DE  GA+   GGDA+ HPYVSFTINLV
Sbjct  334  LEGLCDSGNSTFWKTDDEVGGAMAGLGGDADAHPYVSFTINLV  376



>ref|XP_006599411.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN13381.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R ADNFR  ARE GFQIRDFEY+PE+H+SRKQELEKL++DQE+
Sbjct  214  KLYEDNEYALYTVTLFSRVADNFRTSAREEGFQIRDFEYSPESHDSRKQELEKLVEDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPPSFL+ VL+PSVK+EK+VRSI
Sbjct  274  LRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPSFLACVLAPSVKAEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEG-AVGAFGGDAEVHPYVSFTINLV  268
            LE L DSSNS YWKTEDEG  +    GDA+ HPYVSFTINLV
Sbjct  334  LEGLSDSSNSAYWKTEDEGVGMAGLAGDADAHPYVSFTINLV  375



>gb|KDP41839.1| hypothetical protein JCGZ_26857 [Jatropha curcas]
Length=376

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  E RKQELEKLMQDQE+
Sbjct  214  KLYEDNEYALYTVTLFRRVADNFRTSAREKGFQIRDFEYSPEAQEGRKQELEKLMQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQW YTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  274  LRSSLLQWSYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLSCVLAPSAKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWK+EDE  G + A GGDA  +PYVSFTINL
Sbjct  334  LEGLCDSANSTYWKSEDEIGGGMAALGGDAGAYPYVSFTINL  375



>ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [Vitis vinifera]
 emb|CBI21291.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+ E  ESRK+ELEKLM+DQET
Sbjct  214  KLHEDNEYALYTVTLFHRVADNFRTNARERGFQIRDFEYSSEAQESRKEELEKLMRDQET  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRS+LLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  274  FRSTLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS+NS +WK+ED+ G +   GGDA+ HPYV FTINLV
Sbjct  334  LEGLCDSTNSAFWKSEDDAGGMAGLGGDADAHPYVCFTINLV  375



>gb|KHM99227.1| V-type proton ATPase subunit C [Glycine soja]
Length=376

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE 
Sbjct  214  KLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQER  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  274  LRASLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  271
            LE L DS+NS YWKTEDE   G  G  GDA+ HPYVSFTIN+
Sbjct  334  LEGLTDSTNSAYWKTEDEVGAGMAGLAGDADAHPYVSFTINV  375



>ref|XP_003548919.2| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=384

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE 
Sbjct  222  KLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQER  281

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  282  LRASLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSI  341

Query  390  LESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  271
            LE L DS+NS YWKTEDE   G  G  GDA+ HPYVSFTIN+
Sbjct  342  LEGLTDSTNSAYWKTEDEVGAGMAGLAGDADAHPYVSFTINV  383



>ref|XP_007215551.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
 gb|EMJ16750.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
Length=376

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+P+ KSEK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPTTKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS NST+WKT+DE  G +    GDA+ HPYVSFTINLV
Sbjct  334  LEGLCDSGNSTFWKTDDEVGGGMAGLAGDADAHPYVSFTINLV  376



>ref|XP_008362171.1| PREDICTED: V-type proton ATPase subunit C-like [Malus domestica]
Length=262

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  100  KLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  159

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+ VLSP  K+EK+VRSI
Sbjct  160  LRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPNFLACVLSPPTKAEKKVRSI  219

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS NST+WK +DE  G V    GDA+ HPYVSFTINLV
Sbjct  220  LEGLCDSGNSTFWKXDDEVGGGVPGLAGDADAHPYVSFTINLV  262



>gb|AIY85415.1| V-ATPase subunit C1 [Eriobotrya japonica]
Length=376

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+ VL+P  K+EK+VRSI
Sbjct  274  LRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPNFLACVLAPPTKAEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS NST+WKT+DE  G V    GDA+ HPYVSFTINLV
Sbjct  334  LEGLCDSGNSTFWKTDDEVGGGVPGLAGDADAHPYVSFTINLV  376



>ref|XP_003553974.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=377

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE 
Sbjct  215  KLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQER  274

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  275  LRTSLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSI  334

Query  390  LESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  271
            LE L DS+NS YWK EDE   G  G  GDA+ HPYVSFTINL
Sbjct  335  LEGLSDSTNSAYWKNEDEVGAGMAGLAGDADGHPYVSFTINL  376



>dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
Length=263

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFRI ARE+GFQ+RDFE + E  E+RKQEL KL+QDQE+
Sbjct  102  KLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQETRKQELAKLVQDQES  161

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  162  LRSSLLQWCYTSYGEVFSSWMHFCAVRTFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  221

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  222  LERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  262



>gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum]
Length=377

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYT TLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ  
Sbjct  214  KLYEDNEYALYTATLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQYM  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl--svvlspsvkSEKRVR  397
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPS    + VLSPSVK EK+VR
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSPSFLACVLSPSVKGEKKVR  333

Query  396  SILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            SILE LCDS+NSTYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  334  SILEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  376



>ref|XP_011045799.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Populus 
euphratica]
 ref|XP_011045800.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Populus 
euphratica]
Length=375

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  ESRKQELE+L++DQE 
Sbjct  214  KLYEDNEYALYTVTLFKRVADNFRTNAREKGFQIRDFEYSPEAQESRKQELERLVRDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCA+RVFAESILRYGLPPSFL+ VLSP+ KSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAIRVFAESILRYGLPPSFLACVLSPTTKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE  CD+SNST+WK+EDE G +   GGDA+ +PY SFTINLV
Sbjct  334  LEGFCDNSNSTHWKSEDEMGGIFGLGGDADTYPYPSFTINLV  375



>ref|XP_009378027.1| PREDICTED: V-type proton ATPase subunit C [Pyrus x bretschneideri]
Length=376

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+ VL+P  K+EK+VRSI
Sbjct  274  LRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPNFLACVLAPPTKAEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS NST+WKT+DE  G V    GD + HPYVSFTINLV
Sbjct  334  LEGLCDSGNSTFWKTDDEVGGGVPGLAGDVDAHPYVSFTINLV  376



>ref|XP_010925033.1| PREDICTED: V-type proton ATPase subunit C-like [Elaeis guineensis]
Length=374

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNF+  ARERGFQIR+FEY+PE  ESRKQELEKL+QDQE 
Sbjct  214  KLHEDNEYALYTVTLFGRVADNFKTSARERGFQIREFEYSPEAQESRKQELEKLLQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PS K EK+VRSI
Sbjct  274  IRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLAAVLAPSAKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + NST+WK+EDE  +   GG+AE +PYVSFTIN+V
Sbjct  334  LEELCGNVNSTFWKSEDEVGLAGLGGEAEAYPYVSFTINIV  374



>ref|XP_003624472.1| V-type proton ATPase subunit C [Medicago truncatula]
 gb|AES80690.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=378

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHE RKQEL+KLMQDQE+
Sbjct  216  KLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHEGRKQELDKLMQDQES  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCY SYGEVFSSWMHFCAVR+F+ESILRYGLPPSFL+ VL+PSVK+EK+VRSI
Sbjct  276  LRGSLLQWCYASYGEVFSSWMHFCAVRLFSESILRYGLPPSFLACVLAPSVKAEKKVRSI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  268
            LE L DSSNS YWKT++E   G  G  G+A+ HPYVSFTINL+
Sbjct  336  LEGLSDSSNSAYWKTDEEVGAGMAGLAGEADTHPYVSFTINLL  378



>ref|XP_006446960.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446961.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446962.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006468875.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468876.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Citrus 
sinensis]
 ref|XP_006468877.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Citrus 
sinensis]
 gb|ESR60200.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60201.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60202.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|KDO47360.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47361.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47362.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=375

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDNEYALYTVTLF R ADNFRI ARE+GFQIRDFEY+ E  ESR QELEKL+ DQE+ 
Sbjct  215  LYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSSEAQESRNQELEKLVHDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK EK+VRSIL
Sbjct  275  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSIL  334

Query  387  ESLCDSSNSTYWKTEDEGAVGA-FGGDAEVHPYVSFTINLV  268
            E LC ++NST+WK+ED+G + A  GGDA+ HPYVSFTINLV
Sbjct  335  EELCGNANSTFWKSEDDGGMMAGLGGDADSHPYVSFTINLV  375



>ref|XP_011468207.1| PREDICTED: V-type proton ATPase subunit C [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALY+VTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYSVTLFGRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPVTKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDSSNS +WKTEDE  GA+    GDA+ HPYVSF INLV
Sbjct  334  LEGLCDSSNS-FWKTEDEVGGAMAGLAGDADAHPYVSFNINLV  375



>emb|CDY19421.1| BnaC05g09300D [Brassica napus]
Length=377

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+
Sbjct  216  KLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQES  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  276  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  335

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  336  LERLCDSTNSGYWKSEEDAGAMAGLAGDSETHPYVSFTINL  376



>ref|NP_001141160.1| hypothetical protein [Zea mays]
 gb|ACF84813.1| unknown [Zea mays]
 gb|ACF85584.1| unknown [Zea mays]
 gb|ACN29201.1| unknown [Zea mays]
 gb|AFW81324.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81325.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=200

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE 
Sbjct  40   KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEA  99

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  100  MRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSI  159

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC +++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  160  LEELCGNAHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  200



>ref|XP_004977299.1| PREDICTED: V-type proton ATPase subunit C-like [Setaria italica]
Length=377

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALY+VTLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE 
Sbjct  217  KLYEDNEYALYSVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SY EVFSSWMHFCAVR+F ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  277  MRSSLLQWCYASYSEVFSSWMHFCAVRIFVESILRYGLPPSFLSAVLAPSTKSEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC +++STYWK+ED+ +V   GG++E+HPYVSFTIN+V
Sbjct  337  LEELCGNAHSTYWKSEDDVSVAGLGGESELHPYVSFTINIV  377



>gb|AFW81322.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81323.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=260

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE 
Sbjct  100  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEA  159

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  160  MRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSI  219

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC +++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  220  LEELCGNAHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  260



>ref|XP_006417188.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
 gb|ESQ35541.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
Length=375

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +L+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  RLFEDNEYALYTVTLFTRVADNFRTSAREKGFQVRDFEHSAEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP VKSEK+VRSI
Sbjct  274  LRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPVVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_008379060.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C [Malus domestica]
Length=376

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALY+VTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYSVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SYGEVFSSWMHFCAVR FAESILRYGLPP+FL+ VL+P+ K+EK+VRSI
Sbjct  274  LRASLLQWCYXSYGEVFSSWMHFCAVRDFAESILRYGLPPNFLACVLAPTTKAEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS NST+WKT+DE  G V    GDA+ HPYVSFTINLV
Sbjct  334  LEGLCDSGNSTFWKTDDEAGGGVPGLAGDADAHPYVSFTINLV  376



>ref|XP_009148561.1| PREDICTED: V-type proton ATPase subunit C [Brassica rapa]
 emb|CDX98037.1| BnaA06g07880D [Brassica napus]
Length=375

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  E+RKQEL+KL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQETRKQELQKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSGYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010066422.1| PREDICTED: V-type proton ATPase subunit C [Eucalyptus grandis]
Length=378

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +L+EDNEYALYTVTLF+R ADNFR  ARERGFQIRDFEYN E  E RKQELE+LM+DQE 
Sbjct  217  QLHEDNEYALYTVTLFSRVADNFRTTARERGFQIRDFEYNLEAQEGRKQELERLMRDQEN  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK EK+VRSI
Sbjct  277  FRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSI  336

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCD+++S YWK  ED G +   GGDA+ HPYVSFTIN+
Sbjct  337  LEGLCDNTHSAYWKPEEDAGGMAGLGGDADTHPYVSFTINI  377



>ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
 sp|Q9SDS7.1|VATC_ARATH RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar H(+)-ATPase subunit C; AltName: 
Full=Vacuolar proton pump subunit C [Arabidopsis thaliana]
 gb|AAF20146.1|AF208261_1 vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAF78489.1|AC012187_9 Identical to vacuolar ATP sythase subunit C (DET3) from Arabidopsis 
thaliana gb|AF208261. ESTs gb|AA067533, gb|Z37481, gb|AA721838, 
gb|Z37180, gb|T21206 come from this gene [Arabidopsis 
thaliana]
 gb|AAG50103.1|AF334725_1 putative vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAL24354.1| Identical to vacuolar ATP sythase subunit C (DET3) [Arabidopsis 
thaliana]
 gb|AAM13333.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
 dbj|BAH30291.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28936.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
Length=375

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFRI ARE+GFQ+RDFE + E  E+RKQEL KL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQETRKQELAKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRTFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010693540.1| PREDICTED: V-type proton ATPase subunit C [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVT+F+R ADNFR+KARERGFQIRDFE++PET +SRKQELEKL  DQET
Sbjct  214  KLYEDNEYALYTVTMFSRVADNFRVKARERGFQIRDFEHDPETQDSRKQELEKLAHDQET  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RS+LLQWCY+SYGEVFSSWMHFCAVRVF+ESILRYGLPP+FL+ VL+PS KSEK+VRSI
Sbjct  274  MRSALLQWCYSSYGEVFSSWMHFCAVRVFSESILRYGLPPNFLACVLAPSQKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE  C + NS +WK EDE GA+     +A+ HPYVSFTINLV
Sbjct  334  LERNCTAGNSVHWKAEDEVGAMAGLAAEADPHPYVSFTINLV  375



>ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Elaeis 
guineensis]
Length=374

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF+R ADNF+  ARERGFQIR+FEY+PE  ESRKQELEKL+QDQE 
Sbjct  214  KLHEDNEYALYTVTLFSRVADNFKTSARERGFQIREFEYSPEAQESRKQELEKLLQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFS+WMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSI
Sbjct  274  MRSSLLQWCYASYGEVFSAWMHFCAVRVFAESILRYGLPPSFLAAVLAPPAKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE L  ++NS +WK+EDE ++   GG+AE +PYVSFTIN+V
Sbjct  334  LEELSGNANSAFWKSEDEVSLAGIGGEAEAYPYVSFTINIV  374



>ref|XP_009386009.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF + ADNFR  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+
Sbjct  216  KLHEDNEYALYTVTLFQKVADNFRNNAREKGFQIREFEYSPEAQESRKQELEKLIQDQES  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+VVL+P VKSEK+VR I
Sbjct  276  KRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLAVVLAPLVKSEKKVRGI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + NS+YWK+EDE  +   GG+AE +PYVSFTINLV
Sbjct  336  LEELCGNVNSSYWKSEDEIGLAGIGGEAEAYPYVSFTINLV  376



>ref|XP_003518129.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN00618.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEY LYTVTLF+R ADNFR  ARE+GFQIRDFEY+ E+++SRKQELEKL++DQE+
Sbjct  214  KLYEDNEYVLYTVTLFSRVADNFRTSAREKGFQIRDFEYSHESYDSRKQELEKLVEDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVF ESILRYGLPPSFL+ VL+PSVK+EK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFTESILRYGLPPSFLACVLAPSVKAEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEG-AVGAFGGDAEVHPYVSFTINLV  268
            LE L  SSNS YWKTEDEG  +    GDA+ HPYVSFTINLV
Sbjct  334  LEGLSGSSNSAYWKTEDEGVGMAGLAGDADAHPYVSFTINLV  375



>emb|CDY16036.1| BnaC08g40870D [Brassica napus]
Length=474

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010476263.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDNEYALYTV LFTR ADNFR  ARERGFQ+RDFE++ E  E+RKQELEKL+QDQE+ 
Sbjct  215  LFEDNEYALYTVVLFTRVADNFRTTARERGFQVRDFEHSVEAQETRKQELEKLVQDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VR IL
Sbjct  275  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRPIL  334

Query  387  ESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            E LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  335  ERLCDSTNSLYWKSEEDGGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010494723.1| PREDICTED: V-type proton ATPase subunit C [Camelina sativa]
Length=375

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDNEYALYTV LFTR ADNFR  ARERGFQ+RDFE++ E  E+RKQELEKL+QDQE+ 
Sbjct  215  LFEDNEYALYTVVLFTRVADNFRTTARERGFQVRDFEHSVEAQETRKQELEKLVQDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VR IL
Sbjct  275  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRPIL  334

Query  387  ESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            E LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  335  ERLCDSTNSLYWKSEEDGGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_002441755.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
 gb|EES15593.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
Length=377

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +LYEDNEYALYTVTLF +  DNF+++ARE+GFQIRDFEY+PE  ESRKQE+EKL+QDQE 
Sbjct  217  QLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQIRDFEYSPEAQESRKQEMEKLLQDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHFCAVR+F ESILRYGLPPSFLS VL+PS K EK+VRSI
Sbjct  277  MRTSLLQWCYASYSEVFSSWMHFCAVRIFVESILRYGLPPSFLSAVLAPSTKGEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + +S YWK ED+ AV   GG++EVHPYVSFT+N V
Sbjct  337  LEELCGNVHSIYWKAEDDVAVAGLGGESEVHPYVSFTVNFV  377



>ref|XP_009395792.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF + ADNFR  ARE+GFQIR+FEY+PE  ESRKQE EKL+QDQE+
Sbjct  214  KLHEDNEYALYTVTLFRKVADNFRNNAREKGFQIREFEYSPEAQESRKQEFEKLIQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPP FL+VVL+PSVK+EK+VR I
Sbjct  274  KRRSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPQFLAVVLAPSVKNEKKVRGI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + NS+YWK+EDE  +   GG+AE HPYVSFTINLV
Sbjct  334  LEELCGNVNSSYWKSEDEVGLAGIGGEAEAHPYVSFTINLV  374



>ref|XP_004493016.1| PREDICTED: V-type proton ATPase subunit C-like [Cicer arietinum]
Length=378

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +LYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHESRKQEL+KLMQDQE+
Sbjct  216  QLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHESRKQELDKLMQDQES  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+PSVK+EK+VRSI
Sbjct  276  LRGSLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLACVLAPSVKAEKKVRSI  335

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE L DSSNS YWKT+++  G +    GDA+ HPYVSFTINL+
Sbjct  336  LEGLSDSSNSAYWKTDEDLGGGMAGLAGDADTHPYVSFTINLL  378



>ref|XP_008808181.1| PREDICTED: V-type proton ATPase subunit C-like [Phoenix dactylifera]
Length=374

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNF+  ARERGFQIR+FEY+PE  ES K ELEKL+QDQE 
Sbjct  214  KLHEDNEYALYTVTLFVRVADNFKTSARERGFQIREFEYSPEAQESWKLELEKLLQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPP FL+ VL+PS K EK+VRSI
Sbjct  274  IRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPLFLAAVLAPSAKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + NST+WK+EDE  +   GG+AE +PYVSFTIN+V
Sbjct  334  LEELCGNVNSTFWKSEDEVGLAGLGGEAEAYPYVSFTINIV  374



>ref|XP_010458722.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDNEYALYTV LFTR ADNFR  ARERGFQ+RDFE++ E  E+RKQELEKL++DQE+ 
Sbjct  215  LFEDNEYALYTVVLFTRVADNFRTTARERGFQVRDFEHSVEAQETRKQELEKLVEDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESI+RYGLPP+FL+ VLSP+VKSEK+VR IL
Sbjct  275  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESIMRYGLPPAFLACVLSPAVKSEKKVRPIL  334

Query  387  ESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            E LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  335  ERLCDSTNSLYWKSEEDGGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_008654564.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85084.1| unknown [Zea mays]
 gb|ACG35170.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW81320.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE 
Sbjct  217  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  277  MRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC +++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  337  LEELCGNAHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  377



>ref|XP_008775427.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Phoenix 
dactylifera]
Length=374

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNF+  ARERGFQIR+FEY+PE+ E+RKQELEKL+QDQE 
Sbjct  214  KLHEDNEYALYTVTLFGRVADNFKTSARERGFQIREFEYSPESQENRKQELEKLLQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFS+WMHFCAVR+FAESILRYGLPP+FL+ VL+P  KSEK+VRSI
Sbjct  274  MRSSLLQWCYASYGEVFSAWMHFCAVRIFAESILRYGLPPAFLAAVLAPPAKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE L  ++NS +WK+EDE  +   GG+AE +PYVSFTIN+V
Sbjct  334  LEELGGNANSAFWKSEDEVGLAGIGGEAEAYPYVSFTINIV  374



>gb|KHN28568.1| V-type proton ATPase subunit C [Glycine soja]
Length=383

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 143/168 (85%), Gaps = 8/168 (5%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETHE+RKQEL+KL+QDQE 
Sbjct  215  KLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETHENRKQELDKLVQDQER  274

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  275  LRTSLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSI  334

Query  390  LESLCDSSN------STYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  271
            LE L DS+N        YWK EDE   G  G  GDA+ HPYVSFTINL
Sbjct  335  LEGLSDSTNRQVYDVRAYWKNEDEVGAGMAGLAGDADGHPYVSFTINL  382



>ref|XP_002441624.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
 gb|EES20054.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
Length=377

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+QDQE 
Sbjct  217  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLQDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  277  MRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC +++S YWK+ED+  +   GG+ E HPYVSFTIN V
Sbjct  337  LEELCGNAHSLYWKSEDDVGIAGLGGETEAHPYVSFTINFV  377



>gb|KEH23490.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=386

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 141/171 (82%), Gaps = 10/171 (6%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHE RKQEL+KLMQDQE+
Sbjct  216  KLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHEGRKQELDKLMQDQES  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlpps--------flsvvlspsvk  415
             R SLLQWCY SYGEVFSSWMHFCAVR+F+ESILRYGLPPS          + VL+PSVK
Sbjct  276  LRGSLLQWCYASYGEVFSSWMHFCAVRLFSESILRYGLPPSFLVLYSSRQEACVLAPSVK  335

Query  414  SEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  268
            +EK+VRSILE L DSSNS YWKT++E   G  G  G+A+ HPYVSFTINL+
Sbjct  336  AEKKVRSILEGLSDSSNSAYWKTDEEVGAGMAGLAGEADTHPYVSFTINLL  386



>ref|XP_006305100.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
 gb|EOA37998.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
Length=375

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDNEYALYTV LFTR ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL QDQE+ 
Sbjct  215  LFEDNEYALYTVVLFTRVADNFRTTAREKGFQVRDFEHSVEAQETRKQELEKLGQDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSIL
Sbjct  275  RSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSIL  334

Query  387  ESLCDSSNSTYWKTEDEGAVGA-FGGDAEVHPYVSFTINL  271
            E +CDS+NS YWK+E++GA  A   GD+E HPYVSFTINL
Sbjct  335  ERMCDSTNSLYWKSEEDGAAMAGLAGDSETHPYVSFTINL  374



>gb|ABD32569.1| V-ATPase subunit C [Medicago truncatula]
Length=382

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 142/167 (85%), Gaps = 6/167 (4%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHE RKQEL+KLMQDQE+
Sbjct  216  KLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHEGRKQELDKLMQDQES  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCY SYGEVFSSWMHFCAVR+F+ESILRYGLPPSFL+ VL+PSVK+EK+VRSI
Sbjct  276  LRGSLLQWCYASYGEVFSSWMHFCAVRLFSESILRYGLPPSFLACVLAPSVKAEKKVRSI  335

Query  390  LESLCDSSNS----TYWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  268
            LE L DSSN      YWKT++E   G  G  G+A+ HPYVSFTINL+
Sbjct  336  LEGLSDSSNRQLGIAYWKTDEEVGAGMAGLAGEADTHPYVSFTINLL  382



>gb|KGN50885.1| hypothetical protein Csa_5G312840 [Cucumis sativus]
Length=370

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNF+  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+
Sbjct  208  KLYEDNEYALYTVTLFNRVADNFKTSAREKGFQIREFEYSPEAQESRKQELEKLVQDQES  267

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRSSLLQW Y SY EVF SWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  268  FRSSLLQWSYASYAEVFISWMHFCAVRVFAESILRYGLPPSFLASVLAPSVKSEKKVRSI  327

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE  G +   GGD++ HPYVSFTINL
Sbjct  328  LEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL  369



>ref|XP_007161646.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
 gb|ESW33640.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
Length=376

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF+R  +N+R  ARE+GFQIRDFEY+ ETHE+RKQEL+KL+QDQE 
Sbjct  214  KLYEDNEYALYTVTLFSRVVENYRTSAREKGFQIRDFEYSQETHENRKQELDKLVQDQER  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWC+TSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  274  LRASLLQWCFTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLACVLAPSVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  271
            LE+L DS+NS YWK EDE   G  G  GD++ HPYVSFTINL
Sbjct  334  LEALSDSTNSAYWKIEDEVGAGMAGLAGDSDAHPYVSFTINL  375



>ref|XP_010250562.1| PREDICTED: V-type proton ATPase subunit C [Nelumbo nucifera]
Length=376

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTV LF   ADNF+   RE+GFQIR+FEY+PE  E R +E+E+LM+DQET
Sbjct  216  KLHEDNEYALYTVMLFGHVADNFKTSTREKGFQIREFEYSPEAQEGRNREMERLMEDQET  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPP FL+ VL+PS+KSEK+ RSI
Sbjct  276  LRGSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPLFLAAVLAPSIKSEKKARSI  335

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LCDS++S+YWK+EDEG +   G DA+ HPYVSFTIN+V
Sbjct  336  LEGLCDSTHSSYWKSEDEGGMAGLGCDADAHPYVSFTINIV  376



>ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus]
 ref|XP_004166274.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus]
Length=376

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNF+  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+
Sbjct  214  KLYEDNEYALYTVTLFNRVADNFKTSAREKGFQIREFEYSPEAQESRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRSSLLQW Y SY EVF SWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  274  FRSSLLQWSYASYAEVFISWMHFCAVRVFAESILRYGLPPSFLASVLAPSVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE  G +   GGD++ HPYVSFTINL
Sbjct  334  LEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL  375



>gb|EMT31457.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=259

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  98   KLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEV  157

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+I
Sbjct  158  MRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNI  217

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE LC ++NS+YW++ED+ G     GG+ E HPYVSFTIN V
Sbjct  218  LEGLCGNANSSYWRSEDDVGMAAGLGGETESHPYVSFTINFV  259



>ref|XP_011045798.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 143/176 (81%), Gaps = 15/176 (9%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKAR--------------ERGFQIRDFEYNPETHES  613
            KLYEDNEYALYTVTLF R ADNFR  AR              E+GFQIRDFEY+PE  ES
Sbjct  214  KLYEDNEYALYTVTLFKRVADNFRTNARVFKRVADNFRTNAREKGFQIRDFEYSPEAQES  273

Query  612  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  433
            RKQELE+L++DQE  RSSLLQWCYTSYGEVFSSWMHFCA+RVFAESILRYGLPPSFL+ V
Sbjct  274  RKQELERLVRDQENLRSSLLQWCYTSYGEVFSSWMHFCAIRVFAESILRYGLPPSFLACV  333

Query  432  lspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LSP+ KSEK+VRSILE  CD+SNST+WK+EDE G +   GGDA+ +PY SFTINLV
Sbjct  334  LSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEMGGIFGLGGDADTYPYPSFTINLV  389



>ref|XP_006655657.1| PREDICTED: V-type proton ATPase subunit C-like [Oryza brachyantha]
Length=377

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRK+EL+KL+QDQE 
Sbjct  217  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKEELDKLLQDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS K EK+VRSI
Sbjct  277  MRASLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSQKGEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + +S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  337  LEELCGNVHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  377



>ref|XP_003567787.1| PREDICTED: V-type proton ATPase subunit C [Brachypodium distachyon]
 gb|ACU01766.1| vacuolar ATP synthetase subunit C [Brachypodium distachyon]
Length=382

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +LYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  221  RLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEL  280

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPP+FLSVVL+PS KSEK+VR+I
Sbjct  281  MRTSLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPNFLSVVLAPSTKSEKKVRNI  340

Query  390  LESLCDSSNS-TYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC SSNS  YWK +D+  V   GGD E HPYVSFTIN V
Sbjct  341  LEGLCGSSNSNNYWKQDDDVGVAGLGGDTESHPYVSFTINFV  382



>ref|XP_008463120.1| PREDICTED: V-type proton ATPase subunit C [Cucumis melo]
Length=376

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNF+  ARE+GFQIR+FEY+PE  ESRKQELEKL+QDQE+
Sbjct  214  KLYEDNEYALYTVTLFNRVADNFKTSAREKGFQIREFEYSPEAQESRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRSSLLQW Y SY EVF SWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVKSEK+VRSI
Sbjct  274  FRSSLLQWSYASYAEVFISWMHFCAVRVFAESILRYGLPPSFLAFVLAPSVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NSTYWKTEDE  G +   GGD++ HPYVSFTINL
Sbjct  334  LEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL  375



>ref|XP_010096044.1| V-type proton ATPase subunit C [Morus notabilis]
 gb|EXB62850.1| V-type proton ATPase subunit C [Morus notabilis]
Length=384

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 141/170 (83%), Gaps = 10/170 (6%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  E+RKQELEKLM DQE+ 
Sbjct  215  LYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQETRKQELEKLMHDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RSSLLQWCYTSYGEVFSSWMHFCAVRVFAES+LRYGLPPSFLS VL+PSVK EK+VRSIL
Sbjct  275  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESVLRYGLPPSFLSCVLAPSVKREKKVRSIL  334

Query  387  ESLCDSSNS--------TYWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  268
            E LCD++N         T+WKT+DE   G  G  G+A+ HPYVSFTINLV
Sbjct  335  EGLCDNANRQVVELLSVTFWKTDDEAGGGIVGLTGEADAHPYVSFTINLV  384



>gb|KHG11234.1| V-type proton ATPase subunit C -like protein [Gossypium arboreum]
Length=328

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 136/161 (84%), Gaps = 8/161 (5%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+ 
Sbjct  174  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDM  233

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSI
Sbjct  234  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSI  293

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE        TYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  294  LE-------GTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  327



>ref|XP_006844509.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
 gb|ERN06184.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
Length=374

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTV LF + ADNFRI ARERGFQIRDFEY+PE  + R+QELEKL+QDQET
Sbjct  214  KLYEDNEYALYTVILFRKVADNFRISARERGFQIRDFEYSPEAQDKRQQELEKLLQDQET  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
               SLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSI
Sbjct  274  MSHSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLAAVLAPPTKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE  C S NS  WK+EDEG +    G+A+ +PYVSFTINL+
Sbjct  334  LEGHCGSRNSALWKSEDEGGLLGLVGEADAYPYVSFTINLI  374



>ref|XP_002512862.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
 gb|EEF49365.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
Length=376

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  E+RKQELE+LMQDQE+
Sbjct  214  KLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPEAQENRKQELEQLMQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FRSSLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+ VL+PSVK EK+VRSI
Sbjct  274  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPAFLACVLAPSVKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE L DS+NSTYWK+EDE  G + A GGDA+ HPYVSFTINL
Sbjct  334  LEGLSDSANSTYWKSEDEVGGGLAALGGDADAHPYVSFTINL  375



>gb|ABG23314.1| vacuolar proton-ATPase C subunit [Triticum aestivum]
Length=380

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  219  KLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEV  278

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+I
Sbjct  279  MRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNI  338

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE LC ++NS+YW++ED+ G     GG+AE HPYVSFTIN V
Sbjct  339  LEGLCGNANSSYWRSEDDVGMAAGLGGEAESHPYVSFTINFV  380



>ref|NP_001056500.1| Os05g0593100 [Oryza sativa Japonica Group]
 gb|AAT44305.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
 dbj|BAF18414.1| Os05g0593100 [Oryza sativa Japonica Group]
 dbj|BAG88149.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94456.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79794.1| hypothetical protein OsI_21221 [Oryza sativa Indica Group]
 gb|EEE64903.1| hypothetical protein OsJ_19763 [Oryza sativa Japonica Group]
Length=377

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+ E  ESRK+ELEKLMQDQE 
Sbjct  217  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSSEAQESRKEELEKLMQDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS K EK+VRSI
Sbjct  277  MRASLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSQKGEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + +S YWK+ED+  V   GG+ E HPYVSFTIN +
Sbjct  337  LEELCGNVHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFI  377



>ref|NP_001142247.1| uncharacterized protein LOC100274416 [Zea mays]
 gb|ACF87983.1| unknown [Zea mays]
 tpg|DAA59220.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=377

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +LYEDNEYALYT+TLF +  DNF+++ARE+GFQ+RDFEY+PE  ESRKQE+EKL+ +QE 
Sbjct  217  QLYEDNEYALYTITLFAKVVDNFKVRAREKGFQVRDFEYSPEAQESRKQEMEKLLLEQEV  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHFCAVR+F ESILRYGLPPSFLS VL+PS K EK+VRSI
Sbjct  277  MRTSLLQWCYASYSEVFSSWMHFCAVRIFVESILRYGLPPSFLSAVLAPSTKGEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE LC + +S YWK ED+ AV   GG++EVHPYVSFTIN V
Sbjct  337  LEDLCGNVHSIYWKGEDDVAVAGLGGESEVHPYVSFTINFV  377



>ref|XP_010556324.1| PREDICTED: V-type proton ATPase subunit C [Tarenaya hassleriana]
Length=377

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPEAQESRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPPSFLS VL+P+ K EK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPSFLSCVLAPTGKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKT---EDEGAVGAFGGDAEVHPYVSFTINL  271
            LE LCD++NSTYWK       G +   GGDAE HPYVSFTINL
Sbjct  334  LEGLCDAANSTYWKMEEEGGGGGMAGLGGDAEGHPYVSFTINL  376



>gb|EMS67397.1| V-type proton ATPase subunit C [Triticum urartu]
Length=374

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  213  KLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEV  272

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+I
Sbjct  273  MRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNI  332

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE LC ++NS+YW++ED+ G     GG+ E HPYVSFTIN V
Sbjct  333  LEGLCGNANSSYWRSEDDVGMAAGLGGETESHPYVSFTINFV  374



>gb|ACT34062.1| vacuolar ATP synthetase subunit C [Aegilops tauschii]
Length=380

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  219  KLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEV  278

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLSVVL+PS KSEK+VR+I
Sbjct  279  MRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLSVVLAPSTKSEKKVRNI  338

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  268
            LE LC ++NS+YW++ED+ G     GG+ E HPYVSFTIN V
Sbjct  339  LEGLCGNANSSYWRSEDDVGMAAGLGGETESHPYVSFTINFV  380



>ref|XP_006369829.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
 gb|ERP66398.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
Length=376

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  ESRKQELE+L++DQE+
Sbjct  214  KLHEDNEYALYTVTLFKRVADNFRTNAREKGFQIRDFEYSPEAQESRKQELERLVRDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSP+ KSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPTTKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            LE  CD+SNST+WK+EDE  G +   GG+A+ +PY SFTINLV
Sbjct  334  LEGFCDNSNSTHWKSEDEMGGGIFGLGGEADTYPYPSFTINLV  376



>emb|CDX71966.1| BnaC08g29080D [Brassica napus]
Length=378

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 145/164 (88%), Gaps = 4/164 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+E++    GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDAGAGGAMAGLAGDSETHPYVSFTINL  377



>ref|XP_009118052.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=378

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 145/164 (88%), Gaps = 4/164 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+E++    GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDAGAGGAMAGLAGDSETHPYVSFTINL  377



>gb|KFK43549.1| hypothetical protein AALP_AA1G141200 [Arabis alpina]
Length=376

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFRI ARE+G+Q+RDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLHEDNEYALYTVTLFTRVADNFRITAREKGYQVRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE +CDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  334  LERMCDSTNSLYWKSEEDAGAAMAGLAGDSETHPYVSFTINL  375



>emb|CDY21070.1| BnaA08g24550D [Brassica napus]
Length=376

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDGGAAIAGLAGDSETHPYVSFTINL  375



>ref|XP_011001967.1| PREDICTED: V-type proton ATPase subunit C [Populus euphratica]
Length=376

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  +RE+GFQIRD EY+ E  E+RKQELE+++QDQE+
Sbjct  214  KLYEDNEYALYTVTLFHRVADNFRTSSREKGFQIRDVEYSSEAQENRKQELERIVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSF++ VLSPS+KSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFMACVLSPSLKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            L+ L DSSNSTYWK+EDE  G +   GGDA+ HPYVS TINLV
Sbjct  334  LDGLGDSSNSTYWKSEDELVGGMMGLGGDADTHPYVSLTINLV  376



>ref|XP_009110617.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=376

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDGGAAMAGLAGDSETHPYVSFTINL  375



>ref|NP_001147632.1| LOC100281241 [Zea mays]
 gb|ACF83479.1| unknown [Zea mays]
 gb|ACG28176.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW79360.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQIRDFEY+PE  ESR QE+EKL++DQE 
Sbjct  217  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQIRDFEYSPEAQESRMQEMEKLLRDQEA  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS VL+PS KSEK+VRSI
Sbjct  277  MRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLSAVLAPSTKSEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            L+ L   ++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  337  LDELSGDAHSLYWKSEDDVGVAGLGGETEAHPYVSFTINFV  377



>ref|XP_010528136.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=376

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFGRAADNFRTSAREKGFQIRDFEYSPEAQESRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLS VL+PS K EK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLSCVLAPSSKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKT--EDEGAVGAFGGDAEVHPYVSFTINL  271
            +E L DS+NS YWK   E  G  G  GGDA+ HPYVSFTINL
Sbjct  334  IEGLSDSANSKYWKPEEEGGGMGGLGGGDADAHPYVSFTINL  375



>ref|XP_002889973.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66232.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
Length=378

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 146/164 (89%), Gaps = 4/164 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFRI ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNFRISAREKGFQVRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  271
            LE +CDS+NS YWK+E++    GA+    GD+E +PYVSFTINL
Sbjct  334  LERMCDSTNSLYWKSEEDAGAGGAMAGLAGDSETYPYVSFTINL  377



>ref|XP_010554131.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Tarenaya 
hassleriana]
Length=377

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQ RDFEY+PE  ESRKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFGRVADNFRTSAREKGFQTRDFEYSPEAQESRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPP+FLS VL+PS K EK+VRSI
Sbjct  274  MRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPAFLSCVLAPSTKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE---GAVGAFGGDAEVHPYVSFTINL  271
            LE  CD++NSTYWK E+E   G  G  GGD E +PYV FTINL
Sbjct  334  LEGSCDAANSTYWKVEEEAGGGMAGFGGGDTEAYPYVCFTINL  376



>emb|CDY66539.1| BnaCnng51300D [Brassica napus]
Length=376

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF+R ADN+R  ARE+GFQIRDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFSRVADNYRTSAREKGFQIRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDGGAAMAGLAGDSETHPYVSFTINL  375



>ref|XP_006373110.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50907.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=376

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  +R++GFQIRD E++ E  E+RKQELE+++QDQE+
Sbjct  214  KLYEDNEYALYTVTLFHRVADNFRTSSRDKGFQIRDIEHSSEAQENRKQELERIVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPS+K EK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSLKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  268
            L+ L DSSNSTYWK+EDE  G +   GGDA+ HPYVSFTINLV
Sbjct  334  LDGLGDSSNSTYWKSEDEVVGGMMGLGGDADTHPYVSFTINLV  376



>ref|XP_010554130.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Tarenaya 
hassleriana]
Length=426

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQ RDFEY+PE  ESRKQELEKL+QDQE+
Sbjct  263  KLFEDNEYALYTVTLFGRVADNFRTSAREKGFQTRDFEYSPEAQESRKQELEKLVQDQES  322

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPP+FLS VL+PS K EK+VRSI
Sbjct  323  MRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPAFLSCVLAPSTKGEKKVRSI  382

Query  390  LESLCDSSNSTYWKTEDE---GAVGAFGGDAEVHPYVSFTINL  271
            LE  CD++NSTYWK E+E   G  G  GGD E +PYV FTINL
Sbjct  383  LEGSCDAANSTYWKVEEEAGGGMAGFGGGDTEAYPYVCFTINL  425



>emb|CDY26596.1| BnaA09g46810D [Brassica napus]
Length=614

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 145/164 (88%), Gaps = 4/164 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  E+RKQELEKL+QDQE+
Sbjct  214  KLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQETRKQELEKLVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ VLSP+VKSEK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLACVLSPAVKSEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  271
            LE LCDS+NS YWK+E++    GA+    GD+E HPYVSFTINL
Sbjct  334  LERLCDSTNSLYWKSEEDAGAGGAMAGLAGDSETHPYVSFTINL  377



>gb|ADE77882.1| unknown [Picea sitchensis]
Length=379

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL EDNEYALY+VTLF + AD+FR+ ARE+GFQ+RDFEY+PE  E R+++LE+L+ DQET
Sbjct  217  KLQEDNEYALYSVTLFKKVADSFRVSAREKGFQVRDFEYDPEAQERRREDLERLISDQET  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R  L QWCY SYGEVFSSWMH CA+R+F ESILRYGLPPSFL+ VL+PS KSEK+VRSI
Sbjct  277  MRGGLQQWCYASYGEVFSSWMHLCAIRLFTESILRYGLPPSFLAAVLAPSSKSEKKVRSI  336

Query  390  LESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            LE L   SN+++WK ED+ G  G  GG+ EV+PYVSFTINL
Sbjct  337  LERLSGGSNNSFWKAEDDVGIAGLAGGETEVYPYVSFTINL  377



>gb|KJB76319.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=349

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+ 
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDM  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSI  333

Query  390  LESLCDSSNSTY  355
            LE LCDS+N  Y
Sbjct  334  LEGLCDSANRQY  345



>gb|KJB76320.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=345

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+ 
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDM  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPSVK EK+VRSI
Sbjct  274  LRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSVKGEKKVRSI  333

Query  390  LESLCDSSN  364
            LE LCDS+N
Sbjct  334  LEGLCDSAN  342



>ref|XP_006373109.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50906.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=366

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 133/161 (83%), Gaps = 8/161 (5%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  +R++GFQIRD E++ E  E+RKQELE+++QDQE+
Sbjct  214  KLYEDNEYALYTVTLFHRVADNFRTSSRDKGFQIRDIEHSSEAQENRKQELERIVQDQES  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VLSPS+K EK+VRSI
Sbjct  274  LRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLSPSLKGEKKVRSI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            L+ L D+        E  G +   GGDA+ HPYVSFTINLV
Sbjct  334  LDGLGDN--------EVVGGMMGLGGDADTHPYVSFTINLV  366



>gb|AGJ98217.1| DET3, partial [Petunia x hybrida]
Length=268

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            EDNEYALYTVTLF+RDADNF+IKARERGFQIRDFEY+PET ESRK ELEKLMQDQE FRS
Sbjct  151  EDNEYALYTVTLFSRDADNFKIKARERGFQIRDFEYDPETQESRKHELEKLMQDQEIFRS  210

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            S+ QWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLSVVL+PS KSEK+VRSIL
Sbjct  211  SVXQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLSVVLAPSTKSEKKVRSIL  268



>gb|AAO72561.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
Length=408

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+ E  ESRK+ELEKLMQDQE 
Sbjct  257  KLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSSEAQESRKEELEKLMQDQEA  316

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQWCY SY EVFSSWMHFC VRVF ESILRYGLPPSFLS VL+PS K EK+VRSI
Sbjct  317  MRASLLQWCYASYSEVFSSWMHFCLVRVFVESILRYGLPPSFLSAVLAPSQKGEKKVRSI  376

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGGDA  307
            L +   + +S YWK+ED+  V   GG A
Sbjct  377  LRNSVGNVHSIYWKSEDDVGVAGLGGKA  404



>gb|KJB40646.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=336

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = -3

Query  657  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  478
            + IRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAE
Sbjct  206  YVIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAE  265

Query  477  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEV  301
            SILRYGLPPSFL+ VLSPS K EK+VRSILE LCDS+NSTYWKTEDE GA+   GGDA+ 
Sbjct  266  SILRYGLPPSFLACVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEGGAMAGLGGDADT  325

Query  300  HPYVSFTINL  271
            +PYVSFTIN+
Sbjct  326  YPYVSFTINI  335



>gb|KCW64312.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=345

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +L+EDNEYALYTVTLF+R ADNFR  ARERGFQIRDFEYN E  E RKQELE+LM+DQE 
Sbjct  217  QLHEDNEYALYTVTLFSRVADNFRTTARERGFQIRDFEYNLEAQEGRKQELERLMRDQEN  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
            FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK EK+VRSI
Sbjct  277  FRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSI  336

Query  390  LESLCDSSN  364
            LE LCD+++
Sbjct  337  LEGLCDNTH  345



>ref|XP_010939292.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF+R ADNF+  ARERGFQIR+FEY+PE  ESRKQELEKL+QDQE 
Sbjct  214  KLHEDNEYALYTVTLFSRVADNFKTSARERGFQIREFEYSPEAQESRKQELEKLLQDQEN  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSLLQWCY SYGEVFS+WMHFCAVRVFAESILRYGLPPSFL+ VL+P  KSEK+VRSI
Sbjct  274  MRSSLLQWCYASYGEVFSAWMHFCAVRVFAESILRYGLPPSFLAAVLAPPAKSEKKVRSI  333

Query  390  LESLC  376
            LE L 
Sbjct  334  LEELS  338



>ref|XP_001773067.1| predicted protein [Physcomitrella patens]
 gb|EDQ62107.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGF-QIRDFEYNPETHESRKQELEKLMQDQE  574
            +L EDNEYAL+TVTLF + ADNF+   RERGF Q+RDFE +PE   S+++E+ KL +DQ+
Sbjct  216  RLTEDNEYALFTVTLFRKVADNFKTAGRERGFLQVRDFELDPEGQSSKQEEMAKLQKDQD  275

Query  573  TFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRS  394
              R SL QWCY  YGEVFS+WMH CA+R+F ESILRYGLPP FL+ VL+PS K+EK+VR 
Sbjct  276  ELRQSLQQWCYAVYGEVFSAWMHVCAIRLFTESILRYGLPPKFLAAVLAPSSKTEKKVRG  335

Query  393  ILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  271
            + E L   +NS +W +ED+ G +G  GGD+EVHPYVS T+NL
Sbjct  336  VCEKLSSGTNSLFWHSEDDAGMMGLAGGDSEVHPYVSLTVNL  377



>ref|XP_008775428.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Phoenix 
dactylifera]
Length=335

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  657  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  478
            + IR+FEY+PE+ E+RKQELEKL+QDQE  RSSLLQWCY SYGEVFS+WMHFCAVR+FAE
Sbjct  206  YVIREFEYSPESQENRKQELEKLLQDQENMRSSLLQWCYASYGEVFSAWMHFCAVRIFAE  265

Query  477  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVH  298
            SILRYGLPP+FL+ VL+P  KSEK+VRSILE L  ++NS +WK+EDE  +   GG+AE +
Sbjct  266  SILRYGLPPAFLAAVLAPPAKSEKKVRSILEELGGNANSAFWKSEDEVGLAGIGGEAEAY  325

Query  297  PYVSFTINLV  268
            PYVSFTIN+V
Sbjct  326  PYVSFTINIV  335



>gb|AFA36545.1| vacuolar ATP synthetase subunit C, partial [Lolium perenne]
Length=184

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  71   KLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEL  130

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG  460
             R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYG
Sbjct  131  MRTSLLQWCYASYSEVFSSWMHFCAVRVFVESILRYG  167



>ref|XP_010528980.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=169

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -3

Query  657  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  478
            FQIRDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAE
Sbjct  38   FQIRDFEYSPEAQESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAE  97

Query  477  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT--EDEGAVGAFGGDAE  304
            SILRYGLPPSFLS VL+PS K EK+VRSI+E L DS+NS YWK   E  G  G  GGDA+
Sbjct  98   SILRYGLPPSFLSCVLAPSSKGEKKVRSIIEGLSDSANSKYWKPEEEGGGMGGLGGGDAD  157

Query  303  VHPYVSFTINL  271
             HPYVSFTINL
Sbjct  158  AHPYVSFTINL  168



>ref|XP_002980160.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
 ref|XP_002992900.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ05989.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ19030.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
Length=380

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTV LF + ADNF+  ARERGFQ+RD E++PE  + R+QE +KL ++ ++
Sbjct  217  KLHEDNEYALYTVILFRKVADNFKSAARERGFQVRDIEFDPEGQQQRRQEQDKLSRELDS  276

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             RSSL QWC  SYGEVFS+WMH CA+R+FAESILRYGLPP FL+ V++PS ++EK+VRS+
Sbjct  277  LRSSLQQWCCASYGEVFSAWMHICAIRIFAESILRYGLPPKFLAAVMAPSQRNEKKVRSM  336

Query  390  LESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  271
            LE LC++ NS +WK++++  G  G  GG+ E HPYVSFT+NL
Sbjct  337  LEGLCNAPNSGFWKSDEDGGGVAGIVGGEVEAHPYVSFTLNL  378



>gb|EMT09400.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=377

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 8/162 (5%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +LYED+EYALYTVTLF +   NF+  A+E+GF IRDF Y+PE  ES K +LEKL+QD+E 
Sbjct  223  RLYEDDEYALYTVTLFAKVVGNFKAHAQEKGFLIRDFVYSPEAQES-KDDLEKLLQDEEA  281

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R+SLLQ  Y  Y EVFSSWMH CAV VFAESILRYGL PS L V+L+PS++SEK+VR I
Sbjct  282  MRTSLLQLLYARYSEVFSSWMHICAVFVFAESILRYGLSPSILCVILAPSMESEKKVRDI  341

Query  390  LESLCDSSNST-YWKTEDEGAVGAFGGDAEVHPYVSFTINLV  268
            LE  C ++NS  +WK++D+G     GG  E+HPYVS T+N+V
Sbjct  342  LEEHCGNANSNDFWKSDDDG----LGG--EIHPYVSSTMNVV  377



>ref|XP_010068642.1| PREDICTED: V-type proton ATPase subunit C-like [Eucalyptus grandis]
Length=329

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  651  IRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESI  472
            IRDFEYN E  E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESI
Sbjct  225  IRDFEYNLEAQEGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESI  284

Query  471  LRYGlppsflsvvlspsvkSEKRVRSILESLCDSSN  364
            LRYGLPPSFL+ VL+PSVK EK+VRSILE LCD+++
Sbjct  285  LRYGLPPSFLACVLAPSVKGEKKVRSILEGLCDNTH  320



>ref|XP_005651974.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27430.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
Length=372

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +Y+L++VTLF R AD+F+  AR +G+Q+RD+E++ E  E++ +  + L  + ++ 
Sbjct  212  IFEDQDYSLFSVTLFKRVADSFKAAARSKGYQVRDYEFDQELQENQSEAAKTLKANADSK  271

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            RS L QW  ++YGE FS+W+H CA+R+F ESILRYGLPP FL+V+L P+ K+  ++R +L
Sbjct  272  RSQLEQWSASAYGEAFSAWIHICAIRLFVESILRYGLPPKFLAVLLKPNQKNTTKLRKLL  331

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
             SL  SS ++ +   + GA G   G++E++PYVSFT+++
Sbjct  332  ASLFGSSGTSQYFDGEAGATGGLAGESEMYPYVSFTVSV  370



>gb|KJB40647.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=323

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  ESRKQELEKL+QDQ++
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQESRKQELEKLVQDQDS  273

Query  570  FRSSLLQWCYTSYGEVFSSWM  508
             RSSLLQWCYTSYGE+  +++
Sbjct  274  LRSSLLQWCYTSYGELLDAFL  294



>gb|KDO47363.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47364.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47365.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=303

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDNEYALYTVTLF R ADNFRI ARE+GFQIRDFEY+ E  ESR QELEKL+ DQE+ 
Sbjct  215  LYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSSEAQESRNQELEKLVHDQESL  274

Query  567  RSSLLQWCYTSYGEVFSSWMH  505
            RSSLLQWCYTSYGEV S+++H
Sbjct  275  RSSLLQWCYTSYGEVCSTFLH  295



>gb|EPS62747.1| hypothetical protein M569_12043, partial [Genlisea aurea]
Length=310

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLFTRDADNFR KARER +QIRDFEYN ET ESRKQELEKL+QDQ+ 
Sbjct  235  KLHEDNEYALYTVTLFTRDADNFRTKARERNYQIRDFEYNSETQESRKQELEKLVQDQDA  294

Query  570  FRSSLLQWCYTSYGEV  523
             R+ LLQWCY SYGEV
Sbjct  295  LRTGLLQWCYASYGEV  310



>ref|XP_010663792.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Vitis vinifera]
Length=319

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVT+F R ADNF+  ARERGFQIRDFEY+PET ESRKQELEKLM DQ+T
Sbjct  214  KLHEDNEYALYTVTIFGRVADNFKTSARERGFQIRDFEYSPETQESRKQELEKLMLDQDT  273

Query  570  FRSSLLQWCYTSYGEVFS  517
             R+SLLQWCYTSYGE F+
Sbjct  274  IRTSLLQWCYTSYGEEFA  291



>gb|KJB76317.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=323

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  ESRKQELEKL+QDQ+ 
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQESRKQELEKLVQDQDM  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  478
             RSSLLQWCY SYGE+  + +  C  R+  E
Sbjct  274  LRSSLLQWCYASYGELLDALL--CCTRLCRE  302



>ref|XP_008341246.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C-like [Malus domestica]
Length=299

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  ESRKQELEKL+QDQE 
Sbjct  214  KLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQESRKQELEKLVQDQEN  273

Query  570  FRSSLLQWCYTSYGEVF  520
             R SLLQWCYTSYGEV 
Sbjct  274  LRGSLLQWCYTSYGEVI  290



>sp|Q9SCB9.1|VATC_HORVU RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Hordeum 
vulgare]
 emb|CAB65127.1| vacuolar H+-ATPase subunit C [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            KLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  ESRKQELEKL+QDQE 
Sbjct  219  KLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEV  278

Query  570  FRSS-LLQWCYTSYGEVFSSWMHF-CAVRVFAESILRYG  460
             R+S +      +   VFSSW  F  AVRVF ESILRYG
Sbjct  279  MRTSPIAMGAMLATVRVFSSWDAFSSAVRVFVESILRYG  317



>gb|ADI46924.1| ATPvC1m [Volvox carteri f. nagariensis]
Length=376

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 104/160 (65%), Gaps = 4/160 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNP--ETHESRKQELEKLMQDQE  574
            + EDN+Y L +V LF R  D+F+  AR +G+Q+R  EYNP  E  E    + E+L +D E
Sbjct  211  IAEDNDYTLVSVVLFKRVVDDFKAAARIKGYQVR--EYNPPAEGMELSLMQTEQLKRDVE  268

Query  573  TFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRS  394
              R+++  WC T+YGEVFS +MH   VR+F ESILRYGLPP+F + VL P  K+E R+R+
Sbjct  269  QRRAAVEHWCKTAYGEVFSCYMHILVVRLFVESILRYGLPPTFQAAVLQPQEKAESRLRA  328

Query  393  ILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
             LE+     N+ YWK +D        GDA++HPYVS TIN
Sbjct  329  ELEATFGGGNTHYWKDDDTILGNGLIGDADLHPYVSLTIN  368



>ref|XP_002954527.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
 gb|ADI46857.1| ATPvC1f [Volvox carteri f. nagariensis]
 gb|EFJ44420.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
Length=376

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNP--ETHESRKQELEKLMQDQETF  568
            EDN+YAL TV LF R  D+F+  AR +G+Q+R  EYNP  E  E    ++E+L  D E  
Sbjct  213  EDNDYALVTVVLFKRVIDDFKAAARTKGYQVR--EYNPPAEGAELSLAQIEQLKHDMEQK  270

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            ++ + QWC T+Y EVFS +MH   V++F ESILRYGLPP+F + V+ P  K+E R+R+ L
Sbjct  271  KTDVEQWCKTAYSEVFSCYMHMLVVQLFVESILRYGLPPNFQAAVVRPQDKAEGRLRAEL  330

Query  387  ESLCDSSNSTYWKTEDEGAVGA-FGGDAEVHPYVSFTINL  271
            E+   S  + YW+ +D  ++GA   GDAE+HPYVS T+N+
Sbjct  331  EATFGSGKTHYWR-DDGSSLGAGLVGDAELHPYVSLTVNM  369



>ref|XP_002503957.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO65215.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=375

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED EYALYTVTLF R  D F   ARE  FQ+R+F  + E  +++  E   L +D +  
Sbjct  223  INEDGEYALYTVTLFRRVVDAFNTAARENSFQVREFSLDTEAVQAKIAERNDLERDIKER  282

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            R+S+ QWC TSYGE F +W+H CA+R+F ESILRYGLPPSF + V+ P  +SEK++R IL
Sbjct  283  RTSMFQWCQTSYGEAFGAWVHVCAIRLFVESILRYGLPPSFQACVMKPQKRSEKKLRGIL  342

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
             +      S++W   D+          E  PYVSF+I +
Sbjct  343  ANTFGQGASSHWSNSDDDK------GEEAFPYVSFSIEI  375



>ref|XP_001696429.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
 gb|EDP08406.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
Length=373

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + EDN+Y+L +V LF R  D+F+  AR +G+Q+R++    E  E    + E+L +D E  
Sbjct  211  ISEDNDYSLVSVVLFKRVLDDFKAAARSKGYQVREYHAPTEGSELTTAQAEQLKKDVEQK  270

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            +++L QWC T+YGE FS +MH   VR+F ESILRYGLPPSF + V+ P  KSE R+R  L
Sbjct  271  KNALEQWCKTAYGEAFSCYMHVLVVRLFVESILRYGLPPSFQAAVVRPQDKSEARLRLEL  330

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
            E+      + YWK +         GD E++PYVS T++
Sbjct  331  ETTFGGGKAHYWKDDGSNLGAGLAGDTELYPYVSLTLS  368



>ref|XP_005847214.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
 gb|EFN55112.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
Length=367

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 9/158 (6%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQ-IRDFEYNPETHESRKQELEKLMQDQETFR  565
            ED +Y  +TV LF R  DNF+  AR +GFQ ++D + +PE   S + EL ++  + E  R
Sbjct  216  EDQDYQAFTVVLFRRVVDNFKTAARGKGFQQVKDLKVDPEAARSSEAELARVRTEVEQRR  275

Query  564  SSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILE  385
             SL QWC TSYGE FSSW+H CAVR+F ESILRYGLPP FLSV++ P+ K   ++R ++ 
Sbjct  276  VSLEQWCITSYGEAFSSWIHVCAVRLFVESILRYGLPPKFLSVLMRPNAKYTAKLRKLMA  335

Query  384  SLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
                 + S ++  E        G   ++ PYVSFT+N+
Sbjct  336  HSFSHTGSDHFSAE--------GAGEDMFPYVSFTLNI  365



>gb|KJB40645.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=387

 Score =   115 bits (287),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 69/127 (54%), Gaps = 51/127 (40%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQ---------------------------  652
            KLYEDNEYALYTVTLF R ADNFR  ARERGFQ                           
Sbjct  214  KLYEDNEYALYTVTLFGRVADNFRTSARERGFQVSAFDGCICIFYMSKISLGYSYAWSWC  273

Query  651  ------------------------IRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWC  544
                                    IRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWC
Sbjct  274  IENVLLSWRISYSRCCRISFGVIQIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWC  333

Query  543  YTSYGEV  523
            YTSYGEV
Sbjct  334  YTSYGEV  340


 Score = 37.0 bits (84),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -1

Query  527  RFSAPGCTFVLYVSLLKAF  471
            RFSAPGC FVLYVSL +AF
Sbjct  369  RFSAPGCIFVLYVSLQRAF  387



>gb|KCW64318.1| hypothetical protein EUGRSUZ_G01948 [Eucalyptus grandis]
Length=84

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  588  MQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSE  409
            M+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+ VL+PSVK E
Sbjct  1    MRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGE  60

Query  408  KRVRSILESLCDSSN  364
            K+VRSILE LCD+++
Sbjct  61   KKVRSILEGLCDNTH  75



>ref|XP_001756840.1| predicted protein [Physcomitrella patens]
 gb|EDQ78437.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 105/176 (60%), Gaps = 17/176 (10%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPET-HESRKQELEKLMQDQET  571
            L+ED +Y +YTV +F    ++F   A  + FQ+R    +P   H + + ELE   ++   
Sbjct  214  LHEDTDYLIYTVIVFRHVVESFTNAAGLKNFQVRTLTRDPNGGHFAYRAELEHWQEEHGK  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
             R +LL WCY ++GEVFS+W+H CA+R+F ES+LRYGLPP+FL+VVL+P  K+E +V  +
Sbjct  274  KRHALLHWCYATFGEVFSAWVHLCAIRIFVESVLRYGLPPAFLAVVLAPRQKNESKVCRM  333

Query  390  LESLCDSS---------------NSTYWKTEDEGAVGAFGGDA-EVHPYVSFTINL  271
            LE     +               +  +W TE++ +V +  GD  E HPYVS T+N+
Sbjct  334  LEHFSGGTMRWVTVNHSFHVKIGSGKFWATEEDPSVASLAGDGIESHPYVSLTLNI  389



>ref|XP_009051892.1| hypothetical protein LOTGIDRAFT_206255 [Lottia gigantea]
 gb|ESO97287.1| hypothetical protein LOTGIDRAFT_206255 [Lottia gigantea]
Length=383

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 101/162 (62%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            K+++DNE  L TVTLF R  D F+   RE  F +RDF Y+ E  +S K EL KL  D++ 
Sbjct  216  KIFDDNENVLVTVTLFKRVVDEFKHHCRENKFSVRDFTYSEEEIQSGKTELTKLEADKKK  275

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                L++W   ++GE F++W+H  A+RVF ES+LRYGLP +F ++V+ PS +S KR+R +
Sbjct  276  QFGPLVKWLKVNFGECFAAWLHVKALRVFVESVLRYGLPVNFQAMVVQPSKRSTKRLRDV  335

Query  390  LESL-CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L+ L     NS   +  DE  +   G G +E +PYVS+ + L
Sbjct  336  LKQLYSHLDNSALQQGTDEVDIPGIGLGGSEYYPYVSYKMTL  377



>ref|XP_001814187.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Tribolium 
castaneum]
 ref|XP_008195427.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Tribolium 
castaneum]
Length=386

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DNEY LYTV+LF +  + F++ ARER F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  ITQDNEYGLYTVSLFKKVVEEFKLHARERKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKTMKRLRDVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS +      D   +   G G +E +PYV + IN+
Sbjct  336  NQLYGHLDSSAAISGSNADSVDIPGLGFGQSEYYPYVYYKINV  378



>ref|XP_008195426.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Tribolium 
castaneum]
Length=401

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DNEY LYTV+LF +  + F++ ARER F +RDF YN E   + K E+ KL+ D++  
Sbjct  231  ITQDNEYGLYTVSLFKKVVEEFKLHARERKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  290

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  291  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKTMKRLRDVL  350

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS +      D   +   G G +E +PYV + IN+
Sbjct  351  NQLYGHLDSSAAISGSNADSVDIPGLGFGQSEYYPYVYYKINV  393



>ref|XP_007513767.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
 emb|CCO16292.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
Length=433

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 107/170 (63%), Gaps = 11/170 (6%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARER--GFQIRDFEYNPETHESRKQELEKLMQDQE  574
            L E+N+Y+L+TVTLF R  D+F+   RE+   FQ+R++ Y+ +     K+E + L ++ E
Sbjct  264  LKEENDYSLFTVTLFRRTVDSFKNAVREKNGAFQVREYSYDKDKITENKEEKQSLEEEVE  323

Query  573  TFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRS  394
            T R+ L +WC TSYGEV SSW+H   VR+F ESILRYGLPP+F +V++ P  + EK++RS
Sbjct  324  TRRNELYEWCQTSYGEVVSSWIHVVVVRLFVESILRYGLPPAFQAVIMRPKERLEKKLRS  383

Query  393  ILESLCDSSNSTYWKTEDEGAVGAFGGDAEVH---------PYVSFTINL  271
            ++ +   + +S++W   + G     GG   +          PYVSFT+ L
Sbjct  384  VMNAAFGNGSSSHWSATESGGGSGGGGGDGLGGERGGDDCFPYVSFTVTL  433



>gb|AIJ50380.1| V-ATPase subunit C [Pectinophora gossypiella]
Length=382

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +Y+DN+Y LY+VTLF + AD F++ ARER F +R+F YN     + K E+ KL+ D++  
Sbjct  215  IYQDNDYGLYSVTLFKKVADEFKLHARERKFVVREFSYNEADLAAGKNEITKLVTDKKKQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F + VL PS KS K++R +L
Sbjct  275  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAAVLVPSRKSMKKLRDVL  334

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
             SL    D S +   + E     G   G +E  PYV + IN+
Sbjct  335  HSLYAHLDHSANAGAQAEGAELAGLGFGQSEYFPYVFYKINI  376



>gb|EFA06700.1| hypothetical protein TcasGA2_TC009631 [Tribolium castaneum]
Length=444

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DNEY LYTV+LF +  + F++ ARER F +RDF YN E   + K E+ KL+ D++  
Sbjct  274  ITQDNEYGLYTVSLFKKVVEEFKLHARERKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  333

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  334  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKTMKRLRDVL  393

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS +      D   +   G G +E +PYV + IN+
Sbjct  394  NQLYGHLDSSAAISGSNADSVDIPGLGFGQSEYYPYVYYKINV  436



>emb|CCD60515.1| subfamily S1B unassigned peptidase (S01 family) [Schistosoma 
mansoni]
Length=330

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 102/162 (63%), Gaps = 4/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +  L+TVTLF +  D+F+ +ARE  F +RDF Y+ +  E  + EL KL  D++  
Sbjct  164  IFEDQDNGLWTVTLFKKMTDDFKTQAREFRFVVRDFTYDEKKIEESRNELSKLESDKKRQ  223

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +++L P+ K +K++R IL
Sbjct  224  FAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDIL  283

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            + L    D S+S+    ED   VG FG  ++  PYVSF + L
Sbjct  284  KQLYNHLDGSSSSSVLDEDMN-VGGFGTSSDYFPYVSFKVEL  324



>ref|XP_011399399.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
 gb|KFM26467.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
Length=374

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 97/157 (62%), Gaps = 7/157 (4%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            ED+EY++ +V LF R  D+F+  AR +G+Q ++   + E+ ++ ++ LEKL    E  RS
Sbjct  222  EDSEYSVVSVVLFRRVVDDFKAAARAKGYQAKEITSDAESQKANEEGLEKLRAAVEVKRS  281

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
                WC TSY E FS+W+H  AVR+F ESILRYGLPP FL V++ P+ K+  ++R +L S
Sbjct  282  EFEAWCLTSYSEAFSAWIHILAVRLFVESILRYGLPPQFLPVLMRPNPKAVAKLRKLLAS  341

Query  381  LCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
                    ++  E        G D+++ PYVSFT+N+
Sbjct  342  KYSGVGGQFFSNES-------GADSDLFPYVSFTLNI  371



>gb|ABF18462.1| V-ATPase C subunit [Aedes aegypti]
Length=364

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  195  ITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQ  254

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  255  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVL  314

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    D S ++     D   +   G G +E +PYV + +N+
Sbjct  315  MQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYYPYVYYKLNI  357



>ref|XP_009012372.1| hypothetical protein HELRODRAFT_156435 [Helobdella robusta]
 gb|ESO09279.1| hypothetical protein HELRODRAFT_156435 [Helobdella robusta]
Length=400

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 98/160 (61%), Gaps = 3/160 (2%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            ED+E+ L+TVTLF +  + F++K RE  F +RDFEYN +  E  K+E+ KL  D+     
Sbjct  233  EDSEHCLFTVTLFRKVVEEFKLKCRENKFVVRDFEYNEQEMEDGKKEIMKLNTDKAKQEG  292

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W  T++ E FS W+H  A+R F ESILRYGLP +F ++V++P  ++ K+++ +L  
Sbjct  293  PLIRWLKTNFTETFSGWLHVKALRTFIESILRYGLPVNFQAMVIAPPKRNMKKIKELLNQ  352

Query  381  ---LCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
                 D+S +   KTE +   G      E +PYV F INL
Sbjct  353  HYLHLDASGTYDAKTEMDDIPGFTMSSVEYYPYVYFKINL  392



>ref|XP_001201267.2| PREDICTED: V-type proton ATPase subunit C-like [Strongylocentrotus 
purpuratus]
Length=383

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +YEDN++ LY+VTLF +  D +++ ARE  F +R+F YN E   + K EL KL  D++  
Sbjct  216  IYEDNDHGLYSVTLFKKVVDEYKLHARENKFMVREFTYNEEELNAGKSELNKLAADKKRQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F  ++L P  K++K+++ +L
Sbjct  276  YGPLVRWLKINFSEAFQAWVHVKALRVFVESVLRYGLPVNFQPMILQPYKKTQKKLKEVL  335

Query  387  ESLCDSSNSTYWKTEDEGAVGAFG-----GDAEVHPYVSFTINL  271
             +L    + +   T+D   V AF       + E  PYV + I +
Sbjct  336  NTLYGHLDGSNINTKDAKGVPAFDMPGLMSNTEYFPYVFYPIQI  379



>gb|KDR10550.1| V-type proton ATPase subunit C [Zootermopsis nevadensis]
Length=385

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +D++Y L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++    
Sbjct  218  QDSDYGLFTVTLFKKVVDEFKLHAREKKFVVRDFTYNEEELAAGKNEITKLVTDKKKQFG  277

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L  
Sbjct  278  PLVRWLKVNFSECFCAWVHVKALRVFVESVLRYGLPVNFQAMLLHPNKKNTKRLRDVLNQ  337

Query  381  L---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L    DSS      + D   +   G G +E  PYV + IN+
Sbjct  338  LYGHLDSSAVQGSASHDSVDIPGLGFGQSEYFPYVYYKINV  378



>gb|KFB48532.1| AGAP005845-PA-like protein [Anopheles sinensis]
Length=385

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D++YAL  VTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  216  IMQDSDYALVNVTLFKKVVDEFKLHARERKFVVREFVYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKSTKRLRDVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            + L    D S S+     D   +   G G +E  PYV + +N+
Sbjct  336  QQLYGHLDGSGSSAGGNADNVDIPGLGFGQSEYFPYVYYKLNI  378



>ref|XP_011305233.1| PREDICTED: V-type proton ATPase subunit C [Fopius arisanus]
 ref|XP_011305235.1| PREDICTED: V-type proton ATPase subunit C [Fopius arisanus]
Length=386

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 102/164 (62%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+TVTLF + A+ F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  ITQDSEYGLFTVTLFKKVAEEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPNKKNTKRLRDVL  335

Query  387  ESL---CDSSNS-TYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS S      +D   +   G G  E +PYV + IN+
Sbjct  336  NQLYAHLDSSASGAGGGNQDSMDIPGLGFGQNEYYPYVYYKINV  379



>ref|XP_001843335.1| vacuolar ATP synthase subunit C [Culex quinquefasciatus]
 gb|EDS32198.1| vacuolar ATP synthase subunit C [Culex quinquefasciatus]
Length=528

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  359  ITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQ  418

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  419  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVL  478

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    D S ++     D   +   G G +E +PYV + +N+
Sbjct  479  NQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYYPYVYYKLNI  521



>ref|XP_002585525.1| hypothetical protein BRAFLDRAFT_60009 [Branchiostoma floridae]
 ref|XP_002588498.1| hypothetical protein BRAFLDRAFT_63445 [Branchiostoma floridae]
 gb|EEN41536.1| hypothetical protein BRAFLDRAFT_60009 [Branchiostoma floridae]
 gb|EEN44509.1| hypothetical protein BRAFLDRAFT_63445 [Branchiostoma floridae]
Length=394

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 93/170 (55%), Gaps = 11/170 (6%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            K+YEDN++ L+TVT+FTR  D ++  ARE  F +R+F+YN E   + K EL KL  D++ 
Sbjct  215  KIYEDNDHGLFTVTMFTRVVDEYKHHARENRFVVREFQYNEEEMTAGKNELSKLASDKKK  274

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG------lppsflsvvlspsvkSE  409
                L++W   ++ E F++W+H  A+RVF ES+LRYG                  + K  
Sbjct  275  QFGPLVRWLKVNFSEAFTAWIHVKALRVFVESVLRYGLPVNFQAMLLQPMNKKPLNKKVH  334

Query  408  KRVRSILESLCDSSNSTYWKTED-----EGAVGAFGGDAEVHPYVSFTIN  274
            +++R  L+ L    +S+ +  +D      G  G   G  E +PYV ++IN
Sbjct  335  RKLRDSLQQLYGHLDSSSFAVDDLPMDIPGLSGMNIGQGEYYPYVYYSIN  384



>emb|CAX70572.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
 emb|CAX70573.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
Length=347

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 102/162 (63%), Gaps = 4/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +  L+TVTLF +  D+F+ +ARE  F +RDF Y+ +  E  + EL KL  D++  
Sbjct  181  IFEDQDNGLWTVTLFKKMMDDFKTQAREHRFVVRDFIYDEKKIEEGRNELSKLESDKKRQ  240

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +++L P+ K +K++R +L
Sbjct  241  FAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDVL  300

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            + L    D S+S+    ED   VG FG  ++  PYVSF + L
Sbjct  301  KQLYSHLDGSSSSSIIDEDVN-VGNFGASSDYFPYVSFKVEL  341



>ref|XP_008480724.1| PREDICTED: V-type proton ATPase subunit C [Diaphorina citri]
Length=410

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +D ++ALYTVTLF +  D FR  ARE+ F +R+F YN E   + K E+ KL+ D++    
Sbjct  242  QDQDFALYTVTLFKKVQDEFRHHAREKKFIVREFVYNEEELAAGKNEITKLVTDKKKQFG  301

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L+ 
Sbjct  302  PLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAMLLHPNKKNTKRLRDVLQQ  361

Query  381  L---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L    DSS     +  D   +   G G A+  PYV + IN+
Sbjct  362  LYGHLDSSAQGGSQHHDSVEIPGLGFGQADYFPYVYYKINI  402



>gb|ENN78483.1| hypothetical protein YQE_05047, partial [Dendroctonus ponderosae]
Length=319

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 95/161 (59%), Gaps = 4/161 (2%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +DNE+ LYTVTLF +  D F+  ARER F +RDF Y+ E   + K E+ KL  D++    
Sbjct  151  QDNEFGLYTVTLFKKVIDEFKHHARERKFIVRDFTYDEEQLAAGKNEITKLATDKKKQFG  210

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P  K+ KR+R +L  
Sbjct  211  PLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPHKKTMKRLRDVLNQ  270

Query  381  L---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L    D S        D   +   G G +E +PYV + +N+
Sbjct  271  LYGHLDGSVGHQGANMDNVDIPGLGFGQSEYYPYVYYKLNV  311



>ref|XP_002423137.1| vacuolar ATP synthase subunit C, putative [Pediculus humanus 
corporis]
 gb|EEB10399.1| vacuolar ATP synthase subunit C, putative [Pediculus humanus 
corporis]
Length=495

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +DN+Y L+TVTLF +  + F++ ARE+ F +R+F YN E   + K E+ KL+ D++    
Sbjct  328  QDNDYGLFTVTLFKKVVEEFKLHAREKKFVVREFTYNEEEMAAGKNEITKLVLDKKKQFG  387

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R IL  
Sbjct  388  PLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKNTKRLREILNQ  447

Query  381  L---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L    DSS       +D   +   G G A+  PYV + IN+
Sbjct  448  LYGHLDSSALQGSGHQDSVDIPGLGFGQADYFPYVYYKINI  488



>emb|CAX70571.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
 emb|CAX75463.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
Length=384

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 102/162 (63%), Gaps = 4/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +  L+TVTLF +  D+F+ +ARE  F +RDF Y+ +  E  + EL KL  D++  
Sbjct  218  IFEDQDNGLWTVTLFKKMMDDFKTQAREHRFVVRDFIYDEKKIEEGRNELSKLESDKKRQ  277

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +++L P+ K +K++R +L
Sbjct  278  FAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDVL  337

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            + L    D S+S+    ED   VG FG  ++  PYVSF + L
Sbjct  338  KQLYSHLDGSSSSSIIDEDVN-VGNFGASSDYFPYVSFKVEL  378



>ref|XP_003389520.1| PREDICTED: V-type proton ATPase subunit C 1-B-like [Amphimedon 
queenslandica]
Length=386

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 98/161 (61%), Gaps = 4/161 (2%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            ED EY L+TVT+F +  D F+++ARE+ F +R++E++P+  E+ ++E EKL +D +    
Sbjct  221  EDQEYGLFTVTVFKKIVDEFKLQAREKRFAVREYEHDPQALEAERKEKEKLERDLKRQFG  280

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L+ W   ++ +VFS+W+H  A+RVF+ESILRYGL  + +S+VL P  +S K V   L  
Sbjct  281  PLMNWLKVNFSQVFSAWLHLKALRVFSESILRYGLDSNCVSLVLKPHRRSAKSVHQALND  340

Query  381  L---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
                 DS      K +D   +   G   AE +PYV F +NL
Sbjct  341  KYYHLDSMPLKGSKGDDHIDIPGLGLNQAEYYPYVFFKMNL  381



>ref|XP_001650489.1| AAEL005173-PA [Aedes aegypti]
 gb|EAT43366.1| AAEL005173-PA [Aedes aegypti]
Length=695

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  526  ITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQ  585

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  586  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVL  645

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    D S ++     D   +   G G +E +PYV + +N+
Sbjct  646  MQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYYPYVYYKLNI  688



>dbj|BAM20425.1| vacuolar H[+] ATPase 44kD C subunit [Papilio polytes]
Length=385

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 100/164 (61%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ DN+Y L+TVTLF +  D F++ ARER F +R+F YN     + K E+ KL+ D++  
Sbjct  215  IHHDNDYGLFTVTLFKKVVDEFKLHARERKFVVREFSYNEADLAAGKNEITKLVTDKKKQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F + V+ P+ KS K++R +L
Sbjct  275  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAAVVVPARKSMKKLRDVL  334

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            + L      S++  + +  +   +   G G +E  PYV + IN+
Sbjct  335  QQLYAHLDHSAHQGHGQASENVEIAGLGFGQSEYFPYVFYKINI  378



>ref|XP_004993351.1| hypothetical protein PTSG_05481 [Salpingoeca rosetta]
 gb|EGD73788.1| hypothetical protein PTSG_05481 [Salpingoeca rosetta]
Length=373

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED+EY L++VTLF R AD+FR  ARE+ F +RDFE++ ET   ++ +   L  + +  
Sbjct  209  IHEDSEYGLFSVTLFRRIADDFRAAAREKKFTVRDFEFDEETVAQQEADTTHLANEFKEK  268

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L+ W   S+ + F++WMH  A+R+F ES+LRYGLPP F    +S     EKR+R+ L
Sbjct  269  HARLMDWLQLSFDQCFTAWMHLKALRLFVESVLRYGLPPKFSFYAVSFKPDEEKRMRTAL  328

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            + L    D + +   +  D    G F G  E  PYVSF++ L
Sbjct  329  QRLYGHLDKAGAEAGEVAD--VPGLFQG--EYFPYVSFSVRL  366



>gb|ERL87116.1| hypothetical protein D910_04516 [Dendroctonus ponderosae]
Length=386

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 96/163 (59%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DNE+ LYTVTLF +  D F+  ARER F +RDF Y+ E   + K E+ KL  D++  
Sbjct  216  ITQDNEFGLYTVTLFKKVIDEFKHHARERKFIVRDFTYDEEQLAAGKNEITKLATDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P  K+ KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPHKKTMKRLRDVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    D S        D   +   G G +E +PYV + +N+
Sbjct  336  NQLYGHLDGSVGHQGANMDNVDIPGLGFGQSEYYPYVYYKLNV  378



>ref|NP_001023451.1| Protein VHA-11, isoform a [Caenorhabditis elegans]
 sp|Q9XXU9.1|VATC_CAEEL RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Caenorhabditis 
elegans]
 dbj|BAA75067.1| Vha11 protein [Caenorhabditis elegans]
 emb|CCD66967.1| VHA-11, isoform a [Caenorhabditis elegans]
Length=384

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ ET ++ + E +KLM +++  
Sbjct  218  LTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKAGRTERDKLMAEKQRQ  277

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V+ P+   +K++R  L
Sbjct  278  YAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQEL  337

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  338  HKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  379



>ref|XP_006012217.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Latimeria chalumnae]
 ref|XP_006012218.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Latimeria chalumnae]
Length=381

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 102/162 (63%), Gaps = 4/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED +  L+TVTLF +  D F++KARE  F +R+F +N +  +S K+EL +L  D++  
Sbjct  215  ITEDADGGLFTVTLFKKAVDEFKVKARENKFMVREFTFNEQELQSEKEELTRLAADKKQQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               LL+W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ KS  R+R +L
Sbjct  275  YGPLLRWLKVNFSEAFIAWIHLKALRVFVESVLRYGLPVNFQAMLLQPNKKSINRLRDVL  334

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
             +L    D + +++  T+ +   G   G+ E +PYV F I+L
Sbjct  335  NALYKHLDGAAASFSDTKID-IPGLNVGNQEYYPYVYFRIDL  375



>ref|XP_006626108.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=381

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 101/163 (62%), Gaps = 3/163 (2%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            K+ ED+E  L+TVTLF +   +FRIKARE  F +R+F +N    ++ K+E+ +L  D++ 
Sbjct  214  KIMEDSEGGLFTVTLFKKAVSDFRIKARENKFTVREFSFNETELQAEKEEMTRLAADKKQ  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                LL+W   ++ E F++W+H  A+RVF ES+LRYGLP +F +++L PS K+ KR+R I
Sbjct  274  QFGPLLRWLKVNFSEAFTAWIHVKALRVFVESVLRYGLPVNFQAILLQPSKKNSKRLREI  333

Query  390  LESLCDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTINL  271
            L SL    +     ++ +  V   G    + E + YV FTI++
Sbjct  334  LNSLYKHLDGVAASSKLDAGVDLPGLGLSNQEYYCYVYFTIDV  376



>ref|NP_958479.1| V-type proton ATPase subunit C 1-A [Danio rerio]
 sp|Q7T385.1|VTC1A_DANRE RecName: Full=V-type proton ATPase subunit C 1-A; Short=V-ATPase 
subunit C 1-A; AltName: Full=Vacuolar proton pump subunit 
C 1-A [Danio rerio]
 gb|AAH53214.1| ATPase, H+ transporting, lysosomal, V1 subunit C, isoform 1 [Danio 
rerio]
 gb|AAI64479.1| Atp6v1c1 protein [Danio rerio]
Length=383

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 101/161 (63%), Gaps = 3/161 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L+TVTLF +  D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTIN  274
              L    +S+     D+ A+   G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAAAIIDQSAMDIPGLNLSQQEYYPYVYYKID  376



>gb|ABO61291.1| vacuolar ATPase subunit C [Lutzomyia longipalpis]
Length=386

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 100/164 (61%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D ++ALYTVTLF +  D F++ ARE+ F +R+F YN E   + K E+ KL+ D++  
Sbjct  216  ITQDQDFALYTVTLFKKVVDEFKLHAREKKFVVREFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P  KS KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPHKKSTKRLRDVL  335

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      S+ S+     D   +   G G +E +PYV + +N+
Sbjct  336  NQLYGHLDGSAASSGGSNADNVDIPGLGFGQSEYYPYVYYKLNI  379



>emb|CDJ90591.1| ATPase domain containing protein, partial [Haemonchus contortus]
Length=225

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 105/161 (65%), Gaps = 5/161 (3%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            E+ E+ALY+VTLF +  D F+  ARE  F +RDF Y+ E+ ++ K E +KL+ +++   +
Sbjct  60   EEGEHALYSVTLFKKVIDEFKNIARENKFIVRDFVYDEESMKAGKSERDKLVAEKQRQYA  119

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + ++ P+  S+K++R+ L  
Sbjct  120  PLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAALVEPTKGSQKKLRAELHK  179

Query  381  L---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  180  LYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKVNL  219



>ref|XP_002645132.1| C. briggsae CBR-VHA-11 protein [Caenorhabditis briggsae]
 sp|Q612A4.1|VATC_CAEBR RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Caenorhabditis 
briggsae]
 emb|CAP34690.1| Protein CBR-VHA-11 [Caenorhabditis briggsae]
Length=385

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ ET ++ + E +KL+ +++  
Sbjct  219  LTEEGEHALYTVTLFKKVIDEFKNIARENKFIVRDFVYDEETLKAGRTERDKLLAEKQKQ  278

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+FS+++H  A+RVF ES+LRYGLP +F + V+ P+    K++R  L
Sbjct  279  YAPLIRWLKINFGEIFSAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQSKKLRQEL  338

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
            + L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  339  QKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  380



>ref|XP_005098193.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Aplysia 
californica]
 ref|XP_005098194.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Aplysia 
californica]
Length=390

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 97/162 (60%), Gaps = 3/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +YEDNE+ + TVTLF    D F+ K RE  F +RDF+Y+ E  ++ K EL+KL  D++  
Sbjct  222  VYEDNEHQVMTVTLFRLVQDEFKNKCRENKFIVRDFQYSDEEIQAGKMELDKLNADKKKQ  281

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++GE F +WMH  A+RVF ES+LRYGLP +F  +++ P  K+ KR+R +L
Sbjct  282  FGPLVKWLKINFGESFVAWMHIKALRVFVESVLRYGLPVNFQGMLVRPVKKNSKRLRDLL  341

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L    DS+  +  K       G     ++ +PYV + I+L
Sbjct  342  NQLYGHLDSTALSGQKVNSMDIPGLNLSASDYYPYVFYKISL  383



>ref|XP_011504285.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Ceratosolen 
solmsi marchali]
Length=388

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 100/166 (60%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  IIQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  KS KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVL  335

Query  387  ESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS    S+    +D   +   G G ++  PYV + IN+
Sbjct  336  NQLYAHLDSSATAGSSQSSNQDSVDIPGLGFGQSDYFPYVYYKINV  381



>ref|XP_005797406.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=382

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++ 
Sbjct  215  QLFEDNDSGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKK  274

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +
Sbjct  275  QFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREV  334

Query  390  LESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
            L  L    DSS +    + D    G      E +PYV + I+
Sbjct  335  LNDLYKHLDSSAAVIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_004077677.1| PREDICTED: V-type proton ATPase subunit C 1 [Oryzias latipes]
Length=383

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYEDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LYEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    T  +   G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIMDTAMDIP-GLNLSQQEYYPYVYYKID  375



>ref|XP_008559568.1| PREDICTED: V-type proton ATPase subunit C [Microplitis demolitor]
 ref|XP_008559569.1| PREDICTED: V-type proton ATPase subunit C [Microplitis demolitor]
Length=387

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 100/165 (61%), Gaps = 6/165 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  ITQDAEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCTKRLRDVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTINL  271
              L    DSS ++   + ++ +V   G   G  E  PYV + IN+
Sbjct  336  NQLYAHLDSSAASGGHSANQDSVDIPGLGFGQNEYFPYVYYKINV  380



>ref|XP_008420198.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia reticulata]
Length=382

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +L+EDNE  L++VTLF +  D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++ 
Sbjct  215  QLFEDNESGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKK  274

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +
Sbjct  275  QFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREV  334

Query  390  LESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
            L  L    DSS +    + D    G      E +PYV + I+
Sbjct  335  LYDLYKHLDSSAAVIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_009861882.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 2-like [Ciona intestinalis]
Length=382

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 90/161 (56%), Gaps = 2/161 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LY D EY LY VT+F +  + F+ K     F +RDF+YN     S K +L KL  D++  
Sbjct  216  LYRDEEYGLYGVTIFKKVYEEFKTKCGRHKFFLRDFQYNERDMASDKDQLTKLTSDKKKM  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               LL+W   ++ EVF++WMH  A+RVF ES+LRYGLP +F + V+ P  K  KR++  L
Sbjct  276  LGPLLRWLKVNFSEVFTAWMHVKALRVFVESVLRYGLPVNFQATVVQPQKKQSKRLQETL  335

Query  387  ESLCDSSNSTYWKT--EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    +ST      ED+   G   G  E HPYV + + L
Sbjct  336  NKLYVGLDSTGLAAVNEDDFLPGLTLGTQEYHPYVFYKVVL  376



>ref|XP_315870.4| AGAP005845-PA [Anopheles gambiae str. PEST]
 gb|EAA11948.4| AGAP005845-PA [Anopheles gambiae str. PEST]
Length=385

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D +Y L TVTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  216  ITQDQDYVLCTVTLFKKVVDEFKLHARERKFVVREFVYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWVHVKALRVFVESVLRYGLPVNFQAILIHPNKKSTKRLRDVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            + L    D S ++     D   +   G G +E  PYV + +N+
Sbjct  336  QQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYFPYVYYKLNI  378



>ref|XP_001946227.1| PREDICTED: V-type proton ATPase subunit C [Acyrthosiphon pisum]
 ref|XP_008181338.1| PREDICTED: V-type proton ATPase subunit C [Acyrthosiphon pisum]
Length=387

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 99/166 (60%), Gaps = 12/166 (7%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +DN+Y L+TVTLF + A+ F+  ARER F +R+F YN     + K E+ KL+ D++    
Sbjct  218  QDNDYGLFTVTLFKKVAEEFKHHARERKFIVREFTYNEVELAAGKNEISKLVTDKKKQFG  277

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L  
Sbjct  278  PLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAMLLHPNKKNTKRLRDVLHQ  337

Query  381  LCDSSNSTYWKTEDEGAVGAFG---------GDAEVHPYVSFTINL  271
            L    +S+    +  GA GA           G AE  PYV + IN+
Sbjct  338  LYGHLDSS---AQQGGATGAHDSVDIPGLGFGQAEYFPYVYYKINI  380



>ref|XP_001960901.1| GF11269 [Drosophila ananassae]
 gb|EDV37723.1| GF11269 [Drosophila ananassae]
Length=388

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + EDN+Y L+ VTLF + A+ F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  217  IQEDNDYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  277  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  336

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      +S      + D   +   G G +E +PYV + +N+
Sbjct  337  NQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYYPYVFYKVNI  380



>ref|XP_002733333.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Saccoglossus 
kowalevskii]
Length=384

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 99/162 (61%), Gaps = 3/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +YEDNEY L+TVT+F +  D ++  ARE  F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  IYEDNEYGLFTVTMFRKVVDEYKHHARENRFIVRDFAYNEEELTADKNEIIKLVSDKKKS  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F++W+H  A+RVF ES+LRYGLP +F +++L P  K+ +++R  L
Sbjct  276  FGPLVRWLKVNFSEAFTAWIHVHALRVFVESVLRYGLPVNFQAMLLQPYKKTHRKLRDQL  335

Query  387  ESLCDSSNSTYWKTED---EGAVGAFGGDAEVHPYVSFTINL  271
            + L     S+ +K +    E   G    + + +PYV + IN+
Sbjct  336  KQLYSHLESSAFKADTDMMEDIPGLALSNQDYYPYVYYQINV  377



>gb|EYC06044.1| hypothetical protein Y032_0078g1163 [Ancylostoma ceylanicum]
Length=384

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + E+ E+ALY+VTLF +  D F++ ARE  F +RDF Y+ E+ ++ K E +KL+ +++  
Sbjct  217  ITEEGEHALYSVTLFKKVIDEFKMVARENKFIVRDFVYDEESLKAGKSERDKLVAEKQRQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V+ PS  S+K++R+ L
Sbjct  277  YAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAAVVEPSKGSQKKLRAEL  336

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  337  HKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNL  378



>ref|XP_011144745.1| PREDICTED: V-type proton ATPase subunit C [Harpegnathos saltator]
 ref|XP_011144746.1| PREDICTED: V-type proton ATPase subunit C [Harpegnathos saltator]
 gb|EFN81041.1| Vacuolar proton pump subunit C [Harpegnathos saltator]
Length=388

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 100/166 (60%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  ITQDSEYGLFTVTLFKKVIDEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVL  335

Query  387  ESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS   ++     +D   +   G G ++  PYV + IN+
Sbjct  336  NQLYAHLDSSATASTAAQHNQDNVDIPGLGFGQSDYFPYVYYKINV  381



>emb|CAF93730.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=366

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 97/159 (61%), Gaps = 2/159 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LYED++  LY+VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  199  LYEDSDSGLYSVTLFMKAVDDFKHKARENKFVVRDFQYNEEEMKADKEEMTRLCTDKKKQ  258

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ KR+R +L
Sbjct  259  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKRLREVL  318

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTI  277
              L    +S+     D      G      E +PYV + I
Sbjct  319  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKI  357



>ref|XP_003094835.1| CRE-VHA-11 protein [Caenorhabditis remanei]
 gb|EFO90482.1| CRE-VHA-11 protein [Caenorhabditis remanei]
Length=386

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 103/163 (63%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ ET ++ + E +KL  +++  
Sbjct  220  LTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKAGRTERDKLQAEKQRQ  279

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+FS+++H  A+RVF ES+LRYGLP +F + V+ P+   +K++R  L
Sbjct  280  YAPLIRWLKINFGEIFSAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQEL  339

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  340  HKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  381



>ref|XP_007547766.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Poecilia 
formosa]
 ref|XP_007547767.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Poecilia 
formosa]
Length=382

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++ 
Sbjct  215  QLFEDNDSGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKK  274

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +
Sbjct  275  QFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREV  334

Query  390  LESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
            L  L    DSS +    + D    G      E +PYV + I+
Sbjct  335  LYDLYKHLDSSAAVIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_006219905.1| PREDICTED: V-type proton ATPase subunit C-like, partial [Vicugna 
pacos]
Length=375

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 106/163 (65%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + E+ E+ALY+VTLF +  D F+  ARE  F +RDF Y+ E+ ++ K E +KL+ +++  
Sbjct  212  ITEEGEHALYSVTLFKKVIDEFKTIARENKFVVRDFVYDEESLKAGKSERDKLVAEKQRQ  271

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + ++ P+  S+K++R+ L
Sbjct  272  YAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAALVEPTKGSQKKLRAEL  331

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  332  HKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKVNL  373



>gb|ACO11255.1| Vacuolar proton pump subunit C [Caligus rogercresseyi]
Length=384

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +++D+++AL  V+LF +  D+F+ KARE  F +RDF Y+P+  E+ K E+ KL  D++  
Sbjct  217  IFQDSDHALVNVSLFRKVVDDFKFKAREHKFIVRDFVYDPDELEAGKCEITKLTTDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F S +H  A+RVF ES+LR+GLP +F +++L P  K++K++R +L
Sbjct  277  FGPLVRWLRVNFSEAFISCIHVKALRVFVESVLRFGLPVNFQAMLLLPQKKTQKKLRDVL  336

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
             +L    +S+    E        G + E +PYV + IN+
Sbjct  337  NNLYSHLDSSGGVNEPMDIPAGLGFNQEYYPYVYYKINI  375



>ref|NP_001005772.2| V-type proton ATPase subunit C 1-B [Danio rerio]
 sp|Q5XIY6.1|VTC1B_DANRE RecName: Full=V-type proton ATPase subunit C 1-B; Short=V-ATPase 
subunit C 1-B; AltName: Full=Vacuolar proton pump subunit 
C 1-B [Danio rerio]
 gb|AAH83532.1| Atp6v1c1l protein [Danio rerio]
Length=381

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 103/165 (62%), Gaps = 11/165 (7%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED E  L++VTLFT+  D+F+ +ARE  F +RDF YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTINL  271
            + L    DSS +       +G+V   G      E +PYV + I++
Sbjct  336  KDLYKHLDSSAAVI-----DGSVDIPGLNLSQQEYYPYVYYKIDV  375



>gb|EYC06045.1| hypothetical protein Y032_0078g1163 [Ancylostoma ceylanicum]
Length=423

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + E+ E+ALY+VTLF +  D F++ ARE  F +RDF Y+ E+ ++ K E +KL+ +++  
Sbjct  256  ITEEGEHALYSVTLFKKVIDEFKMVARENKFIVRDFVYDEESLKAGKSERDKLVAEKQRQ  315

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V+ PS  S+K++R+ L
Sbjct  316  YAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAAVVEPSKGSQKKLRAEL  375

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  376  HKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNL  417



>ref|XP_011268884.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011268972.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011269062.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011269145.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
Length=387

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 98/163 (60%), Gaps = 6/163 (4%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +D+EY L+T+TLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++    
Sbjct  218  QDSEYGLFTITLFKKVMDEFKLHAREKKFIVRDFIYNEEELAAGKNEITKLVTDKKKQFG  277

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L  
Sbjct  278  PLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVLNQ  337

Query  381  L---CDSS--NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L    DSS   +     +D   +   G G ++  PYV + IN+
Sbjct  338  LYAHLDSSATGTPAQHNQDNLDIPGLGFGQSDYFPYVYYKINV  380



>ref|XP_010768583.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Notothenia 
coriiceps]
Length=177

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  10   LFEDHDSGLFSVTLFLKAVDDFKHKARENKFVVRDFQYNEEELKADKEEMTRLSTDKKKQ  69

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L PS K+ KR+R +L
Sbjct  70   FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKRLREVL  129

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEV---HPYVSFTIN  274
              L    DSS S       + A+   G +  V   +PYV + I+
Sbjct  130  NDLYKHLDSSASAII----DCAMDIPGLNLSVQEYYPYVYYKID  169



>gb|EFN75043.1| Vacuolar proton pump subunit C [Camponotus floridanus]
Length=402

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 99/165 (60%), Gaps = 6/165 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+T+TLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  231  ITQDSEYGLFTITLFKKVMDEFKLHAREKKFIVRDFIYNEEELAAGKNEITKLVTDKKKQ  290

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L
Sbjct  291  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVL  350

Query  387  ESL---CDSS--NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS   +     +D   +   G G ++  PYV + IN+
Sbjct  351  NQLYAHLDSSATGTPAQHNQDNLDIPGLGFGQSDYFPYVYYKINV  395



>ref|XP_008211658.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Nasonia 
vitripennis]
Length=388

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 99/164 (60%), Gaps = 7/164 (4%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E   + K E+ KL+ D++    
Sbjct  218  QDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQFG  277

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  KS KR+R +L  
Sbjct  278  PLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVLNQ  337

Query  381  L---CDSSNS---TYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            L    DSS +   +    +D   +   G G ++  PYV + IN+
Sbjct  338  LYAHLDSSATAGGSQSGNQDSVDIPGLGFGQSDYFPYVYYKINV  381



>ref|XP_010751636.1| PREDICTED: V-type proton ATPase subunit C 1-A [Larimichthys crocea]
Length=382

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + I+
Sbjct  336  YELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|NP_001040138.1| vacuolar ATPase subunit C [Bombyx mori]
 gb|ABD36144.1| vacuolar ATPase subunit C [Bombyx mori]
Length=386

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 101/164 (62%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +++DN+Y L+TVTLF + AD F++ ARER F +R+F YN     + K E+ KL+ D++  
Sbjct  215  VHQDNDYGLFTVTLFKKVADEFKLHARERKFVVREFAYNEADLLAGKNEITKLVTDKKKQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +VV+ P+ KS K++R +L
Sbjct  275  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAVVMVPARKSMKKLRDLL  334

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      S+++      D   +   G G +E  PYV + IN+
Sbjct  335  NQLYAHLDHSAHAHSAAAPDSVELAGLGFGQSEYFPYVFYKINI  378



>sp|Q9U5N1.1|VATC_MANSE RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Manduca 
sexta]
 emb|CAB55498.1| vacuolar ATPase subunit C [Manduca sexta]
Length=385

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +++D +Y L+TVTLF +  D F++ ARER F +R+F YN     + K E+ KL+ D++  
Sbjct  215  IHQDGDYGLFTVTLFKKVVDEFKLHARERKFVVREFAYNEADLVAGKNEITKLLTDKKKQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F + +L PS +S +R+R  L
Sbjct  275  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAALLVPSRRSARRLRDTL  334

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFG-GDAEVHPYVSFTINL  271
             +L    D S   +    +D   +   G G +E +PYV + IN+
Sbjct  335  HALYAHLDHSAHHHANAQQDSVELAGLGFGQSEYYPYVFYKINI  378



>gb|EGT48628.1| CBN-VHA-11 protein [Caenorhabditis brenneri]
Length=384

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 103/163 (63%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ E  ++ + E +KL+ +++  
Sbjct  218  LTEEGEHALYTVTLFKKVIDEFKNTARESKFIVRDFVYDEEALKAGRTERDKLLSEKQRQ  277

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V+ P+   +K++R  L
Sbjct  278  YAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQEL  337

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  338  NKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  379



>gb|EZA45856.1| S-methyl-5'-thioadenosine phosphorylase-like protein-3 [Microplitis 
demolitor]
Length=556

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 100/165 (61%), Gaps = 6/165 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  385  ITQDAEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  444

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  KR+R +L
Sbjct  445  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCTKRLRDVL  504

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTINL  271
              L    DSS ++   + ++ +V   G   G  E  PYV + IN+
Sbjct  505  NQLYAHLDSSAASGGHSANQDSVDIPGLGFGQNEYFPYVYYKINV  549



>gb|EFX90034.1| hypothetical protein DAPPUDRAFT_205240 [Daphnia pulex]
Length=385

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 94/159 (59%), Gaps = 2/159 (1%)
 Frame = -3

Query  741  EDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETFRS  562
            +D E AL TVTLF +  D F+  ARE  F +RDF YN E   + K E+ KL  D++    
Sbjct  218  QDGENALVTVTLFRKVVDEFKHHAREHKFVVRDFTYNEEELAAGKNEITKLATDKKKQFG  277

Query  561  SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSILES  382
             L++W   ++ E F++W+H  A+RVF ES+LRYGLP +F +++L P+ KS KR+R +L  
Sbjct  278  PLVRWLKVNFSEGFTAWVHVKALRVFVESVLRYGLPVNFQAMLLQPNKKSTKRLREVLSQ  337

Query  381  L-CDSSNSTYWKTEDEGAV-GAFGGDAEVHPYVSFTINL  271
            L     NS      D   + G   G +E +PYV + IN+
Sbjct  338  LYIHLDNSALQSAHDNVDIPGLVFGQSEYYPYVYYKINI  376



>gb|EGI57447.1| V-type proton ATPase subunit C [Acromyrmex echinatior]
Length=386

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  ITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R  L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDAL  335

Query  387  ESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS  ++    +D   +   G G  +  PYV + IN+
Sbjct  336  NQLYAHLDSSATASTAHNQDNVDIPGLGFGQNDYFPYVYYKINV  379



>gb|EHJ73191.1| hypothetical protein KGM_01090 [Danaus plexippus]
Length=451

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 102/164 (62%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +++DN+Y L+TVTLF +  D F++ ARER F +R+F YN     + K E+ +L+ D++  
Sbjct  282  VHQDNDYGLFTVTLFRKVVDEFKLHARERKFIVREFSYNEADLAAGKNEITRLVTDKKKQ  341

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +FL+VV+ P+ KS K++R +L
Sbjct  342  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFLAVVMVPARKSMKKLRDVL  401

Query  387  ESL---CDSSNSTYW-KTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            + L    D S   +    +D   +   G G ++  PYV + IN+
Sbjct  402  QHLYAHLDHSAQQHGHAAQDNAELAGLGFGQSDYFPYVFYKINI  445



>ref|XP_009170324.1| hypothetical protein T265_06723 [Opisthorchis viverrini]
 gb|KER25916.1| hypothetical protein T265_06723 [Opisthorchis viverrini]
Length=413

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED +  L+TVTLF +  ++F+ + RER F +RDFEY+ +  E  K EL KL  D++  
Sbjct  248  LFEDQDNGLWTVTLFRKMIEDFKNRCRERRFIVRDFEYDEKKIEEGKTELSKLESDKKRQ  307

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +V++ P+ K+ KR+R +L
Sbjct  308  FAPLFRWLKINFGEAFSAMVHTKALRVFVESVLRYGLPVDFQAVLIQPNKKAHKRLRELL  367

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L    DS+ S+    E+   VG      + +PYVSF + L
Sbjct  368  RQLYSHLDSTASSNVVDEEIALVGV--SPVDYYPYVSFKVEL  407



>ref|XP_008290531.1| PREDICTED: V-type proton ATPase subunit C 1 [Stegastes partitus]
Length=383

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 98/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_011067212.1| PREDICTED: V-type proton ATPase subunit C [Acromyrmex echinatior]
Length=387

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  217  ITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R  L
Sbjct  277  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDAL  336

Query  387  ESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS  ++    +D   +   G G  +  PYV + IN+
Sbjct  337  NQLYAHLDSSATASTAHNQDNVDIPGLGFGQNDYFPYVYYKINV  380



>ref|XP_003444114.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Oreochromis 
niloticus]
Length=382

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFSVTLFRKAVDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>gb|ESA12183.1| hypothetical protein GLOINDRAFT_185994 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX75116.1| Vma5p [Rhizophagus irregularis DAOM 197198w]
Length=388

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 99/160 (62%), Gaps = 2/160 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            K+ EDN+Y L+TVTLF R +D F  K RE  F +RDF+Y+    E++++E E++   ++ 
Sbjct  222  KIAEDNDYGLFTVTLFKRVSDEFANKCREEKFVVRDFKYDENDMENQRKEFEEVGAVEKE  281

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                LL+    ++GEVFSSW+H  A+RV+ ES+LRYGLPP F+S V+ P  K +K++R I
Sbjct  282  LAVELLRLATANFGEVFSSWIHLKALRVYVESVLRYGLPPDFMSAVIRPKFKMDKKIREI  341

Query  390  LESLCDSSNSTYWKTEDEGAVGAFGG--DAEVHPYVSFTI  277
            L +L    +   +  ++   +  +    D + +PYV F +
Sbjct  342  LNNLYGKLDGLAYGRDENENIEEYQNFIDKDYYPYVYFHL  381



>ref|XP_011504284.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Ceratosolen 
solmsi marchali]
Length=542

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 100/166 (60%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  370  IIQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQ  429

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  KS KR+R +L
Sbjct  430  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVL  489

Query  387  ESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS    S+    +D   +   G G ++  PYV + IN+
Sbjct  490  NQLYAHLDSSATAGSSQSSNQDSVDIPGLGFGQSDYFPYVYYKINV  535



>gb|ETN59245.1| vacuolar ATP synthase subunit C [Anopheles darlingi]
Length=635

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D +YAL +VTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  466  ITQDADYALCSVTLFKKVVDEFKLHARERKFVVREFVYNEEELAAGKNEITKLVTDKKKQ  525

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  526  FGPLVRWLKVNFSECFGAWVHVKALRVFVESVLRYGLPVNFQAILIHPNKKSTKRLRDVL  585

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
            + L    D S ++     D   +   G G +E  PYV + +N+
Sbjct  586  QQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYFPYVYYKLNV  628



>ref|XP_003965909.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Takifugu 
rubripes]
Length=383

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 97/159 (61%), Gaps = 2/159 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  LY+VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLYSVTLFMKAVDDFKHKARENKFIVRDFQYNEEEMKADKEEMARLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTI  277
              L    +S+     D      G      E +PYV + I
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKI  374



>ref|XP_001647617.1| AAEL015594-PA, partial [Aedes aegypti]
 gb|EAT32285.1| AAEL015594-PA, partial [Aedes aegypti]
Length=299

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 93/149 (62%), Gaps = 9/149 (6%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E   + K E+ KL+ D++  
Sbjct  160  ITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEELAAGKNEITKLVTDKKKQ  219

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++++ P+ K+ KR+R +L
Sbjct  220  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPNKKNTKRLRDVL  279

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEV  301
              L             +G+  + GG+A+V
Sbjct  280  MQLYGHL---------DGSAASSGGNADV  299



>ref|XP_010898239.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Esox lucius]
Length=381

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+FR KARE  F +RDF+YN +   + K+E+ +L  D++  
Sbjct  216  LFEDHDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEQEMNADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNIKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS S    T D    G      E +PYV + I+
Sbjct  336  SELYKHLDSSASIIDATMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_010771260.1| PREDICTED: V-type proton ATPase subunit C 1 [Notothenia coriiceps]
Length=382

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +      D    G      E +PYV + ++
Sbjct  336  NELYKHLDSSAAIIDAVMD--IPGLNLSQQEYYPYVYYKLD  374



>ref|XP_011332476.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Cerapachys 
biroi]
Length=339

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 99/166 (60%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+TVTLF +  D F++ +RE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  167  ITQDSEYGLFTVTLFKKVIDEFKLHSREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  226

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R  L
Sbjct  227  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDAL  286

Query  387  ESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS   ++     +D   +   G G ++  PYV + IN+
Sbjct  287  NQLYAHLDSSATASTAAQHNQDNVDIPGLGFGQSDYFPYVYYKINV  332



>ref|XP_007249407.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Astyanax 
mexicanus]
Length=380

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED +  L++VTLF +  D+F+ +ARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  215  LFEDQDSGLFSVTLFRKAIDDFKHQARENKFAVRDFQYNEEEMKADKEEMTRLSTDKKKQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  275  FGPLVRWLKVNFSEAFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  334

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            + L    DSS +    + D    G      E +PYV + I+L
Sbjct  335  QELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKIDL  374



>ref|XP_007886138.1| PREDICTED: V-type proton ATPase subunit C 1 [Callorhinchus milii]
Length=382

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +Y+DN+  LY VTLF +  D+FR++ARE  F +R+F+YN E  ++ K+E+ +L  D++  
Sbjct  216  IYDDNDSGLYNVTLFRKAVDDFRLQARENKFVVREFQYNEEELKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L PS K  K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPSKKMMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTIN  274
              L    +S+     D  A+   G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAASIID-AAIDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_010883498.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Esox 
lucius]
Length=307

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 96/160 (60%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN +   + K+E+ +L  D++  
Sbjct  141  LFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEQEMNADKEEMTRLSTDKKKQ  200

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H   +RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  201  FGPLVRWLKVNFSEAFIAWIHIKGLRVFVESVLRYGLPVNFQAMLLQPNKKNLKKLREVL  260

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  261  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  300



>ref|XP_011332474.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Cerapachys 
biroi]
 ref|XP_011332475.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Cerapachys 
biroi]
 gb|EZA58381.1| V-type proton ATPase subunit C [Cerapachys biroi]
Length=388

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 99/166 (60%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D+EY L+TVTLF +  D F++ +RE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  216  ITQDSEYGLFTVTLFKKVIDEFKLHSREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R  L
Sbjct  276  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDAL  335

Query  387  ESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS   ++     +D   +   G G ++  PYV + IN+
Sbjct  336  NQLYAHLDSSATASTAAQHNQDNVDIPGLGFGQSDYFPYVYYKINV  381



>ref|XP_001418773.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97066.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=374

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 1/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ +++Y L TV LF R  D F   ARE G   +++ ++PE   + K +   L Q+    
Sbjct  215  IHVEDDYELRTVVLFRRVVDAFTTAAREIGCTAKEYSHDPEASRAAKSQRGALEQEVVQR  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            R SLL+WC  SYGE FS+ MH C VRVF ESILRYGLPP F +V++ P++K   ++R +L
Sbjct  275  RDSLLEWCQISYGEAFSTMMHVCTVRVFVESILRYGLPPDFQAVLMRPNMKHVSKLRKVL  334

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAE-VHPYVSFTINL  271
                    S++W  E  G   + GG  E ++ YVS T+ +
Sbjct  335  NQEFGKDASSHWDDEIGGDEKSGGGLVEDMYSYVSLTMKV  374



>gb|AAB51350.1| C subunit of V-ATPase, partial [Amblyomma americanum]
Length=382

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 94/159 (59%), Gaps = 0/159 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +YEDN++ L+TVTLF +  D F+   RE  F +RDF Y+     + K E+ KL  D++  
Sbjct  215  VYEDNDHGLFTVTLFQKVVDTFKHHCRENKFVVRDFVYDESALLAGKNEIAKLESDKKKQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F++W+H  A+R+F ES+LRYGLP +F  ++L P  K+ KR+R +L
Sbjct  275  YGLLVRWLKVNFSEAFTAWVHVKALRLFVESVLRYGLPVNFQGMLLQPQKKTAKRLREVL  334

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L    +++  +   +   G   G  E +PYV F I++
Sbjct  335  NQLYSHLDTSIAQGPVDDIPGLNLGQQEYYPYVYFKISI  373



>dbj|GAA48137.1| V-type proton ATPase subunit C 1-A [Clonorchis sinensis]
Length=574

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 100/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED +  L+TVTLF +  ++F+ + RER F +RDFEY+ +  E  K EL KL  D++  
Sbjct  409  LFEDQDNGLWTVTLFRKMIEDFKNRCRERRFIVRDFEYDEKKIEEGKTELSKLESDKKRQ  468

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
             + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +V++ P+ K+ KR+R +L
Sbjct  469  FAPLFRWLKINFGEAFSAMVHTKALRVFVESVLRYGLPVDFQAVLIQPNKKAHKRLRELL  528

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L    DS+ S+    E+   VG      + +PYVSF + L
Sbjct  529  RQLYSHLDSTASSNVVDEEVALVGV--SPVDYYPYVSFKVEL  568



>ref|XP_008321927.1| PREDICTED: V-type proton ATPase subunit C 1 [Cynoglossus semilaevis]
Length=383

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 97/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L+ VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFCVTLFRKALDDFKHKARENKFIVRDFQYNEEEMKADKEEMTRLCTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_010744926.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Larimichthys 
crocea]
Length=383

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 97/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED +  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDQDSGLFSVTLFMKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_007550565.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia formosa]
 ref|XP_007550567.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X2 [Poecilia 
formosa]
Length=383

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 98/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>gb|AAB62571.1| V-ATPase C subunit [Drosophila melanogaster]
Length=388

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 97/164 (59%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  217  IQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMPKLMTDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  277  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  336

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      +S      + D   +   G G +E  PYV + +N+
Sbjct  337  NQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  380



>ref|XP_005803508.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=383

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 98/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_007550566.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X1 [Poecilia 
formosa]
Length=383

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 98/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_010883497.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Esox 
lucius]
Length=382

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 96/160 (60%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN +   + K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEQEMNADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H   +RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKGLRVFVESVLRYGLPVNFQAMLLQPNKKNLKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_003459431.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004560058.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Maylandia 
zebra]
 ref|XP_005464958.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005742954.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_005930197.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005930198.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Haplochromis burtoni]
Length=383

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 98/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  NDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_002015982.1| GL11349 [Drosophila persimilis]
 gb|EDW31872.1| GL11349 [Drosophila persimilis]
Length=388

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED++Y L+ VTLF +  + F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  217  IQEDSDYCLFNVTLFKKVTEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  277  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  336

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      +S      + D   +   G G +E +PYV + +N+
Sbjct  337  NQLYGHLDGASAGGQVSSADNVDIPGLGFGQSEYYPYVFYKVNI  380



>ref|XP_008329974.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Cynoglossus 
semilaevis]
Length=382

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+F+ KARE  F +RDF YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDNDNGLFSVTLFRKAVDDFKHKARENKFTVRDFYYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_006636047.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=382

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 2/160 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED E  L++VTLF +  D+FR KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDQESGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L PS K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEGFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVL  335

Query  387  ESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  274
              L    +S+     D      G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAAAIIDASMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_002940167.1| PREDICTED: V-type proton ATPase subunit C 2 [Xenopus (Silurana) 
tropicalis]
Length=381

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 95/162 (59%), Gaps = 3/162 (2%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED E  L+TVTLF +  D+F+ KARE  F +R+F +N +  +S K E+ KL  D++  
Sbjct  215  IAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQL  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               LL+W   ++ E F  W+H  A+RVF ES+LRYGLP +F +VVL P+ KS KR+R +L
Sbjct  275  YGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVL  334

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
             ++    D + +   K       G      + +PYV F I+L
Sbjct  335  NAIFRHLDENAAANMKDIGMEIPGLQLSSQDYYPYVCFKIDL  376



>ref|NP_477266.1| vacuolar H[+] ATPase 44kD subunit, isoform A [Drosophila melanogaster]
 ref|NP_599140.1| vacuolar H[+] ATPase 44kD subunit, isoform B [Drosophila melanogaster]
 ref|XP_002034118.1| GM20063 [Drosophila sechellia]
 ref|XP_002081761.1| GD25545 [Drosophila simulans]
 gb|AAF58011.1| vacuolar H[+] ATPase 44kD subunit, isoform A [Drosophila melanogaster]
 gb|AAL28586.1| HL07758p [Drosophila melanogaster]
 gb|AAM27505.1| LD12844p [Drosophila melanogaster]
 gb|AAM68515.1| vacuolar H[+] ATPase 44kD subunit, isoform B [Drosophila melanogaster]
 gb|EDW48131.1| GM20063 [Drosophila sechellia]
 gb|EDX07346.1| GD25545 [Drosophila simulans]
 gb|ACL84134.1| Vha44-PA, partial [synthetic construct]
 gb|ACL89238.1| Vha44-PA [synthetic construct]
Length=388

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 97/164 (59%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  217  IQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  277  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  336

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      +S      + D   +   G G +E  PYV + +N+
Sbjct  337  NQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  380



>ref|XP_003701871.1| PREDICTED: V-type proton ATPase subunit C-like [Megachile rotundata]
Length=595

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D +Y L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  425  ITQDADYGLFTVTLFKKVIDEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  484

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L
Sbjct  485  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVL  544

Query  387  ESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS  S+    +D   +   G G  +  PYV + IN+
Sbjct  545  NQLYAHLDSSATSSTQGNQDSVDIPGLGFGQNDYFPYVYYKINV  588



>ref|XP_005917491.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Haplochromis 
burtoni]
Length=382

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLFSVTLFRKAVDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_005728447.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_006787870.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Neolamprologus 
brichardi]
Length=382

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDSDSGLFSVTLFRKAVDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + I+
Sbjct  336  YDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>gb|KFM68542.1| V-type proton ATPase subunit C, partial [Stegodyphus mimosarum]
Length=382

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 99/163 (61%), Gaps = 5/163 (3%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            +++ DNE++LY VTLF +  D F+  ARE+ F +RDF Y+ +     K +  KL  D+  
Sbjct  214  RIFHDNEHSLYNVTLFKKWVDKFKANAREKKFIVRDFTYSEKELADGKSQHAKLKSDKSR  273

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
              S L +W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P   + K++R +
Sbjct  274  QLSLLFRWIKVNFSECFVAWIHVKALRVFVESVLRYGLPVNFQAMLLQPLKST-KKLREV  332

Query  390  LESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
            L +L    DSS ++    +  G + +FG + E +PYV F IN+
Sbjct  333  LNNLYSHLDSSLASGQIDDIPGGLSSFGVE-EYYPYVYFKINI  374



>ref|XP_001360460.2| GA20788 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25035.2| GA20788 [Drosophila pseudoobscura pseudoobscura]
Length=448

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED++Y L+ VTLF +  + F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  277  IQEDSDYCLFNVTLFKKVTEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  336

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  337  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  396

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      +S      + D   +   G G +E +PYV + +N+
Sbjct  397  NQLYGHLDGASAGGQVSSADNVDIPGLGFGQSEYYPYVFYKVNI  440



>ref|XP_002107808.1| hypothetical protein TRIADDRAFT_19844 [Trichoplax adhaerens]
 gb|EDV28606.1| hypothetical protein TRIADDRAFT_19844 [Trichoplax adhaerens]
Length=379

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 98/162 (60%), Gaps = 2/162 (1%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            K+YEDNE+AL++VTLF +  D F+  AR+  F +RDF+YN    ++ K E+ +L  D++ 
Sbjct  212  KIYEDNEHALFSVTLFNKVIDEFKHHARDNRFIVRDFKYNEAEVQAGKSEITRLEADKKK  271

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
                L++W  T++GE   +++H   +R+F ES+LRYGLP +F + +L P+ KS KR+R  
Sbjct  272  QFGPLMRWLKTNFGECVIAFVHIKVLRLFVESVLRYGLPVNFQAALLLPTKKSSKRLREA  331

Query  390  LESLCDSSNSTYWKTEDEG--AVGAFGGDAEVHPYVSFTINL  271
            L +L    +ST     D G    G      + +PYV F +N+
Sbjct  332  LMNLYRHLDSTANTNLDIGFEIPGVTTQQGDYYPYVYFPVNV  373



>emb|CEF60497.1| V-type proton ATPase subunit C 2 [Strongyloides ratti]
Length=386

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED E+ LY+VTLF +  D ++IK RE  F +RDF Y+ E  ++ K + EK+ Q+    
Sbjct  218  IHEDGEHCLYSVTLFKKVIDEYKIKCRELKFIVRDFVYDEEALKAGKSDREKVFQEVRKQ  277

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E+FS+++H  A+RVF ES+LRYGLP +F +V++ P   ++K++RS L
Sbjct  278  HPPLVRWLKINFSEIFSAYVHIKALRVFVESVLRYGLPVNFQTVLMEPHKGAQKKLRSEL  337

Query  387  ESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  271
              L    D S S    T ED  A+   G   + +PYV F +N+
Sbjct  338  NKLYSHLDGSASGPIDTFEDSPALMQLGVH-DYYPYVFFKLNI  379



>ref|NP_725564.1| vacuolar H[+] ATPase 44kD subunit, isoform C [Drosophila melanogaster]
 gb|AAF58012.1| vacuolar H[+] ATPase 44kD subunit, isoform C [Drosophila melanogaster]
Length=442

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 97/164 (59%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  271  IQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  330

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  331  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  390

Query  387  ESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L      +S      + D   +   G G +E  PYV + +N+
Sbjct  391  NQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  434



>ref|XP_008304955.1| PREDICTED: V-type proton ATPase subunit C 1-A [Stegastes partitus]
Length=382

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  ++ K+E+ +L  D++  
Sbjct  216  LFEDHDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P+ K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + I+
Sbjct  336  YELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_008211656.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Nasonia 
vitripennis]
 ref|XP_008211657.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Nasonia 
vitripennis]
Length=655

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 99/166 (60%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  483  INQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEELAAGKNEMTKLVTDKKKQ  542

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  KS KR+R +L
Sbjct  543  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLRPHKKSTKRLRDVL  602

Query  387  ESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
              L    DSS     +    +D   +   G G ++  PYV + IN+
Sbjct  603  NQLYAHLDSSATAGGSQSGNQDSVDIPGLGFGQSDYFPYVYYKINV  648



>ref|XP_003395428.1| PREDICTED: v-type proton ATPase subunit C-like [Bombus terrestris]
Length=406

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 96/166 (58%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  234  IAQDVEYGLFTVTLFKKVIDEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  293

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI-  391
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R + 
Sbjct  294  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVL  353

Query  390  ------LESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
                  L+S   +S+      +    +G   G  +  PYV + IN+
Sbjct  354  NQHYAHLDSSATTSSGAQGSQDSMDILGLSFGQNDYFPYVYYKINV  399



>emb|CDS17048.1| V type proton ATPase subunit C 1 A [Echinococcus granulosus]
Length=382

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 95/158 (60%), Gaps = 1/158 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +  L+TVTLF +  ++F ++ARE+ F +RDF Y+ +  E  K    KL  D++  
Sbjct  217  IFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAIEESKNMFSKLEADKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L +W   ++GE FS   H  A+R+F ES+LRYGLP  F ++++ P+ K+ KR+R +L
Sbjct  277  FPPLFRWLRVNFGEAFSVMTHIKALRIFVESVLRYGLPVDFEAILIVPNRKNYKRLREVL  336

Query  387  ESLCDS-SNSTYWKTEDEGAVGAFGGDAEVHPYVSFTI  277
             ++ +   N +   T DE  VGA     E +PYVS ++
Sbjct  337  HNMYEHLDNLSLSSTTDEEIVGAGMSHGEYYPYVSISV  374



>ref|XP_002408654.1| C subunit of V-ATPase, putative [Ixodes scapularis]
 gb|EEC12507.1| C subunit of V-ATPase, putative [Ixodes scapularis]
Length=384

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 91/157 (58%), Gaps = 0/157 (0%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            +YED E+ L+TVTLF +  + FR+  RE  F +R+F Y+     + K E+ KL  D++  
Sbjct  217  VYEDQEHGLFTVTLFFKVVEEFRLHCRENKFVVREFVYDESALLAGKNEIAKLESDKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F++W+H  A+R+F ES+LRYGLP +F  ++L P  K+ KR+R +L
Sbjct  277  HGQLIRWLKVNFSEAFTAWIHVKALRLFVESVLRYGLPVNFQGMLLQPQKKTAKRLREVL  336

Query  387  ESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTI  277
              L    +++      +   G   G  E +PYV F I
Sbjct  337  NQLYSHLDTSIAAGPIDDIPGLNLGQQEYYPYVYFKI  373



>emb|CEG71831.1| hypothetical protein RMATCC62417_07500 [Rhizopus microsporus]
Length=382

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -3

Query  750  KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQET  571
            K+ ED+E+ L+TVT+F R AD F  KARE  F  RDF+YN +  +++++ELE+ +Q +  
Sbjct  211  KITEDDEFGLFTVTVFQRVADEFCHKAREERFIPRDFKYNEDALQTQQRELEETIQTERE  270

Query  570  FRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSI  391
              + LL+   T++GEVF+SW+H  A+RVF ES+LRYGLPP F SV + P  K EK+V  +
Sbjct  271  QHAELLRLAKTNFGEVFASWLHLKALRVFVESVLRYGLPPDFCSVTICPKPKFEKKVDDV  330

Query  390  L  388
            +
Sbjct  331  M  331



>ref|XP_001975366.1| GG22273 [Drosophila erecta]
 gb|EDV55766.1| GG22273 [Drosophila erecta]
Length=441

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 96/164 (59%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  270  IQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  329

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  330  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  389

Query  387  ESLCD-----SSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L       S+       ++    G   G +E  PYV + +N+
Sbjct  390  NQLYGHLDGVSAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  433



>ref|XP_003741777.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Metaseiulus 
occidentalis]
Length=381

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 97/164 (59%), Gaps = 14/164 (9%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED E+ L+TVTLF +  D+F+ KAR + F +RDFEYN E+ +S K E  ++  +++  
Sbjct  215  IHEDGEHGLFTVTLFRKVVDDFKNKARLQKFIVRDFEYNEESIKSGKDEKSRMETEKKRQ  274

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L +W   ++GE F +W+H  A+R+F ES+LRYGLP +F  ++L P  +S +R+R +L
Sbjct  275  LVLLSRWIRNNFGEAFVAWIHIKALRLFVESVLRYGLPVNFQGMLLLPQKRSMRRLRELL  334

Query  387  ESLCDSSNSTYWKTEDEGAVGAF-------GGDAEVHPYVSFTI  277
                   N TY   ++  A G          G +E +PYV F I
Sbjct  335  -------NRTYSHLDNSAASGPVEDIPGFNMGPSEYYPYVYFKI  371



>emb|CDJ04792.1| V type proton ATPase subunit C 1 A [Echinococcus multilocularis]
 emb|CDS42074.1| V type proton ATPase subunit C 1 A [Echinococcus multilocularis]
Length=382

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 94/158 (59%), Gaps = 1/158 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +  L+TVTLF +  ++F ++ARE+ F +RDF Y+ +  E  K    KL  D++  
Sbjct  217  IFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAIEESKNMFSKLEADKKKQ  276

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L +W   ++GE FS   H  A+R+F ES+LRYGLP  F ++++ P+ K+ KR+R +L
Sbjct  277  FPPLFRWLRVNFGEAFSVMTHIKALRIFVESVLRYGLPVDFEAILIVPNRKNYKRLREVL  336

Query  387  ESLCDS-SNSTYWKTEDEGAVGAFGGDAEVHPYVSFTI  277
             ++ +   N     T DE  VGA     E +PYVS ++
Sbjct  337  HNMYEHLDNLALSSTTDEEIVGAGMSHGEYYPYVSISV  374



>gb|EUB62465.1| V-type proton ATPase subunit C 1-A [Echinococcus granulosus]
Length=399

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 95/158 (60%), Gaps = 1/158 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            ++ED +  L+TVTLF +  ++F ++ARE+ F +RDF Y+ +  E  K    KL  D++  
Sbjct  234  IFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAIEESKNMFSKLEADKKKQ  293

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L +W   ++GE FS   H  A+R+F ES+LRYGLP  F ++++ P+ K+ KR+R +L
Sbjct  294  FPPLFRWLRVNFGEAFSVMTHIKALRIFVESVLRYGLPVDFEAILIVPNRKNYKRLREVL  353

Query  387  ESLCDS-SNSTYWKTEDEGAVGAFGGDAEVHPYVSFTI  277
             ++ +   N +   T DE  VGA     E +PYVS ++
Sbjct  354  HNMYEHLDNLSLSSTTDEEIVGAGMSHGEYYPYVSISV  391



>ref|XP_003968986.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Takifugu 
rubripes]
Length=382

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 98/161 (61%), Gaps = 5/161 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+EDN+  L++VTLF +  D+FR +ARE  F +RDF+YN    ++ K+E+ +L  D++  
Sbjct  216  LFEDNDSGLFSVTLFRKAIDDFRHQARENKFMVRDFQYNEVEMKADKEEMTRLSTDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K+ K++R +L
Sbjct  276  FGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPHKKNMKKLREVL  335

Query  387  ESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  274
              L    DSS +    + D    G      E +PYV + ++
Sbjct  336  YELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKVD  374



>ref|XP_011414828.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
 ref|XP_011414829.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
Length=383

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 99/163 (61%), Gaps = 6/163 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED+E  L +VTLF + A++FR + RE  F +RDF YN +     K E+ KL  D++  
Sbjct  216  LFEDDENCLCSVTLFRKVAEDFRNRCRENRFMVRDFTYNEKDIADGKMEISKLEDDKKKQ  275

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++GE FS+W+H  A+R+F ES+LRYGLP +FL+V++ P  K+ +++R ++
Sbjct  276  YGPLVKWLKVNFGEAFSAWIHVKALRIFVESVLRYGLPVNFLAVLIQPHKKTTRKLREVM  335

Query  387  ESL---CDSSNST-YWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L    DS  S    + E  G VG    + + +PYV + I L
Sbjct  336  NQLYAHLDSPASQDAGQMEIPGLVGI--SNVDYYPYVYYKIGL  376



>gb|EKC32287.1| V-type proton ATPase subunit C 1 [Crassostrea gigas]
Length=419

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 99/163 (61%), Gaps = 6/163 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            L+ED+E  L +VTLF + A++FR + RE  F +RDF YN +     K E+ KL  D++  
Sbjct  252  LFEDDENCLCSVTLFRKVAEDFRNRCRENRFMVRDFTYNEKDIADGKMEISKLEDDKKKQ  311

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++GE FS+W+H  A+R+F ES+LRYGLP +FL+V++ P  K+ +++R ++
Sbjct  312  YGPLVKWLKVNFGEAFSAWIHVKALRIFVESVLRYGLPVNFLAVLIQPHKKTTRKLREVM  371

Query  387  ESL---CDSSNST-YWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L    DS  S    + E  G VG    + + +PYV + I L
Sbjct  372  NQLYAHLDSPASQDAGQMEIPGLVGI--SNVDYYPYVYYKIGL  412



>ref|XP_004340673.1| Vtype proton ATPase subunit C, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18631.1| Vtype proton ATPase subunit C, putative [Acanthamoeba castellanii 
str. Neff]
Length=394

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            LY D+E+ LY V LF + AD+F+ +AR++ + +R+++++ +  E+ K++L+K    +   
Sbjct  229  LYSDSEFNLYNVILFKKMADDFKTQARKKKWTVREYKFDAKAVEAGKEDLKKFESKRVKQ  288

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
            ++SL++WC  ++ E F+SW+H  A+R F E++LR+GLP  + S V+ P   SE ++R  L
Sbjct  289  KNSLIRWCRLNFAEAFTSWVHLKAIRTFIEAVLRFGLPAEYTSAVIEPGRSSENKLRKTL  348

Query  387  ESLCDSSNSTYWKTEDEGAVGAF--GGDAEVHPYV  289
            +SL     S+Y    DE    +   G   + +PYV
Sbjct  349  DSLYAKLGSSYIDGGDEVDAASLLAGVSDKFYPYV  383



>ref|XP_002092223.1| GE14069 [Drosophila yakuba]
 gb|EDW91935.1| GE14069 [Drosophila yakuba]
Length=513

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 96/164 (59%), Gaps = 5/164 (3%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   + K E+ KLM D++  
Sbjct  342  IQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQ  401

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++++ P+ KS KR+R +L
Sbjct  402  FGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVL  461

Query  387  ESLCD-----SSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  271
              L       S+       ++    G   G +E  PYV + +N+
Sbjct  462  NQLYGHLDGVSAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  505



>ref|XP_003488765.1| PREDICTED: V-type proton ATPase subunit C-like [Bombus impatiens]
Length=591

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 98/166 (59%), Gaps = 7/166 (4%)
 Frame = -3

Query  747  LYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHESRKQELEKLMQDQETF  568
            + +D EY L+TVTLF +  D F++ ARE+ F +RDF YN E   + K E+ KL+ D++  
Sbjct  419  IAQDVEYGLFTVTLFKKVIDEFKLHAREKKFIVRDFTYNEEELAAGKNEITKLVTDKKKQ  478

Query  567  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvvlspsvkSEKRVRSIL  388
               L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++L P  K  +R+R +L
Sbjct  479  FGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILLHPHKKCARRLRDVL  538

Query  387  E---SLCDSSNST---YWKTEDEGAVGAFG-GDAEVHPYVSFTINL  271
                +  DSS +T       +D   +   G G  +  PYV + IN+
Sbjct  539  NQHYAHLDSSATTSSGAQGNQDSVDIPGLGFGQNDYFPYVYYKINV  584



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840