BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034C17

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594051.1|  PREDICTED: formin-binding protein 4 isoform X1     199   8e-55   Nicotiana tomentosiformis
ref|XP_009594052.1|  PREDICTED: formin-binding protein 4 isoform X2     199   8e-55   Nicotiana tomentosiformis
ref|XP_006352638.1|  PREDICTED: formin-binding protein 4-like           194   3e-53   Solanum tuberosum [potatoes]
ref|XP_009759140.1|  PREDICTED: formin-binding protein 4 isoform X2     192   9e-53   Nicotiana sylvestris
ref|XP_010327206.1|  PREDICTED: formin-binding protein 4 isoform X2     191   2e-52   Solanum lycopersicum
ref|XP_009759139.1|  PREDICTED: formin-binding protein 4 isoform X1     192   2e-52   Nicotiana sylvestris
ref|XP_004248291.1|  PREDICTED: formin-binding protein 4 isoform X1     191   4e-52   Solanum lycopersicum
ref|XP_011095580.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   1e-51   
gb|KHG11395.1|  Formin-binding 4                                        189   5e-51   Gossypium arboreum [tree cotton]
gb|KJB63036.1|  hypothetical protein B456_009G450800                    185   2e-50   Gossypium raimondii
gb|KJB63037.1|  hypothetical protein B456_009G450800                    185   1e-49   Gossypium raimondii
gb|KDP32612.1|  hypothetical protein JCGZ_13162                         184   3e-49   Jatropha curcas
ref|XP_002532512.1|  conserved hypothetical protein                     183   4e-49   Ricinus communis
ref|XP_010061427.1|  PREDICTED: uncharacterized protein LOC104449...    178   9e-48   Eucalyptus grandis [rose gum]
ref|XP_007020411.1|  WW domain-containing protein, putative isofo...    179   1e-47   
ref|XP_007140124.1|  hypothetical protein PHAVU_008G086000g             179   2e-47   Phaseolus vulgaris [French bean]
ref|XP_010061425.1|  PREDICTED: uncharacterized protein LOC104449...    178   2e-47   Eucalyptus grandis [rose gum]
ref|XP_010061424.1|  PREDICTED: uncharacterized protein LOC104449...    178   3e-47   Eucalyptus grandis [rose gum]
ref|XP_011038873.1|  PREDICTED: uncharacterized protein LOC105135...    176   1e-46   Populus euphratica
emb|CDP13682.1|  unnamed protein product                                176   1e-46   Coffea canephora [robusta coffee]
ref|XP_011038872.1|  PREDICTED: uncharacterized protein LOC105135...    175   4e-46   Populus euphratica
gb|KDO59208.1|  hypothetical protein CISIN_1g003934mg                   173   6e-46   Citrus sinensis [apfelsine]
ref|XP_010928059.1|  PREDICTED: histone acetyltransferase KAT6A i...    173   1e-45   Elaeis guineensis
ref|XP_006474823.1|  PREDICTED: uncharacterized protein LOC102614824    173   2e-45   Citrus sinensis [apfelsine]
ref|XP_009387310.1|  PREDICTED: formin-binding protein 4 isoform X2     171   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928058.1|  PREDICTED: uncharacterized protein LOC105049...    173   2e-45   Elaeis guineensis
ref|XP_008218730.1|  PREDICTED: uncharacterized protein LOC103319...    171   4e-45   Prunus mume [ume]
gb|EYU27458.1|  hypothetical protein MIMGU_mgv1a004181mg                169   4e-45   Erythranthe guttata [common monkey flower]
ref|XP_009387309.1|  PREDICTED: protein piccolo isoform X1              171   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008218722.1|  PREDICTED: formin-binding protein 4 isoform X1     171   6e-45   Prunus mume [ume]
ref|XP_006586155.1|  PREDICTED: uncharacterized protein LOC100791...    170   1e-44   Glycine max [soybeans]
ref|XP_006586154.1|  PREDICTED: uncharacterized protein LOC100791...    169   3e-44   Glycine max [soybeans]
ref|XP_006602115.1|  PREDICTED: uncharacterized protein LOC100805...    168   5e-44   Glycine max [soybeans]
ref|XP_010675975.1|  PREDICTED: uncharacterized protein LOC104891888    168   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006602114.1|  PREDICTED: uncharacterized protein LOC100805...    168   1e-43   Glycine max [soybeans]
ref|XP_007208104.1|  hypothetical protein PRUPE_ppa001027mg             168   1e-43   
ref|XP_010255738.1|  PREDICTED: formin-binding protein 4-like iso...    167   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010255737.1|  PREDICTED: formin-binding protein 4-like iso...    166   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010274245.1|  PREDICTED: uncharacterized protein LOC104609...    166   6e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010103959.1|  Formin-binding protein 4                           166   6e-43   
ref|XP_008463035.1|  PREDICTED: flocculation protein FLO11 isofor...    166   6e-43   
ref|XP_008800274.1|  PREDICTED: uncharacterized protein LOC103714...    166   6e-43   Phoenix dactylifera
ref|XP_008800273.1|  PREDICTED: uncharacterized protein LOC103714...    166   7e-43   Phoenix dactylifera
ref|XP_008463034.1|  PREDICTED: flocculation protein FLO11 isofor...    166   7e-43   Cucumis melo [Oriental melon]
ref|XP_010274244.1|  PREDICTED: uncharacterized protein LOC104609...    166   7e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008463033.1|  PREDICTED: flocculation protein FLO11 isofor...    166   8e-43   Cucumis melo [Oriental melon]
ref|XP_002300398.2|  hypothetical protein POPTR_0001s38050g             166   8e-43   
gb|KEH34105.1|  WW domain protein, putative                             164   2e-42   Medicago truncatula
gb|KEH34106.1|  WW domain protein, putative                             164   2e-42   Medicago truncatula
gb|KGN44384.1|  hypothetical protein Csa_7G276700                       163   5e-42   
gb|KEH34104.1|  WW domain protein, putative                             163   5e-42   Medicago truncatula
gb|KEH34103.1|  WW domain protein, putative                             163   5e-42   Medicago truncatula
ref|XP_004167069.1|  PREDICTED: uncharacterized protein LOC101223441    163   7e-42   
ref|XP_004149420.1|  PREDICTED: uncharacterized protein LOC101219916    163   7e-42   Cucumis sativus [cucumbers]
ref|XP_009367262.1|  PREDICTED: uncharacterized protein LOC103956...    162   9e-42   Pyrus x bretschneideri [bai li]
gb|EEC80443.1|  hypothetical protein OsI_22639                          161   2e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001057442.1|  Os06g0298400                                       161   2e-41   
gb|KHN31687.1|  hypothetical protein glysoja_022552                     161   2e-41   Glycine soja [wild soybean]
ref|XP_009367261.1|  PREDICTED: formin-binding protein 4 isoform X1     161   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_004498164.1|  PREDICTED: uncharacterized protein LOC101511...    161   2e-41   Cicer arietinum [garbanzo]
ref|XP_010542508.1|  PREDICTED: ENHANCER OF AG-4 protein 2 isofor...    160   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_008353129.1|  PREDICTED: uncharacterized protein LOC103416676    160   3e-41   
ref|XP_002884955.1|  hypothetical protein ARALYDRAFT_478706             160   3e-41   
ref|XP_010542506.1|  PREDICTED: formin-binding protein 4 isoform X6     160   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_010227748.1|  PREDICTED: formin-binding protein 4 isoform X2     160   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_010227749.1|  PREDICTED: formin-binding protein 4 isoform X3     160   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_010542503.1|  PREDICTED: ENHANCER OF AG-4 protein 2 isofor...    160   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_010542504.1|  PREDICTED: formin-binding protein 4 isoform X4     160   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_010542501.1|  PREDICTED: formin-binding protein 4 isoform X1     160   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_010542505.1|  PREDICTED: formin-binding protein 4 isoform X5     160   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_010542502.1|  PREDICTED: formin-binding protein 4 isoform X2     160   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_003563936.1|  PREDICTED: formin-binding protein 4 isoform X1     160   6e-41   Brachypodium distachyon [annual false brome]
ref|XP_004965269.1|  PREDICTED: formin-binding protein 4-like iso...    158   9e-41   Setaria italica
ref|XP_009124732.1|  PREDICTED: formin-binding protein 4 isoform X4     158   2e-40   Brassica rapa
emb|CDY43359.1|  BnaA01g29900D                                          159   2e-40   Brassica napus [oilseed rape]
ref|XP_009124731.1|  PREDICTED: formin-binding protein 4 isoform X3     158   2e-40   Brassica rapa
ref|XP_009124729.1|  PREDICTED: formin-binding protein 4 isoform X1     158   2e-40   Brassica rapa
ref|XP_009124730.1|  PREDICTED: formin-binding protein 4 isoform X2     158   3e-40   
ref|XP_004965268.1|  PREDICTED: formin-binding protein 4-like iso...    157   4e-40   Setaria italica
gb|ADE75782.1|  unknown                                                 150   5e-40   Picea sitchensis
emb|CDY24199.1|  BnaC01g37790D                                          156   2e-39   Brassica napus [oilseed rape]
ref|XP_006407247.1|  hypothetical protein EUTSA_v10020110mg             155   2e-39   
ref|XP_011461600.1|  PREDICTED: uncharacterized protein LOC101298...    155   2e-39   Fragaria vesca subsp. vesca
ref|XP_006656031.1|  PREDICTED: formin-binding protein 4-like iso...    154   3e-39   Oryza brachyantha
ref|XP_004294901.2|  PREDICTED: formin-binding protein 4 isoform X1     154   5e-39   Fragaria vesca subsp. vesca
ref|XP_006656030.1|  PREDICTED: formin-binding protein 4-like iso...    154   6e-39   Oryza brachyantha
gb|EMT11848.1|  hypothetical protein F775_13332                         154   1e-38   
ref|XP_008358896.1|  PREDICTED: formin-binding protein 4-like           154   1e-38   
ref|XP_008384608.1|  PREDICTED: formin-binding protein 4                153   2e-38   
gb|KHN11174.1|  hypothetical protein glysoja_039437                     152   4e-38   Glycine soja [wild soybean]
ref|XP_007020413.1|  WW domain-containing protein, putative isofo...    152   5e-38   
ref|XP_010465144.1|  PREDICTED: formin-binding protein 4-like iso...    151   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010465146.1|  PREDICTED: formin-binding protein 4-like iso...    151   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010644626.1|  PREDICTED: uncharacterized protein LOC100249...    152   7e-38   Vitis vinifera
emb|CBI39790.3|  unnamed protein product                                151   7e-38   Vitis vinifera
gb|KFK38660.1|  hypothetical protein AALP_AA3G143500                    151   7e-38   Arabis alpina [alpine rockcress]
ref|XP_010644625.1|  PREDICTED: uncharacterized protein LOC100249...    151   8e-38   Vitis vinifera
gb|KFK38659.1|  hypothetical protein AALP_AA3G143500                    151   9e-38   Arabis alpina [alpine rockcress]
ref|XP_006857706.1|  hypothetical protein AMTR_s00061p00171230          151   9e-38   Amborella trichopoda
ref|XP_006296953.1|  hypothetical protein CARUB_v10012949mg             150   1e-37   Capsella rubella
ref|XP_010465143.1|  PREDICTED: formin-binding protein 4-like iso...    151   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006296954.1|  hypothetical protein CARUB_v10012949mg             150   2e-37   Capsella rubella
ref|NP_187930.2|  WW domain-containing protein                          148   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154613.1|  WW domain-containing protein                       148   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AFW86408.1|  hypothetical protein ZEAMMB73_868308                    143   5e-36   
ref|XP_002436906.1|  hypothetical protein SORBIDRAFT_10g010870          145   8e-36   
ref|XP_010487073.1|  PREDICTED: formin-binding protein 4-like           144   2e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001146286.1|  uncharacterized protein LOC100279861               142   8e-35   Zea mays [maize]
ref|XP_008658490.1|  PREDICTED: uncharacterized protein LOC100279...    142   9e-35   Zea mays [maize]
gb|EEE65564.1|  hypothetical protein OsJ_21058                          140   4e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EPS69239.1|  hypothetical protein M569_05527                         129   1e-33   Genlisea aurea
dbj|BAB03122.1|  unnamed protein product                                138   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EMS61112.1|  hypothetical protein TRIUR3_25390                       135   4e-32   Triticum urartu
ref|XP_004498163.1|  PREDICTED: uncharacterized protein LOC101511...    132   3e-31   
ref|XP_010418959.1|  PREDICTED: uncharacterized protein LOC104704597    121   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_001760339.1|  predicted protein                                  119   2e-26   
ref|XP_006452661.1|  hypothetical protein CICLE_v10007493mg             111   6e-24   
gb|KCW68367.1|  hypothetical protein EUGRSUZ_F02026                     109   3e-23   Eucalyptus grandis [rose gum]
ref|XP_007020416.1|  WW domain-containing protein, putative isofo...    108   5e-23   
ref|XP_010061426.1|  PREDICTED: uncharacterized protein LOC104449...    105   7e-22   Eucalyptus grandis [rose gum]
ref|XP_002979087.1|  hypothetical protein SELMODRAFT_418782             102   3e-21   
ref|XP_002993992.1|  hypothetical protein SELMODRAFT_431966             102   3e-21   
ref|XP_005648919.1|  hypothetical protein COCSUDRAFT_83679              101   1e-20   Coccomyxa subellipsoidea C-169
emb|CAN72861.1|  hypothetical protein VITISV_026660                   88.6    3e-16   Vitis vinifera
ref|XP_007020417.1|  WW domain-containing protein, putative isofo...  77.0    2e-12   
ref|XP_007020415.1|  WW domain-containing protein, putative isofo...  77.0    2e-12   
ref|XP_005851747.1|  hypothetical protein CHLNCDRAFT_133122           62.8    5e-08   Chlorella variabilis
ref|XP_007910560.1|  PREDICTED: formin-binding protein 4              55.5    2e-05   Callorhinchus milii [Australian ghost shark]
emb|CEG00791.1|  WW domain                                            52.8    2e-05   Ostreococcus tauri
gb|KIZ05972.1|  hypothetical protein MNEG_1980                        53.9    5e-05   Monoraphidium neglectum
ref|XP_010227751.1|  PREDICTED: formin-binding protein 4 isoform X4   40.8    1e-04   Brachypodium distachyon [annual false brome]
ref|XP_003967430.1|  PREDICTED: formin-binding protein 4-like         52.8    1e-04   
ref|XP_010403680.1|  PREDICTED: formin-binding protein 4              52.4    2e-04   
ref|XP_002955634.1|  hypothetical protein VOLCADRAFT_106914           52.4    2e-04   Volvox carteri f. nagariensis
ref|XP_002127483.1|  PREDICTED: formin-binding protein 4-like         52.4    2e-04   Ciona intestinalis [sea vase]
ref|XP_007432656.1|  PREDICTED: formin-binding protein 4              52.4    2e-04   
ref|XP_004914259.1|  PREDICTED: formin-binding protein 4-like         51.6    4e-04   
ref|XP_008071879.1|  PREDICTED: formin-binding protein 4-like         50.8    4e-04   
ref|XP_006984450.1|  PREDICTED: formin-binding protein 4              51.6    4e-04   Peromyscus maniculatus bairdii
ref|XP_004941312.1|  PREDICTED: formin-binding protein 4 isoform X13  51.2    4e-04   
ref|XP_010610971.1|  PREDICTED: formin-binding protein 4              51.2    4e-04   
ref|XP_005529187.1|  PREDICTED: formin-binding protein 4              51.2    5e-04   
ref|XP_008631485.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  51.2    5e-04   
ref|XP_009095510.1|  PREDICTED: formin-binding protein 4              51.2    5e-04   
ref|XP_010562680.1|  PREDICTED: formin-binding protein 4              51.2    5e-04   Haliaeetus leucocephalus
ref|XP_005496963.1|  PREDICTED: formin-binding protein 4              51.2    5e-04   
ref|XP_004174565.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  51.2    5e-04   
ref|XP_005426589.1|  PREDICTED: formin-binding protein 4              50.8    5e-04   
ref|XP_005046801.1|  PREDICTED: formin-binding protein 4              50.8    5e-04   
ref|XP_005987018.1|  PREDICTED: formin-binding protein 4-like         50.8    5e-04   
ref|XP_424260.4|  PREDICTED: formin-binding protein 4 isoform X9      50.8    6e-04   
ref|XP_004619146.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   Sorex araneus [Eurasian shrew]
ref|XP_009680890.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   Struthio camelus australis
ref|XP_009890763.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   Charadrius vociferus
ref|XP_008504314.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.8    6e-04   
ref|XP_010709208.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   
gb|ETE72718.1|  Formin-binding protein 4                              50.8    6e-04   Ophiophagus hannah
ref|XP_009472269.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   Nipponia nippon
ref|XP_005690276.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   
ref|XP_005984649.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.8    6e-04   
ref|XP_005514896.1|  PREDICTED: formin-binding protein 4              50.8    6e-04   
ref|XP_008841852.1|  PREDICTED: formin-binding protein 4              50.8    7e-04   Nannospalax galili
ref|XP_008572269.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.8    7e-04   Galeopterus variegatus [Malayan flying lemur]
gb|EGW03959.1|  Formin-binding protein 4                              50.8    7e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_007608875.1|  PREDICTED: formin-binding protein 4 isoform X1   50.8    7e-04   
gb|EPQ10535.1|  Formin-binding protein 4                              50.8    7e-04   Myotis brandtii
ref|XP_004585382.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.8    7e-04   
ref|XP_006157913.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    7e-04   
ref|XP_005438440.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   
ref|XP_010219680.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Tinamus guttatus
ref|XP_009565112.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Cuculus canorus
ref|XP_009278792.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    7e-04   
ref|XP_005064618.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   
ref|XP_005577974.1|  PREDICTED: formin-binding protein 4 isoform X3   50.4    7e-04   Macaca fascicularis [crab eating macaque]
ref|XP_005870929.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    7e-04   Myotis brandtii
ref|XP_010811181.1|  PREDICTED: formin-binding protein 4 isoform X2   50.8    7e-04   
gb|ELW48873.1|  Formin-binding protein 4                              50.4    7e-04   Tupaia chinensis
ref|XP_011355314.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Pteropus vampyrus
ref|XP_009184334.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   
ref|XP_006865168.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Chrysochloris asiatica
ref|XP_006908190.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Pteropus alecto
gb|EHH56277.1|  Formin-binding protein 30                             50.4    7e-04   Macaca fascicularis [crab eating macaque]
ref|XP_007123822.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   
ref|XP_007082258.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Panthera tigris altaica
gb|ELK23839.1|  Formin-binding protein 4                              50.4    7e-04   Myotis davidii
ref|XP_003781357.1|  PREDICTED: formin-binding protein 4              50.4    7e-04   Otolemur garnettii
ref|XP_007497493.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    8e-04   Monodelphis domestica
ref|XP_007455781.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Lipotes vexillifer [baiji]
ref|XP_007181320.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_010840760.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Bison bison bison
ref|XP_004458039.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_005364254.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_004016511.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
emb|CAF98248.1|  unnamed protein product                              50.1    8e-04   Tetraodon nigroviridis
ref|XP_009898310.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   Picoides pubescens
ref|XP_003773809.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_004657307.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Jaculus jaculus
ref|XP_004264160.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Orcinus orca [Orca]
ref|XP_006748335.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    8e-04   Leptonychotes weddellii
ref|XP_004399566.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Odobenus rosmarus divergens
ref|XP_007497492.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Monodelphis domestica
ref|XP_011285148.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    8e-04   Felis catus [cat]
ref|XP_008917822.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_002921697.2|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_004682869.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Condylura cristata
ref|XP_006772377.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Myotis davidii
ref|XP_006212307.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_010335732.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Saimiri boliviensis boliviensis
ref|XP_006748334.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Leptonychotes weddellii
ref|XP_009006355.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Callithrix jacchus [common marmoset]
dbj|BAB14348.1|  unnamed protein product                              50.4    8e-04   Homo sapiens [man]
ref|XP_006092154.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_005577973.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    8e-04   Macaca fascicularis [crab eating macaque]
ref|XP_008699305.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Ursus maritimus [white bear]
ref|XP_004897606.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_004763090.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_005577972.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Macaca fascicularis [crab eating macaque]
ref|XP_004437020.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ELR46049.1|  Formin-binding protein 4                              50.4    8e-04   Bos mutus
ref|XP_008268954.1|  PREDICTED: formin-binding protein 4 isoform X3   50.4    8e-04   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006190347.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_010369442.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    8e-04   Rhinopithecus roxellana
ref|XP_540739.3|  PREDICTED: formin-binding protein 4 isoform X3      50.4    8e-04   Canis lupus familiaris [dogs]
ref|XP_011474945.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_007664750.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_007619634.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_010821225.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_008109909.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
ref|XP_010369441.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Rhinopithecus roxellana
ref|XP_011285147.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Felis catus [cat]
ref|XP_008536737.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   Equus przewalskii [Przewalski horse]
ref|XP_008145202.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_009244653.1|  PREDICTED: formin-binding protein 4              50.4    8e-04   
ref|XP_005631279.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Canis lupus familiaris [dogs]
ref|XP_008268943.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    8e-04   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007519094.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    8e-04   
emb|CAB70761.1|  hypothetical protein                                 50.4    8e-04   Homo sapiens [man]
gb|AAH37404.1|  Formin binding protein 4                              50.4    8e-04   Homo sapiens [man]
dbj|BAC98073.2|  mKIAA1014 protein                                    50.4    8e-04   Mus musculus [mouse]
ref|XP_004051127.1|  PREDICTED: formin-binding protein 4              50.4    9e-04   
ref|XP_006057462.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    9e-04   
ref|XP_005631280.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    9e-04   Canis lupus familiaris [dogs]
ref|XP_003465203.2|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    9e-04   Cavia porcellus [guinea pig]
gb|EAW67887.1|  formin binding protein 4, isoform CRA_d               50.4    9e-04   Homo sapiens [man]
ref|XP_004387776.1|  PREDICTED: formin-binding protein 4              50.4    9e-04   
ref|XP_010590359.1|  PREDICTED: formin-binding protein 4              50.4    9e-04   Loxodonta africana [African bush elephant]
sp|Q6ZQ03.2|FNBP4_MOUSE  RecName: Full=Formin-binding protein 4; ...  50.4    9e-04   Mus musculus [mouse]
ref|XP_009458647.1|  PREDICTED: formin-binding protein 4 isoform X3   50.4    9e-04   
dbj|BAA76858.2|  KIAA1014 protein                                     50.4    9e-04   
ref|XP_008268948.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    9e-04   Oryctolagus cuniculus [domestic rabbit]
ref|XP_508418.3|  PREDICTED: formin-binding protein 4 isoform X2      50.4    9e-04   
ref|XP_006057461.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    9e-04   Bubalus bubalis [domestic water buffalo]
ref|XP_007068505.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    9e-04   
ref|XP_005022222.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    9e-04   
ref|XP_005243464.1|  PREDICTED: formin-binding protein 4              50.4    9e-04   
ref|NP_061298.1|  formin-binding protein 4                            50.4    9e-04   
ref|NP_056123.2|  formin-binding protein 4                            50.4    9e-04   Homo sapiens [man]
ref|XP_010963325.1|  PREDICTED: formin-binding protein 4              50.4    9e-04   Camelus bactrianus [camel]
ref|XP_005252890.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    9e-04   
ref|XP_006896823.1|  PREDICTED: formin-binding protein 4              50.4    9e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009458646.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    9e-04   
ref|XP_004708500.1|  PREDICTED: formin-binding protein 4              50.4    0.001   
ref|XP_010999018.1|  PREDICTED: formin-binding protein 4              50.4    0.001   
ref|XP_005598182.1|  PREDICTED: formin-binding protein 4              50.4    0.001   
ref|XP_004851869.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    0.001   
gb|EMP27691.1|  Formin-binding protein 4                              50.4    0.001   Chelonia mydas [green seaturtle]
ref|XP_008169919.1|  PREDICTED: formin-binding protein 4 isoform X2   50.4    0.001   Chrysemys picta bellii
ref|NP_001013177.2|  formin binding protein 4                         50.4    0.001   Rattus norvegicus [brown rat]
ref|XP_006234567.1|  PREDICTED: formin-binding protein 4 isoform X1   50.4    0.001   Rattus norvegicus [brown rat]
ref|XP_008966419.1|  PREDICTED: formin-binding protein 4              50.4    0.001   
ref|XP_005330019.1|  PREDICTED: formin-binding protein 4              50.4    0.001   Ictidomys tridecemlineatus
ref|XP_005909883.1|  PREDICTED: LOW QUALITY PROTEIN: formin-bindi...  50.4    0.001   
ref|XP_005295040.1|  PREDICTED: formin-binding protein 4 isoform X1   50.1    0.001   Chrysemys picta bellii
ref|XP_006110987.1|  PREDICTED: formin-binding protein 4 isoform X3   50.1    0.001   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006110985.1|  PREDICTED: formin-binding protein 4 isoform X1   50.1    0.001   Pelodiscus sinensis [Chinese softshell turtle]



>ref|XP_009594051.1| PREDICTED: formin-binding protein 4 isoform X1 [Nicotiana tomentosiformis]
Length=928

 Score =   199 bits (506),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV+R KK T  V STLRSNKKVS+LVDKWKAAKEELHA EEEE  S  E LEKKRQR
Sbjct  774  VQSKVSRNKKRTTGVVSTLRSNKKVSSLVDKWKAAKEELHAGEEEEPESVLEKLEKKRQR  833

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRA+QIASGEAK+NANFQPLGGDWRERVKR+RAEKM+E EK+P   +EEN+QPDLN
Sbjct  834  EIEEWRAKQIASGEAKENANFQPLGGDWRERVKRKRAEKMREAEKQP---SEENEQPDLN  890

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             LS GLPSGWQAYWD+S+KQVYYGNA 
Sbjct  891  VLSRGLPSGWQAYWDDSTKQVYYGNAV  917



>ref|XP_009594052.1| PREDICTED: formin-binding protein 4 isoform X2 [Nicotiana tomentosiformis]
Length=912

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV+R KK T  V STLRSNKKVS+LVDKWKAAKEELHA EEEE  S  E LEKKRQR
Sbjct  758  VQSKVSRNKKRTTGVVSTLRSNKKVSSLVDKWKAAKEELHAGEEEEPESVLEKLEKKRQR  817

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRA+QIASGEAK+NANFQPLGGDWRERVKR+RAEKM+E EK+P   +EEN+QPDLN
Sbjct  818  EIEEWRAKQIASGEAKENANFQPLGGDWRERVKRKRAEKMREAEKQP---SEENEQPDLN  874

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             LS GLPSGWQAYWD+S+KQVYYGNA 
Sbjct  875  VLSRGLPSGWQAYWDDSTKQVYYGNAV  901



>ref|XP_006352638.1| PREDICTED: formin-binding protein 4-like [Solanum tuberosum]
Length=907

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 4/146 (3%)
 Frame = -2

Query  671  PSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            PSKV RKK+ TV V +TLRSNKKVS+LVDKWKAAKEELHAEEEEER SA E LEKKRQRE
Sbjct  755  PSKVLRKKR-TVGVVTTLRSNKKVSSLVDKWKAAKEELHAEEEEERESALEKLEKKRQRE  813

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEWRAQQIASGEAKDNANFQPLGGDWRERVKR+R EKM+E EK+P   +EEN+QPDL+ 
Sbjct  814  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRKRVEKMREAEKQP---SEENEQPDLDV  870

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            +S  LPSGWQAYWD+S+KQVYYGN A
Sbjct  871  ISRDLPSGWQAYWDDSTKQVYYGNTA  896



>ref|XP_009759140.1| PREDICTED: formin-binding protein 4 isoform X2 [Nicotiana sylvestris]
Length=840

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV+R KK T  V STLRSNKKVS+LVDKWKAAKEELHAEEEE ++   ++  KKRQR
Sbjct  687  VQSKVSRNKKRTTGVVSTLRSNKKVSSLVDKWKAAKEELHAEEEEPKSVLEKLE-KKRQR  745

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRA+QIASGEAK+NANFQPLGGDWRERVKR+RAEKM+E EK+P   +EEN+QPDL+
Sbjct  746  EIEEWRAKQIASGEAKENANFQPLGGDWRERVKRKRAEKMREAEKQP---SEENEQPDLD  802

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             LS GLPSGWQAYWD+S+KQVYYGNA 
Sbjct  803  VLSRGLPSGWQAYWDDSTKQVYYGNAV  829



>ref|XP_010327206.1| PREDICTED: formin-binding protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_010327207.1| PREDICTED: formin-binding protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_010327208.1| PREDICTED: formin-binding protein 4 isoform X2 [Solanum lycopersicum]
Length=821

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 4/147 (3%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            VPSKV RKK+ TV V STLRSNKKVS+LVDKWKAAKEELHAEEEEER SA + LEKKRQR
Sbjct  668  VPSKVLRKKR-TVGVVSTLRSNKKVSSLVDKWKAAKEELHAEEEEERESALDKLEKKRQR  726

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKR+R EKM+E EK+    +EEN+QPDL+
Sbjct  727  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRKRVEKMREAEKQL---SEENEQPDLD  783

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             +S GLPSGW+AYWD+S+KQVYYG A 
Sbjct  784  VISRGLPSGWKAYWDDSTKQVYYGKAV  810



>ref|XP_009759139.1| PREDICTED: formin-binding protein 4 isoform X1 [Nicotiana sylvestris]
Length=907

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV+R KK T  V STLRSNKKVS+LVDKWKAAKEELHAEEEE ++   ++  KKRQR
Sbjct  754  VQSKVSRNKKRTTGVVSTLRSNKKVSSLVDKWKAAKEELHAEEEEPKSVLEKLE-KKRQR  812

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRA+QIASGEAK+NANFQPLGGDWRERVKR+RAEKM+E EK+P   +EEN+QPDL+
Sbjct  813  EIEEWRAKQIASGEAKENANFQPLGGDWRERVKRKRAEKMREAEKQP---SEENEQPDLD  869

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             LS GLPSGWQAYWD+S+KQVYYGNA 
Sbjct  870  VLSRGLPSGWQAYWDDSTKQVYYGNAV  896



>ref|XP_004248291.1| PREDICTED: formin-binding protein 4 isoform X1 [Solanum lycopersicum]
Length=888

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 4/147 (3%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            VPSKV RKK+ TV V STLRSNKKVS+LVDKWKAAKEELHAEEEEER SA + LEKKRQR
Sbjct  735  VPSKVLRKKR-TVGVVSTLRSNKKVSSLVDKWKAAKEELHAEEEEERESALDKLEKKRQR  793

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKR+R EKM+E EK+    +EEN+QPDL+
Sbjct  794  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRKRVEKMREAEKQL---SEENEQPDLD  850

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             +S GLPSGW+AYWD+S+KQVYYG A 
Sbjct  851  VISRGLPSGWKAYWDDSTKQVYYGKAV  877



>ref|XP_011095580.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105174988 
[Sesamum indicum]
Length=950

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  665  KVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREIE  486
            KV R KK TVAV STLRSNKKVS+LVDKWKAAKEELH EEEE   +   +  KKRQREIE
Sbjct  796  KVPRGKKRTVAVVSTLRSNKKVSSLVDKWKAAKEELHEEEEEPEDAYEILE-KKRQREIE  854

Query  485  EWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEE-NQQPDLNAL  309
            EWRAQQIASGEAKDNANFQPLGGDWRERVKR+RAEKMKE E+  +D   + NQQPDL  L
Sbjct  855  EWRAQQIASGEAKDNANFQPLGGDWRERVKRKRAEKMKEAEQSSSDAAADGNQQPDLEEL  914

Query  308  SIGLPSGWQAYWDESSKQVYYGN  240
            S GLPSGWQ YWDESSKQVYYGN
Sbjct  915  SKGLPSGWQVYWDESSKQVYYGN  937



>gb|KHG11395.1| Formin-binding 4 [Gossypium arboreum]
Length=946

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK AR KK TVAV S+LRSNKKVS+LVDKWKAAKEEL    E+E  +AYE LEKKRQR
Sbjct  789  VQSKAARTKKRTVAVTSSLRSNKKVSSLVDKWKAAKEELQENAEDEPENAYEKLEKKRQR  848

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEW AQQ+ASGEAKDNANFQPLGGDWRE+VKRRRA+K KE+ + P    + NQQPDL+
Sbjct  849  EIEEWHAQQLASGEAKDNANFQPLGGDWREKVKRRRAQKAKESAETPVAHPDGNQQPDLD  908

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS GLPSGWQAYWDE+SKQ YYGN
Sbjct  909  ELSRGLPSGWQAYWDEASKQPYYGN  933



>gb|KJB63036.1| hypothetical protein B456_009G450800 [Gossypium raimondii]
Length=758

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 7/149 (5%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK AR KK TVAV S+LRSNKKVS+LVDKWKAAKEEL    E+E  +AYE LEKKRQR
Sbjct  600  VQSKAARTKKRTVAVTSSLRSNKKVSSLVDKWKAAKEELQENAEDEPENAYEKLEKKRQR  659

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPT----DGTEENQQ  327
            EIEEW AQQ+ASGEAKDNANFQPLGGDWRE+VKRRRA+K KE+ + P+    DG   NQQ
Sbjct  660  EIEEWHAQQLASGEAKDNANFQPLGGDWREKVKRRRAQKAKESTETPSVAHPDG---NQQ  716

Query  326  PDLNALSIGLPSGWQAYWDESSKQVYYGN  240
            PDL+ LS GLPSGWQAYWDE+SKQ YYGN
Sbjct  717  PDLDELSRGLPSGWQAYWDEASKQPYYGN  745



>gb|KJB63037.1| hypothetical protein B456_009G450800 [Gossypium raimondii]
Length=944

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 7/149 (5%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK AR KK TVAV S+LRSNKKVS+LVDKWKAAKEEL    E+E  +AYE LEKKRQR
Sbjct  786  VQSKAARTKKRTVAVTSSLRSNKKVSSLVDKWKAAKEELQENAEDEPENAYEKLEKKRQR  845

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPT----DGTEENQQ  327
            EIEEW AQQ+ASGEAKDNANFQPLGGDWRE+VKRRRA+K KE+ + P+    DG   NQQ
Sbjct  846  EIEEWHAQQLASGEAKDNANFQPLGGDWREKVKRRRAQKAKESTETPSVAHPDG---NQQ  902

Query  326  PDLNALSIGLPSGWQAYWDESSKQVYYGN  240
            PDL+ LS GLPSGWQAYWDE+SKQ YYGN
Sbjct  903  PDLDELSRGLPSGWQAYWDEASKQPYYGN  931



>gb|KDP32612.1| hypothetical protein JCGZ_13162 [Jatropha curcas]
Length=951

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV  +LRSNKKVS+LVDKWKAAKEEL+  EE+E  +AYEILE+KRQREI
Sbjct  797  AKVTRSKKRAVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEDEPENAYEILERKRQREI  856

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEW A+QIASGEAKDNANFQPLGGDWRERVKRRRA+  KE  + P+   EEN+QPDL  L
Sbjct  857  EEWHAKQIASGEAKDNANFQPLGGDWRERVKRRRAQAAKEAARTPSP-VEENKQPDLAEL  915

Query  308  SIGLPSGWQAYWDESSKQVYYGNA  237
            S GLPSGWQAYWDE+SKQVYYGNA
Sbjct  916  SKGLPSGWQAYWDEASKQVYYGNA  939



>ref|XP_002532512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29864.1| conserved hypothetical protein [Ricinus communis]
Length=964

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV+R KK TVAV S+LRSNKKVS+LVDKWKAAKEEL+  EE+E  +AYEILE+KRQREI
Sbjct  808  SKVSRTKKRTVAVASSLRSNKKVSSLVDKWKAAKEELNENEEDEPENAYEILERKRQREI  867

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGT-EENQQPDLNA  312
            EEWRA+QIASGEAKDNANFQPLGGDWRERVKRRRA+  KE  + P++ +   NQQ DL  
Sbjct  868  EEWRAKQIASGEAKDNANFQPLGGDWRERVKRRRAQAAKEAAQLPSEASIVANQQLDLAE  927

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS GLPSGWQAYWDE+SKQVYYGN
Sbjct  928  LSKGLPSGWQAYWDEASKQVYYGN  951



>ref|XP_010061427.1| PREDICTED: uncharacterized protein LOC104449101 isoform X4 [Eucalyptus 
grandis]
 gb|KCW68366.1| hypothetical protein EUGRSUZ_F02026 [Eucalyptus grandis]
Length=792

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL  ++E+E  +A  +LEKKRQR
Sbjct  635  VQSKVLRSKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELQEDDEDEAKTALALLEKKRQR  694

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRAQQIASGEAK+NANFQPLGGDWRERVKR+RA+  +E  +      + NQQP L 
Sbjct  695  EIEEWRAQQIASGEAKENANFQPLGGDWRERVKRKRAQAAREAVQNQEQSNDGNQQPSLV  754

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS  LPSGWQAYWDESSKQVYYGN
Sbjct  755  ELSRSLPSGWQAYWDESSKQVYYGN  779



>ref|XP_007020411.1| WW domain-containing protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007020412.1| WW domain-containing protein, putative isoform 1 [Theobroma cacao]
 gb|EOY11936.1| WW domain-containing protein, putative isoform 1 [Theobroma cacao]
 gb|EOY11937.1| WW domain-containing protein, putative isoform 1 [Theobroma cacao]
Length=922

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK AR KK TVA  S+LRSNKKVS+LVDKWKAAKEELH   E+E  + Y +LE+KRQR
Sbjct  763  VSSKAARTKKRTVAATSSLRSNKKVSSLVDKWKAAKEELHENAEDEPENPYAMLERKRQR  822

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRA-EKMKETEKKPTDGTEE-NQQPD  321
            EIEEWRAQQIASGEAKDNANFQPLGGDWRE+VKRRRA +K KE  + P++   + N+QPD
Sbjct  823  EIEEWRAQQIASGEAKDNANFQPLGGDWREKVKRRRAQQKAKEAAETPSEVVPDGNEQPD  882

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGNA  237
            L+ LS  LPSGWQAYWDE+SKQVYYGN 
Sbjct  883  LDELSRDLPSGWQAYWDETSKQVYYGNV  910



>ref|XP_007140124.1| hypothetical protein PHAVU_008G086000g [Phaseolus vulgaris]
 gb|ESW12118.1| hypothetical protein PHAVU_008G086000g [Phaseolus vulgaris]
Length=934

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEE+  EEEEE  S YE LE+KRQREI
Sbjct  778  SKVVRTRKRAVAVGSSLKSNKKVSSLVDKWKAAKEEMLEEEEEEPDSVYEALERKRQREI  837

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPLGGDWRE+VKR+RA+  KE+  KP D  ++N QQPD N 
Sbjct  838  EEWHAKQIASGEAKDNANFQPLGGDWREKVKRKRAQAAKESVSKPQDAIKQNQQQPDPNE  897

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            L+ GLPS WQAYWD+S+KQVYYGN
Sbjct  898  LAKGLPSNWQAYWDDSTKQVYYGN  921



>ref|XP_010061425.1| PREDICTED: uncharacterized protein LOC104449101 isoform X2 [Eucalyptus 
grandis]
Length=891

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL  ++E+E  +A  +LEKKRQR
Sbjct  734  VQSKVLRSKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELQEDDEDEAKTALALLEKKRQR  793

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRAQQIASGEAK+NANFQPLGGDWRERVKR+RA+  +E  +      + NQQP L 
Sbjct  794  EIEEWRAQQIASGEAKENANFQPLGGDWRERVKRKRAQAAREAVQNQEQSNDGNQQPSLV  853

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS  LPSGWQAYWDESSKQVYYGN
Sbjct  854  ELSRSLPSGWQAYWDESSKQVYYGN  878



>ref|XP_010061424.1| PREDICTED: uncharacterized protein LOC104449101 isoform X1 [Eucalyptus 
grandis]
Length=929

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL  ++E+E  +A  +LEKKRQR
Sbjct  772  VQSKVLRSKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELQEDDEDEAKTALALLEKKRQR  831

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIEEWRAQQIASGEAK+NANFQPLGGDWRERVKR+RA+  +E  +      + NQQP L 
Sbjct  832  EIEEWRAQQIASGEAKENANFQPLGGDWRERVKRKRAQAAREAVQNQEQSNDGNQQPSLV  891

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS  LPSGWQAYWDESSKQVYYGN
Sbjct  892  ELSRSLPSGWQAYWDESSKQVYYGN  916



>ref|XP_011038873.1| PREDICTED: uncharacterized protein LOC105135610 isoform X2 [Populus 
euphratica]
Length=856

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V +KV+RKK+ TVAV  +LRSNKKVS+LVDKWKAAKEEL+  EEE +++      KKRQR
Sbjct  700  VQTKVSRKKR-TVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEEPKSAYEIFE-KKRQR  757

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG-TEENQQPDL  318
            EIEEW A+QIASGEAKDNANFQPLGGDWRERVKRRRA+  KE    P +  T+EN+QPDL
Sbjct  758  EIEEWHAKQIASGEAKDNANFQPLGGDWRERVKRRRAQAAKEAALIPPEAPTDENKQPDL  817

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNA  237
              LS GLPSGWQ YWD SSKQVYYGN 
Sbjct  818  EELSKGLPSGWQVYWDGSSKQVYYGNV  844



>emb|CDP13682.1| unnamed protein product [Coffea canephora]
Length=957

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TVAV S+LRSNKKVS+LVDKWKAAKEEL  +E+E   +   +  KKRQR+I
Sbjct  802  SKVQRSKKRTVAVVSSLRSNKKVSSLVDKWKAAKEELQEDEKEPENAYEILE-KKRQRQI  860

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGT-EENQQPDLNA  312
            EEW AQQIASGEAKDNANFQPLGGDWRERVKR+RA   KE+ + P D   E NQQPDL  
Sbjct  861  EEWHAQQIASGEAKDNANFQPLGGDWRERVKRKRARLAKESVQTPKDDVFEGNQQPDLGE  920

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS GLP GWQAYWD SSKQVYYGN
Sbjct  921  LSKGLPRGWQAYWDVSSKQVYYGN  944



>ref|XP_011038872.1| PREDICTED: uncharacterized protein LOC105135610 isoform X1 [Populus 
euphratica]
Length=976

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V +KV+RKK+ TVAV  +LRSNKKVS+LVDKWKAAKEEL+  EEE +++      KKRQR
Sbjct  820  VQTKVSRKKR-TVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEEPKSAYEIFE-KKRQR  877

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG-TEENQQPDL  318
            EIEEW A+QIASGEAKDNANFQPLGGDWRERVKRRRA+  KE    P +  T+EN+QPDL
Sbjct  878  EIEEWHAKQIASGEAKDNANFQPLGGDWRERVKRRRAQAAKEAALIPPEAPTDENKQPDL  937

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNA  237
              LS GLPSGWQ YWD SSKQVYYGN 
Sbjct  938  EELSKGLPSGWQVYWDGSSKQVYYGNV  964



>gb|KDO59208.1| hypothetical protein CISIN_1g003934mg [Citrus sinensis]
Length=785

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL+  EE+E  +AYEILE+KRQR
Sbjct  627  VQSKV-RNKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEDEPENAYEILERKRQR  685

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQ--PD  321
            EIEEWRAQQIASGEAKDNANFQPLGGDWRE+VKRRRA+  KE  + P +   + +Q  PD
Sbjct  686  EIEEWRAQQIASGEAKDNANFQPLGGDWREKVKRRRAQLAKEAAETPPEAEADQKQEKPD  745

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGN  240
            L  LS  LPSGWQAYWDESSKQ+YYGN
Sbjct  746  LVDLSKDLPSGWQAYWDESSKQIYYGN  772



>ref|XP_010928059.1| PREDICTED: histone acetyltransferase KAT6A isoform X2 [Elaeis 
guineensis]
Length=872

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR KK TVAV  TLRSNKKVS+LVDKWKAAKEELH  E+EE  +AYEILEKKRQ+EI
Sbjct  715  SKVARSKKRTVAVAPTLRSNKKVSSLVDKWKAAKEELHGNEDEEPENAYEILEKKRQKEI  774

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            EEWR +QIASGEA+DNANF PLGGDWRERVKRRRAE   E  + P +   EN+  QPDL 
Sbjct  775  EEWRTRQIASGEAQDNANFVPLGGDWRERVKRRRAETKAEAGEAPREQGVENEKKQPDLV  834

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNA  237
             LS  LPSGWQAYWDES+K+VYYGN+
Sbjct  835  QLSKDLPSGWQAYWDESTKEVYYGNS  860



>ref|XP_006474823.1| PREDICTED: uncharacterized protein LOC102614824 [Citrus sinensis]
Length=945

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL+  EE+E  +AYEILE+KRQR
Sbjct  787  VQSKV-RNKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEDEPENAYEILERKRQR  845

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQ--PD  321
            EIEEWRAQQIASGEAKDNANFQPLGGDWRE+VKRRRA+  KE  + P +   + +Q  PD
Sbjct  846  EIEEWRAQQIASGEAKDNANFQPLGGDWREKVKRRRAQLAKEAAETPPEAEADQKQEKPD  905

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGN  240
            L  LS  LPSGWQAYWDESSKQ+YYGN
Sbjct  906  LVDLSKDLPSGWQAYWDESSKQIYYGN  932



>ref|XP_009387310.1| PREDICTED: formin-binding protein 4 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387311.1| PREDICTED: formin-binding protein 4 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            S+V R KK TVAV  TLRSNKKVS+LVDKWKAAKEELH EE+EE   A EILEKKRQ+EI
Sbjct  569  SRVLRGKKRTVAVAPTLRSNKKVSSLVDKWKAAKEELHGEEDEEPEDALEILEKKRQKEI  628

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAE-KMKETEKKPTDGTEENQQPDLNA  312
            EEWRA+QIASGEA+DNANF PLGGDWRERVKRRRAE K    E  P     E +QPDL  
Sbjct  629  EEWRARQIASGEAQDNANFLPLGGDWRERVKRRRAEAKTGPGETVPGAAVNEKKQPDLAE  688

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            LS  LP GWQAYWDESSK+VYYGN++
Sbjct  689  LSRSLPPGWQAYWDESSKEVYYGNSS  714



>ref|XP_010928058.1| PREDICTED: uncharacterized protein LOC105049946 isoform X1 [Elaeis 
guineensis]
Length=969

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR KK TVAV  TLRSNKKVS+LVDKWKAAKEELH  E+EE  +AYEILEKKRQ+EI
Sbjct  812  SKVARSKKRTVAVAPTLRSNKKVSSLVDKWKAAKEELHGNEDEEPENAYEILEKKRQKEI  871

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            EEWR +QIASGEA+DNANF PLGGDWRERVKRRRAE   E  + P +   EN+  QPDL 
Sbjct  872  EEWRTRQIASGEAQDNANFVPLGGDWRERVKRRRAETKAEAGEAPREQGVENEKKQPDLV  931

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNA  237
             LS  LPSGWQAYWDES+K+VYYGN+
Sbjct  932  QLSKDLPSGWQAYWDESTKEVYYGNS  957



>ref|XP_008218730.1| PREDICTED: uncharacterized protein LOC103319011 isoform X2 [Prunus 
mume]
Length=833

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 116/153 (76%), Gaps = 12/153 (8%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TVAV S+LRSNKKVS+LVDKWKAAKEEL  +EEE + +      +KRQR I
Sbjct  674  SKVPRTKKRTVAVASSLRSNKKVSSLVDKWKAAKEELLEDEEEPQNAYELFE-RKRQRGI  732

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKET--------EKKPTDGTEEN  333
            EEW AQQI SGEAKDNANFQPLGGDWRE+VKRR+A+  ++          + PTDG   N
Sbjct  733  EEWYAQQITSGEAKDNANFQPLGGDWREKVKRRKAQLARKAGQTASTPGPEAPTDG---N  789

Query  332  QQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            Q+PDL  LS GLPSGWQAYWDESSKQVYYGN A
Sbjct  790  QKPDLAELSRGLPSGWQAYWDESSKQVYYGNTA  822



>gb|EYU27458.1| hypothetical protein MIMGU_mgv1a004181mg [Erythranthe guttata]
Length=540

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 112/143 (78%), Gaps = 5/143 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TVAV STLRSNKKVS+LVDKWKAAKEEL  EEEE   +   +  KKRQREI
Sbjct  390  SKVPRGKKRTVAVVSTLRSNKKVSSLVDKWKAAKEELQEEEEEPEDAYEVLE-KKRQREI  448

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEWRA QIA+GEAKDNANFQPLGGDWRERVKR+RA+KMKE+        +  +Q DL  L
Sbjct  449  EEWRAHQIATGEAKDNANFQPLGGDWRERVKRKRAQKMKESSPD----IDTKKQTDLTQL  504

Query  308  SIGLPSGWQAYWDESSKQVYYGN  240
            S GLPSGWQ + D+SSKQVYYGN
Sbjct  505  SKGLPSGWQVFLDDSSKQVYYGN  527



>ref|XP_009387309.1| PREDICTED: protein piccolo isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=893

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            S+V R KK TVAV  TLRSNKKVS+LVDKWKAAKEELH EE+EE   A EILEKKRQ+EI
Sbjct  737  SRVLRGKKRTVAVAPTLRSNKKVSSLVDKWKAAKEELHGEEDEEPEDALEILEKKRQKEI  796

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAE-KMKETEKKPTDGTEENQQPDLNA  312
            EEWRA+QIASGEA+DNANF PLGGDWRERVKRRRAE K    E  P     E +QPDL  
Sbjct  797  EEWRARQIASGEAQDNANFLPLGGDWRERVKRRRAEAKTGPGETVPGAAVNEKKQPDLAE  856

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            LS  LP GWQAYWDESSK+VYYGN++
Sbjct  857  LSRSLPPGWQAYWDESSKEVYYGNSS  882



>ref|XP_008218722.1| PREDICTED: formin-binding protein 4 isoform X1 [Prunus mume]
Length=889

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 116/153 (76%), Gaps = 12/153 (8%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TVAV S+LRSNKKVS+LVDKWKAAKEEL  +EEE + +      +KRQR I
Sbjct  730  SKVPRTKKRTVAVASSLRSNKKVSSLVDKWKAAKEELLEDEEEPQNAYELFE-RKRQRGI  788

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKET--------EKKPTDGTEEN  333
            EEW AQQI SGEAKDNANFQPLGGDWRE+VKRR+A+  ++          + PTDG   N
Sbjct  789  EEWYAQQITSGEAKDNANFQPLGGDWREKVKRRKAQLARKAGQTASTPGPEAPTDG---N  845

Query  332  QQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            Q+PDL  LS GLPSGWQAYWDESSKQVYYGN A
Sbjct  846  QKPDLAELSRGLPSGWQAYWDESSKQVYYGNTA  878



>ref|XP_006586155.1| PREDICTED: uncharacterized protein LOC100791890 isoform X2 [Glycine 
max]
 ref|XP_006586156.1| PREDICTED: uncharacterized protein LOC100791890 isoform X3 [Glycine 
max]
 ref|XP_006586157.1| PREDICTED: uncharacterized protein LOC100791890 isoform X4 [Glycine 
max]
Length=835

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  680  TKVVRNRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPDSVYEVLE-RKRQREI  738

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPLGGDWRE+VKRRRA+  KE+   P D  E N QQPD + 
Sbjct  739  EEWHAKQIASGEAKDNANFQPLGGDWREKVKRRRAQAAKESVSTPQDAIEHNQQQPDPSE  798

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
             S GLP+ WQAYWD+S+KQ+YYGN  
Sbjct  799  HSKGLPTNWQAYWDDSTKQIYYGNTV  824



>ref|XP_006586154.1| PREDICTED: uncharacterized protein LOC100791890 isoform X1 [Glycine 
max]
Length=930

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  775  TKVVRNRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPDSVYEVLE-RKRQREI  833

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPLGGDWRE+VKRRRA+  KE+   P D  E N QQPD + 
Sbjct  834  EEWHAKQIASGEAKDNANFQPLGGDWREKVKRRRAQAAKESVSTPQDAIEHNQQQPDPSE  893

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
             S GLP+ WQAYWD+S+KQ+YYGN  
Sbjct  894  HSKGLPTNWQAYWDDSTKQIYYGNTV  919



>ref|XP_006602115.1| PREDICTED: uncharacterized protein LOC100805568 isoform X2 [Glycine 
max]
 ref|XP_006602116.1| PREDICTED: uncharacterized protein LOC100805568 isoform X3 [Glycine 
max]
 ref|XP_006602117.1| PREDICTED: uncharacterized protein LOC100805568 isoform X4 [Glycine 
max]
Length=836

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KVAR +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  681  TKVARNRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPDSVFEVLE-RKRQREI  739

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPL GDWRE+VKRRRA+  KE+   P D  E N QQ DL+ 
Sbjct  740  EEWHAKQIASGEAKDNANFQPLVGDWREKVKRRRAQAAKESVSTPQDAIEHNQQQHDLSE  799

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
             S GLP+ WQAYWD+S+KQVYYGN
Sbjct  800  HSKGLPTNWQAYWDDSTKQVYYGN  823



>ref|XP_010675975.1| PREDICTED: uncharacterized protein LOC104891888 [Beta vulgaris 
subsp. vulgaris]
Length=896

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK +R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEER +  EILEKKRQR
Sbjct  739  VQSKASRMKKPKVAVASSLRSNKKVSSLVDKWKAAKEELEEEEEEERETHLEILEKKRQR  798

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLN  315
            EIE WRAQQIASGEAK+NANFQPLGGDWRERVKRRRA+K              N+QPDL+
Sbjct  799  EIEGWRAQQIASGEAKENANFQPLGGDWRERVKRRRAQKEAAAGTTSDAADNGNKQPDLS  858

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNA  237
             LS  LP GWQAYWD+SS+QVYY N+
Sbjct  859  KLSRDLPPGWQAYWDDSSRQVYYANS  884



>ref|XP_006602114.1| PREDICTED: uncharacterized protein LOC100805568 isoform X1 [Glycine 
max]
Length=931

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KVAR +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  776  TKVARNRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPDSVFEVLE-RKRQREI  834

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPL GDWRE+VKRRRA+  KE+   P D  E N QQ DL+ 
Sbjct  835  EEWHAKQIASGEAKDNANFQPLVGDWREKVKRRRAQAAKESVSTPQDAIEHNQQQHDLSE  894

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
             S GLP+ WQAYWD+S+KQVYYGN
Sbjct  895  HSKGLPTNWQAYWDDSTKQVYYGN  918



>ref|XP_007208104.1| hypothetical protein PRUPE_ppa001027mg [Prunus persica]
 gb|EMJ09303.1| hypothetical protein PRUPE_ppa001027mg [Prunus persica]
Length=930

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 115/153 (75%), Gaps = 12/153 (8%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TVAV S+LRSNKKVS+LVDKWKAAKEEL  +EEE + +      +KRQR I
Sbjct  771  SKVPRTKKRTVAVASSLRSNKKVSSLVDKWKAAKEELLEDEEEPQNTYELFE-RKRQRGI  829

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAE---KMKETEKKP-----TDGTEEN  333
            EEW AQQI SGEAKDNANFQPLGGDWRE+VKRR+A+   K  +T   P      DG   N
Sbjct  830  EEWYAQQITSGEAKDNANFQPLGGDWREKVKRRKAQLARKAGQTASTPGPEAHMDG---N  886

Query  332  QQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            Q+PDL  LS GLPSGWQAYWDESSKQVYYGN A
Sbjct  887  QKPDLAELSRGLPSGWQAYWDESSKQVYYGNTA  919



>ref|XP_010255738.1| PREDICTED: formin-binding protein 4-like isoform X2 [Nelumbo 
nucifera]
Length=976

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = -2

Query  656  RKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREIEEWR  477
            R KK T+AV  TLRSNKKVS+LVDKW+AAKEELH +EE+E  +AYE+LEKKRQ+EIEEW 
Sbjct  825  RGKKRTIAVAPTLRSNKKVSSLVDKWRAAKEELHEDEEDEPENAYEMLEKKRQKEIEEWH  884

Query  476  AQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTD-GTEENQQPDLNALSIG  300
            AQQIASGEAKDNANFQPLGGDWRERVKR+RA+ + E+ +  ++    E QQPDL  LS  
Sbjct  885  AQQIASGEAKDNANFQPLGGDWRERVKRKRAQLISESVQTQSEIPANEKQQPDLVELSKD  944

Query  299  LPSGWQAYWDESSKQVYYGNA  237
            LP+GWQAYWD+SSK+VYYGN 
Sbjct  945  LPAGWQAYWDDSSKEVYYGNV  965



>ref|XP_010255737.1| PREDICTED: formin-binding protein 4-like isoform X1 [Nelumbo 
nucifera]
Length=1009

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = -2

Query  656  RKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREIEEWR  477
            R KK T+AV  TLRSNKKVS+LVDKW+AAKEELH +EE+E  +AYE+LEKKRQ+EIEEW 
Sbjct  858  RGKKRTIAVAPTLRSNKKVSSLVDKWRAAKEELHEDEEDEPENAYEMLEKKRQKEIEEWH  917

Query  476  AQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTD-GTEENQQPDLNALSIG  300
            AQQIASGEAKDNANFQPLGGDWRERVKR+RA+ + E+ +  ++    E QQPDL  LS  
Sbjct  918  AQQIASGEAKDNANFQPLGGDWRERVKRKRAQLISESVQTQSEIPANEKQQPDLVELSKD  977

Query  299  LPSGWQAYWDESSKQVYYGNA  237
            LP+GWQAYWD+SSK+VYYGN 
Sbjct  978  LPAGWQAYWDDSSKEVYYGNV  998



>ref|XP_010274245.1| PREDICTED: uncharacterized protein LOC104609583 isoform X2 [Nelumbo 
nucifera]
Length=978

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SK  R KK T+AV  TLRSNKKVS+LVDKWKA KEELH + E+E   AYEILEKKRQ+EI
Sbjct  823  SKALRGKKRTIAVAPTLRSNKKVSSLVDKWKAVKEELHEDGEDEPEYAYEILEKKRQKEI  882

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTD-GTEENQQPDLNA  312
             +WRAQQIASGEAKDNANFQPLGGDWRERVKR+RA+   ++ +  ++    E QQPDL  
Sbjct  883  VQWRAQQIASGEAKDNANFQPLGGDWRERVKRKRAQLTNDSVQAQSEIPANEKQQPDLVE  942

Query  311  LSIGLPSGWQAYWDESSKQVYYGNA  237
            LS  LPSGWQAYWD+SSK+VYYGN 
Sbjct  943  LSKDLPSGWQAYWDDSSKEVYYGNV  967



>ref|XP_010103959.1| Formin-binding protein 4 [Morus notabilis]
 gb|EXB97662.1| Formin-binding protein 4 [Morus notabilis]
Length=996

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 118/150 (79%), Gaps = 8/150 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR KK TVAV S+LRS+KKVS+LV+KWKAAKEEL  +EEE + +   +  +KRQREI
Sbjct  835  SKVARTKKRTVAVASSLRSSKKVSSLVNKWKAAKEELLEDEEEPKNAYEMLE-RKRQREI  893

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK-KPTDGTEEN------Q  330
            EEW AQQIASGEAKDNANFQPLGGDWRERVKRRRA++ +E  +  P    +EN      Q
Sbjct  894  EEWHAQQIASGEAKDNANFQPLGGDWRERVKRRRAQQAREAARTSPEAHNDENQEQQHQQ  953

Query  329  QPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
            QP+L  LS  LPSGWQAYWDESSKQVYYGN
Sbjct  954  QPNLAELSKDLPSGWQAYWDESSKQVYYGN  983



>ref|XP_008463035.1| PREDICTED: flocculation protein FLO11 isoform X3 [Cucumis melo]
Length=909

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  734  PENTLVastssatstataSNVPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelh  555
            P N  V  +SS  + +  S V  K  R KK TV V  +LRSNKKVS+L+DKWKAAKEEL 
Sbjct  733  PTNKAVTDSSSVANASAVSKVQPKALRSKKRTVTVAPSLRSNKKVSSLLDKWKAAKEELE  792

Query  554  aeeeeerasayeilEKKRQREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKM  375
             EEE E A       +KR+REI+EW AQQIASG+AK+NANFQPLG DWRERVKRRRA+  
Sbjct  793  DEEEPENAYEILE--RKREREIKEWHAQQIASGDAKENANFQPLGSDWRERVKRRRAQSS  850

Query  374  KETEKKPTDG-TEENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNA  237
             E  + P +  T+ NQQPDL  +S  LPSGWQAYWDESSKQVYYGN 
Sbjct  851  SEVTQSPVEAPTDGNQQPDLAEISKDLPSGWQAYWDESSKQVYYGNV  897



>ref|XP_008800274.1| PREDICTED: uncharacterized protein LOC103714695 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008800275.1| PREDICTED: uncharacterized protein LOC103714695 isoform X2 [Phoenix 
dactylifera]
Length=874

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR KK TVAV  TLRSNKKVS+LVDKWKAAKEELH +E+EE  +AYEI+EKKRQ+EI
Sbjct  717  SKVARSKKRTVAVAPTLRSNKKVSSLVDKWKAAKEELHGDEDEEPENAYEIVEKKRQKEI  776

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            EEWR  QIASG A+DNANF PLGGDWRERVKRRRAE   E  + P +   EN+  QPDL 
Sbjct  777  EEWRTHQIASGGAQDNANFVPLGGDWRERVKRRRAEAKAEAGEAPREQGVENEKKQPDLV  836

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNA  237
             LS  LPSGWQAYWDES+K+VYYGN+
Sbjct  837  QLSKDLPSGWQAYWDESTKEVYYGNS  862



>ref|XP_008800273.1| PREDICTED: uncharacterized protein LOC103714695 isoform X1 [Phoenix 
dactylifera]
Length=971

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR KK TVAV  TLRSNKKVS+LVDKWKAAKEELH +E+EE  +AYEI+EKKRQ+EI
Sbjct  814  SKVARSKKRTVAVAPTLRSNKKVSSLVDKWKAAKEELHGDEDEEPENAYEIVEKKRQKEI  873

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            EEWR  QIASG A+DNANF PLGGDWRERVKRRRAE   E  + P +   EN+  QPDL 
Sbjct  874  EEWRTHQIASGGAQDNANFVPLGGDWRERVKRRRAEAKAEAGEAPREQGVENEKKQPDLV  933

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNA  237
             LS  LPSGWQAYWDES+K+VYYGN+
Sbjct  934  QLSKDLPSGWQAYWDESTKEVYYGNS  959



>ref|XP_008463034.1| PREDICTED: flocculation protein FLO11 isoform X2 [Cucumis melo]
Length=940

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  734  PENTLVastssatstataSNVPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelh  555
            P N  V  +SS  + +  S V  K  R KK TV V  +LRSNKKVS+L+DKWKAAKEEL 
Sbjct  764  PTNKAVTDSSSVANASAVSKVQPKALRSKKRTVTVAPSLRSNKKVSSLLDKWKAAKEELE  823

Query  554  aeeeeerasayeilEKKRQREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKM  375
             EEE E A       +KR+REI+EW AQQIASG+AK+NANFQPLG DWRERVKRRRA+  
Sbjct  824  DEEEPENAYEILE--RKREREIKEWHAQQIASGDAKENANFQPLGSDWRERVKRRRAQSS  881

Query  374  KETEKKPTDG-TEENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNA  237
             E  + P +  T+ NQQPDL  +S  LPSGWQAYWDESSKQVYYGN 
Sbjct  882  SEVTQSPVEAPTDGNQQPDLAEISKDLPSGWQAYWDESSKQVYYGNV  928



>ref|XP_010274244.1| PREDICTED: uncharacterized protein LOC104609583 isoform X1 [Nelumbo 
nucifera]
Length=1011

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SK  R KK T+AV  TLRSNKKVS+LVDKWKA KEELH + E+E   AYEILEKKRQ+EI
Sbjct  856  SKALRGKKRTIAVAPTLRSNKKVSSLVDKWKAVKEELHEDGEDEPEYAYEILEKKRQKEI  915

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTD-GTEENQQPDLNA  312
             +WRAQQIASGEAKDNANFQPLGGDWRERVKR+RA+   ++ +  ++    E QQPDL  
Sbjct  916  VQWRAQQIASGEAKDNANFQPLGGDWRERVKRKRAQLTNDSVQAQSEIPANEKQQPDLVE  975

Query  311  LSIGLPSGWQAYWDESSKQVYYGNA  237
            LS  LPSGWQAYWD+SSK+VYYGN 
Sbjct  976  LSKDLPSGWQAYWDDSSKEVYYGNV  1000



>ref|XP_008463033.1| PREDICTED: flocculation protein FLO11 isoform X1 [Cucumis melo]
Length=943

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  734  PENTLVastssatstataSNVPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelh  555
            P N  V  +SS  + +  S V  K  R KK TV V  +LRSNKKVS+L+DKWKAAKEEL 
Sbjct  767  PTNKAVTDSSSVANASAVSKVQPKALRSKKRTVTVAPSLRSNKKVSSLLDKWKAAKEELE  826

Query  554  aeeeeerasayeilEKKRQREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKM  375
             EEE E A       +KR+REI+EW AQQIASG+AK+NANFQPLG DWRERVKRRRA+  
Sbjct  827  DEEEPENAYEILE--RKREREIKEWHAQQIASGDAKENANFQPLGSDWRERVKRRRAQSS  884

Query  374  KETEKKPTDG-TEENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNA  237
             E  + P +  T+ NQQPDL  +S  LPSGWQAYWDESSKQVYYGN 
Sbjct  885  SEVTQSPVEAPTDGNQQPDLAEISKDLPSGWQAYWDESSKQVYYGNV  931



>ref|XP_002300398.2| hypothetical protein POPTR_0001s38050g [Populus trichocarpa]
 gb|EEE85203.2| hypothetical protein POPTR_0001s38050g [Populus trichocarpa]
Length=987

 Score =   166 bits (420),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V +KV+RKK+ TVAV  +LRSNKKVS+LVDKWKAAKEEL+  EEEE  SAYEI EKKRQR
Sbjct  830  VQTKVSRKKR-TVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEEEPKSAYEIFEKKRQR  888

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG-TEENQQPDL  318
            EIEEW A+QIASGEAKDNANFQPLGGDWRERVKRRRA+  K     P++  T+EN+QPDL
Sbjct  889  EIEEWHAKQIASGEAKDNANFQPLGGDWRERVKRRRAQAAKAAALTPSEAPTDENKQPDL  948

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNA  237
              LS GLPSGWQ YWD SSKQVYYGN 
Sbjct  949  EELSKGLPSGWQVYWDGSSKQVYYGNV  975



>gb|KEH34105.1| WW domain protein, putative [Medicago truncatula]
Length=802

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  646  TKVVRSRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPESVYDALE-RKRQREI  704

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN--QQPDLN  315
            EEWRA+QIASGEAKDNANFQPLGGDWRE+V+R+RA+  KET  K    +E +  Q+PD+ 
Sbjct  705  EEWRAKQIASGEAKDNANFQPLGGDWREKVRRKRAKAAKETVGKVEVASESSKQQKPDIV  764

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             L+ GLPS WQAYWDE+SK+VYYGN  
Sbjct  765  ELAKGLPSNWQAYWDEASKKVYYGNVV  791



>gb|KEH34106.1| WW domain protein, putative [Medicago truncatula]
Length=797

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  641  TKVVRSRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPESVYDALE-RKRQREI  699

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN--QQPDLN  315
            EEWRA+QIASGEAKDNANFQPLGGDWRE+V+R+RA+  KET  K    +E +  Q+PD+ 
Sbjct  700  EEWRAKQIASGEAKDNANFQPLGGDWREKVRRKRAKAAKETVGKVEVASESSKQQKPDIV  759

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             L+ GLPS WQAYWDE+SK+VYYGN  
Sbjct  760  ELAKGLPSNWQAYWDEASKKVYYGNVV  786



>gb|KGN44384.1| hypothetical protein Csa_7G276700 [Cucumis sativus]
Length=903

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V  K  R KK TV V  +LRSNKKVS+L+DKWKAAKEEL  EEE E A       +KR+R
Sbjct  747  VQPKALRSKKRTVTVAPSLRSNKKVSSLLDKWKAAKEELEDEEEPENAYEILE--RKRER  804

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG-TEENQQPDL  318
            EI+EW AQQIASG+AK+NANFQPLG DWRERVKRRRA+   E  + P +  T  NQQPDL
Sbjct  805  EIKEWHAQQIASGDAKENANFQPLGSDWRERVKRRRAQSSSEATQSPVEAPTGGNQQPDL  864

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNA  237
              +S  LPSGWQAYWDESSKQVYYGN 
Sbjct  865  AEISKDLPSGWQAYWDESSKQVYYGNV  891



>gb|KEH34104.1| WW domain protein, putative [Medicago truncatula]
Length=928

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  772  TKVVRSRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPESVYDALE-RKRQREI  830

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN--QQPDLN  315
            EEWRA+QIASGEAKDNANFQPLGGDWRE+V+R+RA+  KET  K    +E +  Q+PD+ 
Sbjct  831  EEWRAKQIASGEAKDNANFQPLGGDWREKVRRKRAKAAKETVGKVEVASESSKQQKPDIV  890

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             L+ GLPS WQAYWDE+SK+VYYGN  
Sbjct  891  ELAKGLPSNWQAYWDEASKKVYYGNVV  917



>gb|KEH34103.1| WW domain protein, putative [Medicago truncatula]
Length=923

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  767  TKVVRSRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPESVYDALE-RKRQREI  825

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN--QQPDLN  315
            EEWRA+QIASGEAKDNANFQPLGGDWRE+V+R+RA+  KET  K    +E +  Q+PD+ 
Sbjct  826  EEWRAKQIASGEAKDNANFQPLGGDWREKVRRKRAKAAKETVGKVEVASESSKQQKPDIV  885

Query  314  ALSIGLPSGWQAYWDESSKQVYYGNAA  234
             L+ GLPS WQAYWDE+SK+VYYGN  
Sbjct  886  ELAKGLPSNWQAYWDEASKKVYYGNVV  912



>ref|XP_004167069.1| PREDICTED: uncharacterized protein LOC101223441 [Cucumis sativus]
Length=943

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V  K  R KK TV V  +LRSNKKVS+L+DKWKAAKEEL  EEE E A       +KR+R
Sbjct  787  VQPKALRSKKRTVTVAPSLRSNKKVSSLLDKWKAAKEELEDEEEPENAYEILE--RKRER  844

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG-TEENQQPDL  318
            EI+EW AQQIASG+AK+NANFQPLG DWRERVKRRRA+   E  + P +  T  NQQPDL
Sbjct  845  EIKEWHAQQIASGDAKENANFQPLGSDWRERVKRRRAQSSSEATQSPVEAPTGGNQQPDL  904

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNA  237
              +S  LPSGWQAYWDESSKQVYYGN 
Sbjct  905  AEISKDLPSGWQAYWDESSKQVYYGNV  931



>ref|XP_004149420.1| PREDICTED: uncharacterized protein LOC101219916 [Cucumis sativus]
Length=943

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V  K  R KK TV V  +LRSNKKVS+L+DKWKAAKEEL  EEE E A       +KR+R
Sbjct  787  VQPKALRSKKRTVTVAPSLRSNKKVSSLLDKWKAAKEELEDEEEPENAYEILE--RKRER  844

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG-TEENQQPDL  318
            EI+EW AQQIASG+AK+NANFQPLG DWRERVKRRRA+   E  + P +  T  NQQPDL
Sbjct  845  EIKEWHAQQIASGDAKENANFQPLGSDWRERVKRRRAQSSSEATQSPVEAPTGGNQQPDL  904

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNA  237
              +S  LPSGWQAYWDESSKQVYYGN 
Sbjct  905  AEISKDLPSGWQAYWDESSKQVYYGNV  931



>ref|XP_009367262.1| PREDICTED: uncharacterized protein LOC103956925 isoform X2 [Pyrus 
x bretschneideri]
Length=793

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 111/155 (72%), Gaps = 12/155 (8%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK T+A  S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  +KRQR
Sbjct  632  VQSKVPRTKKRTIAAASSLRSNKKVSSLVDKWKAAKEELLEDEEEPENAYELLE-RKRQR  690

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAE--------KMKETEKKPTDGTE  339
             IEEW AQQI SGEAKDNANFQPLGGDWRE+VKRR+A+              + PTDG  
Sbjct  691  GIEEWYAQQITSGEAKDNANFQPLGGDWREKVKRRKAQLAREAAKTAAASASEAPTDG--  748

Query  338  ENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
             N+QPD+   S GLP GWQAYWDESSKQVYYGN  
Sbjct  749  -NKQPDMTEQSNGLPPGWQAYWDESSKQVYYGNTV  782



>gb|EEC80443.1| hypothetical protein OsI_22639 [Oryza sativa Indica Group]
Length=824

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK  V+V ++LRSNKKVS+LVDKWKAAKEEL  EE+EE  SA + LE+KRQ++I
Sbjct  664  SKVVRSKKRAVSVATSLRSNKKVSSLVDKWKAAKEELRDEEDEEPESALDALERKRQKDI  723

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMK----ETEKKPTDGTEENQ-QP  324
            +EWR QQIASGEA++NANF PLGGDWR+RVKRRRAE  K    ET   P   T+ ++ QP
Sbjct  724  DEWRKQQIASGEAQENANFVPLGGDWRDRVKRRRAEAKKEANSETIPAPVSVTDLHKGQP  783

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGNA  237
            DL  L  GLPSGWQAY DES+KQVYYGN+
Sbjct  784  DLAELCKGLPSGWQAYLDESTKQVYYGNS  812



>ref|NP_001057442.1| Os06g0298400 [Oryza sativa Japonica Group]
 dbj|BAD53469.1| WW domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF19356.1| Os06g0298400 [Oryza sativa Japonica Group]
Length=860

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK  V+V ++LRSNKKVS+LVDKWKAAKEEL  EE+EE  SA + LE+KRQ++I
Sbjct  700  SKVVRSKKRAVSVATSLRSNKKVSSLVDKWKAAKEELRDEEDEEPESALDALERKRQKDI  759

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMK----ETEKKPTDGTEENQ-QP  324
            +EWR QQIASGEA++NANF PLGGDWR+RVKRRRAE  K    ET   P   T+ ++ QP
Sbjct  760  DEWRKQQIASGEAQENANFVPLGGDWRDRVKRRRAEAKKEANSETISAPVSVTDLHKGQP  819

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGNA  237
            DL  L  GLPSGWQAY DES+KQVYYGN+
Sbjct  820  DLAELCKGLPSGWQAYLDESTKQVYYGNS  848



>gb|KHN31687.1| hypothetical protein glysoja_022552 [Glycine soja]
Length=929

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 114/144 (79%), Gaps = 4/144 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KVAR +K  VAVGS+L+SNKKVS+LVDK   A +E   EEEEE  S +E+LE+KRQREI
Sbjct  776  TKVARNRKRAVAVGSSLKSNKKVSSLVDK---ATKEELLEEEEEPDSVFEVLERKRQREI  832

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPL GDWRE+VKRRRA+  KE+   P D  E N QQ DL+ 
Sbjct  833  EEWHAKQIASGEAKDNANFQPLVGDWREKVKRRRAQAAKESVSTPQDAIEHNQQQHDLSE  892

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
             S GLP+ WQAYWD+S+KQVYYGN
Sbjct  893  HSKGLPTNWQAYWDDSTKQVYYGN  916



>ref|XP_009367261.1| PREDICTED: formin-binding protein 4 isoform X1 [Pyrus x bretschneideri]
Length=934

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 111/155 (72%), Gaps = 12/155 (8%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK T+A  S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  +KRQR
Sbjct  773  VQSKVPRTKKRTIAAASSLRSNKKVSSLVDKWKAAKEELLEDEEEPENAYELLE-RKRQR  831

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAE--------KMKETEKKPTDGTE  339
             IEEW AQQI SGEAKDNANFQPLGGDWRE+VKRR+A+              + PTDG  
Sbjct  832  GIEEWYAQQITSGEAKDNANFQPLGGDWREKVKRRKAQLAREAAKTAAASASEAPTDG--  889

Query  338  ENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
             N+QPD+   S GLP GWQAYWDESSKQVYYGN  
Sbjct  890  -NKQPDMTEQSNGLPPGWQAYWDESSKQVYYGNTV  923



>ref|XP_004498164.1| PREDICTED: uncharacterized protein LOC101511978 isoform X2 [Cicer 
arietinum]
Length=881

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  725  TKVVRSRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPDSVYEALE-RKRQREI  783

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEE-NQQ-PDLN  315
            EEW A+QI+SGEAKDNANFQPLGGDWRE+V+R+RA+   +T  K    TE  NQQ PD+ 
Sbjct  784  EEWCAKQISSGEAKDNANFQPLGGDWREKVRRKRAKAASDTVPKVQVATEHKNQQKPDIV  843

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS GLPS WQAYWDE+SKQVYYGN
Sbjct  844  ELSKGLPSNWQAYWDEASKQVYYGN  868



>ref|XP_010542508.1| PREDICTED: ENHANCER OF AG-4 protein 2 isoform X7 [Tarenaya hassleriana]
Length=883

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  640  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  699

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQP-DLNA  312
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R +  +E  +  T   +  Q P DL  
Sbjct  700  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGE--TKKGKNQQTPDDLTK  757

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  758  ISANLPSGWQAYWDESSKQIYYGNKA  783



>ref|XP_008353129.1| PREDICTED: uncharacterized protein LOC103416676 [Malus domestica]
Length=880

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 112/153 (73%), Gaps = 12/153 (8%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK T AV S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  +KRQR
Sbjct  719  VQSKVPRTKKRTSAVASSLRSNKKVSSLVDKWKAAKEELLEDEEEPENAYEXLE-RKRQR  777

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKE--------TEKKPTDGTE  339
             IEEW AQQI SGEAKDNANFQPLGGDWRE+VKRR+A+  +E        T   PTDG  
Sbjct  778  GIEEWYAQQITSGEAKDNANFQPLGGDWREKVKRRKAQLDREAAKTAAASTSAAPTDG--  835

Query  338  ENQQPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
             NQQPD+   S GLP GW AYWDESSK+VYYGN
Sbjct  836  -NQQPDMTEQSNGLPPGWXAYWDESSKKVYYGN  867



>ref|XP_002884955.1| hypothetical protein ARALYDRAFT_478706 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61214.1| hypothetical protein ARALYDRAFT_478706 [Arabidopsis lyrata subsp. 
lyrata]
Length=770

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 113/145 (78%), Gaps = 6/145 (4%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK TVA  STLRSNKKVS+LVDKWKAAKEEL+  EEEE  S      +KR+REI
Sbjct  621  TKVKRLKKRTVAATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDSGILD--RKRKREI  678

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEW+++QIASGEAKDNANFQPLGGDWRE+VKR+R    K  +K P    ++ Q+PDL  L
Sbjct  679  EEWKSRQIASGEAKDNANFQPLGGDWREKVKRKRERAEKSQKKDP----DKQQKPDLTKL  734

Query  308  SIGLPSGWQAYWDESSKQVYYGNAA  234
            S  LPSGWQAYWDES+K+VYYGN +
Sbjct  735  SANLPSGWQAYWDESTKKVYYGNTS  759



>ref|XP_010542506.1| PREDICTED: formin-binding protein 4 isoform X6 [Tarenaya hassleriana]
Length=913

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  759  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  818

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR---AEKMKETEKKPTDGTEENQQPDL  318
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R   A +  ET+K    G  +    DL
Sbjct  819  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGETKK----GKNQQTPDDL  874

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  875  TKISANLPSGWQAYWDESSKQIYYGNKA  902



>ref|XP_010227748.1| PREDICTED: formin-binding protein 4 isoform X2 [Brachypodium 
distachyon]
Length=833

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE   A E LEKKR++EI
Sbjct  676  TKVHRTKKRPVAVASSLRSNKKVSSLVDKWKAAKEELRDEEEEEPEDALEALEKKRRKEI  735

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            + WR QQIASGEAK+NANF PLGGDWR+RVKRRRAE  KE++ +      E    QPDL 
Sbjct  736  DGWRKQQIASGEAKENANFVPLGGDWRDRVKRRRAEAKKESKSEFIQAVPEQHKGQPDLV  795

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS GLPSGWQAY DES+KQVYYGN
Sbjct  796  ELSKGLPSGWQAYIDESTKQVYYGN  820



>ref|XP_010227749.1| PREDICTED: formin-binding protein 4 isoform X3 [Brachypodium 
distachyon]
Length=830

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE   A E LEKKR++EI
Sbjct  673  TKVHRTKKRPVAVASSLRSNKKVSSLVDKWKAAKEELRDEEEEEPEDALEALEKKRRKEI  732

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            + WR QQIASGEAK+NANF PLGGDWR+RVKRRRAE  KE++ +      E    QPDL 
Sbjct  733  DGWRKQQIASGEAKENANFVPLGGDWRDRVKRRRAEAKKESKSEFIQAVPEQHKGQPDLV  792

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS GLPSGWQAY DES+KQVYYGN
Sbjct  793  ELSKGLPSGWQAYIDESTKQVYYGN  817



>ref|XP_010542503.1| PREDICTED: ENHANCER OF AG-4 protein 2 isoform X3 [Tarenaya hassleriana]
Length=983

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  740  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  799

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQP-DLNA  312
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R +  +E  +  T   +  Q P DL  
Sbjct  800  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGE--TKKGKNQQTPDDLTK  857

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  858  ISANLPSGWQAYWDESSKQIYYGNKA  883



>ref|XP_010542504.1| PREDICTED: formin-binding protein 4 isoform X4 [Tarenaya hassleriana]
Length=970

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  759  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  818

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR---AEKMKETEKKPTDGTEENQQPDL  318
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R   A +  ET+K    G  +    DL
Sbjct  819  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGETKK----GKNQQTPDDL  874

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  875  TKISANLPSGWQAYWDESSKQIYYGNKA  902



>ref|XP_010542501.1| PREDICTED: formin-binding protein 4 isoform X1 [Tarenaya hassleriana]
Length=1002

 Score =   160 bits (406),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  759  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  818

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR---AEKMKETEKKPTDGTEENQQPDL  318
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R   A +  ET+K    G  +    DL
Sbjct  819  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGETKK----GKNQQTPDDL  874

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  875  TKISANLPSGWQAYWDESSKQIYYGNKA  902



>ref|XP_010542505.1| PREDICTED: formin-binding protein 4 isoform X5 [Tarenaya hassleriana]
Length=928

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  759  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  818

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR---AEKMKETEKKPTDGTEENQQPDL  318
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R   A +  ET+K    G  +    DL
Sbjct  819  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGETKK----GKNQQTPDDL  874

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  875  TKISANLPSGWQAYWDESSKQIYYGNKA  902



>ref|XP_010542502.1| PREDICTED: formin-binding protein 4 isoform X2 [Tarenaya hassleriana]
Length=983

 Score =   160 bits (406),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKVAR K+  VAV S+LRSNKKVS+LVDKWKAAKEEL+  EEEE  +AYEILE+KRQREI
Sbjct  759  SKVARPKRRPVAVASSLRSNKKVSSLVDKWKAAKEELNESEEEEPENAYEILERKRQREI  818

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR---AEKMKETEKKPTDGTEENQQPDL  318
            EEW+A+QIASGEAK+NANFQPLGGDWRE+VKR+R   A +  ET+K    G  +    DL
Sbjct  819  EEWKARQIASGEAKENANFQPLGGDWREKVKRKRQQAAREAGETKK----GKNQQTPDDL  874

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              +S  LPSGWQAYWDESSKQ+YYGN A
Sbjct  875  TKISANLPSGWQAYWDESSKQIYYGNKA  902



>ref|XP_003563936.1| PREDICTED: formin-binding protein 4 isoform X1 [Brachypodium 
distachyon]
Length=862

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE   A E LEKKR++EI
Sbjct  705  TKVHRTKKRPVAVASSLRSNKKVSSLVDKWKAAKEELRDEEEEEPEDALEALEKKRRKEI  764

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            + WR QQIASGEAK+NANF PLGGDWR+RVKRRRAE  KE++ +      E    QPDL 
Sbjct  765  DGWRKQQIASGEAKENANFVPLGGDWRDRVKRRRAEAKKESKSEFIQAVPEQHKGQPDLV  824

Query  314  ALSIGLPSGWQAYWDESSKQVYYGN  240
             LS GLPSGWQAY DES+KQVYYGN
Sbjct  825  ELSKGLPSGWQAYIDESTKQVYYGN  849



>ref|XP_004965269.1| PREDICTED: formin-binding protein 4-like isoform X2 [Setaria 
italica]
Length=691

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE  SA E LE+KRQ+EI
Sbjct  532  AKVIRSKKRAVAVTSSLRSNKKVSSLVDKWKAAKEELRDEEEEEPESALEALERKRQKEI  591

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPT----DGTEENQQPD  321
            EEWR QQIASGEA++NANF P+ GDWR+RVKRRRAE  KE+++          + N  PD
Sbjct  592  EEWRKQQIASGEAQENANFVPVRGDWRDRVKRRRAEVKKESKESAAASLHSAEQHNGSPD  651

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGNA  237
            L  LS GLPSGWQAY DES+KQVYYGN+
Sbjct  652  LAELSKGLPSGWQAYLDESTKQVYYGNS  679



>ref|XP_009124732.1| PREDICTED: formin-binding protein 4 isoform X4 [Brassica rapa]
Length=836

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            SKV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE    Y +L++KR+RE
Sbjct  679  SKVKRPKKRTVSATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRRE  738

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+    +E + +P    E+ Q+PDL  
Sbjct  739  IEEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERTGREAD-EPKKKDEKQQKPDLTK  797

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS  LPSGWQAYWDES+K+ YYGN
Sbjct  798  LSAHLPSGWQAYWDESTKKAYYGN  821



>emb|CDY43359.1| BnaA01g29900D [Brassica napus]
Length=901

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            SKV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE    Y +L++KR+RE
Sbjct  744  SKVKRPKKRTVSATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRRE  803

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+    +E + +P    E+ Q+PDL  
Sbjct  804  IEEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERTGREAD-EPKKKDEKQQKPDLTK  862

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS  LPSGWQAYWDES+K+ YYGN
Sbjct  863  LSAHLPSGWQAYWDESTKKTYYGN  886



>ref|XP_009124731.1| PREDICTED: formin-binding protein 4 isoform X3 [Brassica rapa]
Length=841

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            SKV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE    Y +L++KR+RE
Sbjct  684  SKVKRPKKRTVSATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRRE  743

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+    +E + +P    E+ Q+PDL  
Sbjct  744  IEEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERTGREAD-EPKKKDEKQQKPDLTK  802

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS  LPSGWQAYWDES+K+ YYGN
Sbjct  803  LSAHLPSGWQAYWDESTKKAYYGN  826



>ref|XP_009124729.1| PREDICTED: formin-binding protein 4 isoform X1 [Brassica rapa]
Length=881

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            SKV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE    Y +L++KR+RE
Sbjct  724  SKVKRPKKRTVSATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRRE  783

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+    +E + +P    E+ Q+PDL  
Sbjct  784  IEEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERTGREAD-EPKKKDEKQQKPDLTK  842

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS  LPSGWQAYWDES+K+ YYGN
Sbjct  843  LSAHLPSGWQAYWDESTKKAYYGN  866



>ref|XP_009124730.1| PREDICTED: formin-binding protein 4 isoform X2 [Brassica rapa]
Length=874

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            SKV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE    Y +L++KR+RE
Sbjct  717  SKVKRPKKRTVSATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRRE  776

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+    +E + +P    E+ Q+PDL  
Sbjct  777  IEEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERTGREAD-EPKKKDEKQQKPDLTK  835

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS  LPSGWQAYWDES+K+ YYGN
Sbjct  836  LSAHLPSGWQAYWDESTKKAYYGN  859



>ref|XP_004965268.1| PREDICTED: formin-binding protein 4-like isoform X1 [Setaria 
italica]
Length=858

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE  SA E LE+KRQ+EI
Sbjct  699  AKVIRSKKRAVAVTSSLRSNKKVSSLVDKWKAAKEELRDEEEEEPESALEALERKRQKEI  758

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPT----DGTEENQQPD  321
            EEWR QQIASGEA++NANF P+ GDWR+RVKRRRAE  KE+++          + N  PD
Sbjct  759  EEWRKQQIASGEAQENANFVPVRGDWRDRVKRRRAEVKKESKESAAASLHSAEQHNGSPD  818

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGNA  237
            L  LS GLPSGWQAY DES+KQVYYGN+
Sbjct  819  LAELSKGLPSGWQAYLDESTKQVYYGNS  846



>gb|ADE75782.1| unknown [Picea sitchensis]
Length=287

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 115/152 (76%), Gaps = 11/152 (7%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasay-eilEKKRQRE  492
            SKV R KK + AV STLRSNKKVS+LVDKWKAAKEELH  ++E+ +    E+LEKKR+RE
Sbjct  126  SKV-RSKKRSTAVASTLRSNKKVSSLVDKWKAAKEELHGSDDEDESENAIEVLEKKRRRE  184

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-------  333
            IEEWR QQIASGEA+DNANFQPLGGDWRERVKR++     E E KP   T +N       
Sbjct  185  IEEWRMQQIASGEAQDNANFQPLGGDWRERVKRKKTGSAVE-ETKPQATTVDNSGSKGLD  243

Query  332  -QQPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
             ++PDL  LS GLP GWQA+WDESS +VYYGN
Sbjct  244  KKKPDLVELSKGLPMGWQAFWDESSGEVYYGN  275



>emb|CDY24199.1| BnaC01g37790D [Brassica napus]
Length=886

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  668  SKVARKKKGTVA-VGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            SKV R KK TVA   STLRSNKKVS+LVDKWKAAKEEL+  EEEE    Y +L++KR+RE
Sbjct  731  SKVKRAKKRTVAATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDDYGVLDRKRRRE  790

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNA  312
            IEEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+    +E + +P    ++ Q+PDL  
Sbjct  791  IEEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERAGREAD-EPKKKDDKVQKPDLTK  849

Query  311  LSIGLPSGWQAYWDESSKQVYYGN  240
            LS  LPSGWQAYWDES+K+ YYGN
Sbjct  850  LSAHLPSGWQAYWDESTKKTYYGN  873



>ref|XP_006407247.1| hypothetical protein EUTSA_v10020110mg [Eutrema salsugineum]
 gb|ESQ48700.1| hypothetical protein EUTSA_v10020110mg [Eutrema salsugineum]
Length=781

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 114/147 (78%), Gaps = 9/147 (6%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TV   STLRSNKKVS+LVDKWKAAKEEL+  EEEE      +  +KR++EI
Sbjct  626  SKVKRPKKRTVTATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEEEDYGILD-RKRRKEI  684

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR----AEKMKETEKKPTDGTEENQQPD  321
            EEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+     ++  E++KK     E+ Q+PD
Sbjct  685  EEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKERAGGDEAAESKKK----DEKQQKPD  740

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGN  240
            L  LS  LPSGWQAYWDES+K+VYYGN
Sbjct  741  LTKLSAHLPSGWQAYWDESTKKVYYGN  767



>ref|XP_011461600.1| PREDICTED: uncharacterized protein LOC101298981 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011461601.1| PREDICTED: uncharacterized protein LOC101298981 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011461602.1| PREDICTED: uncharacterized protein LOC101298981 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=751

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV   KK      S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  +KRQR
Sbjct  594  VQSKVQSTKKRKTPASSSLRSNKKVSSLVDKWKAAKEELLEDEEESEDTYESLE-RKRQR  652

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKE-TEKKPTDGTEENQQPDL  318
            EIEEW +QQI SG+AKDNANFQPLGG+WRE+VKRR+A+  +E  +  P   +  NQQPDL
Sbjct  653  EIEEWYSQQITSGDAKDNANFQPLGGNWREKVKRRKAQLAREAAQTAPEAPSNGNQQPDL  712

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              LS  LPSGWQ YWDESSKQVYYGN  
Sbjct  713  TELSRDLPSGWQVYWDESSKQVYYGNTV  740



>ref|XP_006656031.1| PREDICTED: formin-binding protein 4-like isoform X2 [Oryza brachyantha]
 ref|XP_006656032.1| PREDICTED: formin-binding protein 4-like isoform X3 [Oryza brachyantha]
Length=773

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 118/149 (79%), Gaps = 7/149 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK   AV ++LRSNKKVS+LVDKWKAAKEEL  EE+EE  SA + LE+KRQ++I
Sbjct  615  SKVIRSKKR--AVAASLRSNKKVSSLVDKWKAAKEELRDEEDEEPESALDALERKRQKDI  672

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG----TEENQ-QP  324
            +EWR QQIASGEA++NANF PLGGDWR+RVKRRRAE  KE + +P       T+ ++ QP
Sbjct  673  DEWRKQQIASGEAQENANFVPLGGDWRDRVKRRRAEAKKEAKSEPIPAPVSVTDLHRGQP  732

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGNA  237
            DL  LS GLPSGWQAY DES+KQVYYG++
Sbjct  733  DLAELSKGLPSGWQAYMDESTKQVYYGSS  761



>ref|XP_004294901.2| PREDICTED: formin-binding protein 4 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=896

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV   KK      S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  +KRQR
Sbjct  739  VQSKVQSTKKRKTPASSSLRSNKKVSSLVDKWKAAKEELLEDEEESEDTYESLE-RKRQR  797

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKE-TEKKPTDGTEENQQPDL  318
            EIEEW +QQI SG+AKDNANFQPLGG+WRE+VKRR+A+  +E  +  P   +  NQQPDL
Sbjct  798  EIEEWYSQQITSGDAKDNANFQPLGGNWREKVKRRKAQLAREAAQTAPEAPSNGNQQPDL  857

Query  317  NALSIGLPSGWQAYWDESSKQVYYGNAA  234
              LS  LPSGWQ YWDESSKQVYYGN  
Sbjct  858  TELSRDLPSGWQVYWDESSKQVYYGNTV  885



>ref|XP_006656030.1| PREDICTED: formin-binding protein 4-like isoform X1 [Oryza brachyantha]
Length=859

 Score =   154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 118/149 (79%), Gaps = 7/149 (5%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK   AV ++LRSNKKVS+LVDKWKAAKEEL  EE+EE  SA + LE+KRQ++I
Sbjct  701  SKVIRSKKR--AVAASLRSNKKVSSLVDKWKAAKEELRDEEDEEPESALDALERKRQKDI  758

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG----TEENQ-QP  324
            +EWR QQIASGEA++NANF PLGGDWR+RVKRRRAE  KE + +P       T+ ++ QP
Sbjct  759  DEWRKQQIASGEAQENANFVPLGGDWRDRVKRRRAEAKKEAKSEPIPAPVSVTDLHRGQP  818

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGNA  237
            DL  LS GLPSGWQAY DES+KQVYYG++
Sbjct  819  DLAELSKGLPSGWQAYMDESTKQVYYGSS  847



>gb|EMT11848.1| hypothetical protein F775_13332 [Aegilops tauschii]
Length=856

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE   A E LE+KR++EI
Sbjct  703  TKVPRTKKRPVAVASSLRSNKKVSSLVDKWKAAKEELRDEEEEEPEDALEYLERKRRKEI  762

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            + WR QQIASGEAK+NANF PLGGDWR+RVKR+RAE   E+ +   +  +   +PDL+ L
Sbjct  763  DGWRKQQIASGEAKENANFVPLGGDWRDRVKRKRAEAKTESIRAAAE--QHKGEPDLSEL  820

Query  308  SIGLPSGWQAYWDESSKQVYYGN  240
            S GLPSGWQAY DES+KQ+YYGN
Sbjct  821  SKGLPSGWQAYIDESTKQMYYGN  843



>ref|XP_008358896.1| PREDICTED: formin-binding protein 4-like [Malus domestica]
Length=935

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 109/155 (70%), Gaps = 12/155 (8%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK T+A  S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  K RQR
Sbjct  774  VQSKVPRTKKRTIAAASSLRSNKKVSSLVDKWKAAKEELLEDEEEPENAYELLEWK-RQR  832

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMK--------ETEKKPTDGTE  339
             IEEW AQQI SGEAKDNANFQ LGGDWRE+VKRR+A+  +           + PTDG  
Sbjct  833  GIEEWYAQQITSGEAKDNANFQRLGGDWREKVKRRKAQLAREAXKTAAASASEAPTDG--  890

Query  338  ENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
             N+ PDL   S GLP GWQAYWDESSKQVYYGN  
Sbjct  891  -NKHPDLTEQSNGLPPGWQAYWDESSKQVYYGNTV  924



>ref|XP_008384608.1| PREDICTED: formin-binding protein 4 [Malus domestica]
Length=935

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 109/155 (70%), Gaps = 12/155 (8%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK T+A  S+LRSNKKVS+LVDKWKAAKEEL  +EEE   +   +  K RQR
Sbjct  774  VQSKVPRTKKRTIAAASSLRSNKKVSSLVDKWKAAKEELLEDEEEPENAYELLEWK-RQR  832

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMK--------ETEKKPTDGTE  339
             IEEW AQQI SGEAKDNANFQ LGGDWRE+VKRR+A+  +           + PTDG  
Sbjct  833  GIEEWYAQQITSGEAKDNANFQRLGGDWREKVKRRKAQLAREAXKTAAASASEAPTDG--  890

Query  338  ENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
             N+ PDL   S GLP GWQAYWDESSKQVYYGN  
Sbjct  891  -NKXPDLTEQSNGLPPGWQAYWDESSKQVYYGNTV  924



>gb|KHN11174.1| hypothetical protein glysoja_039437 [Glycine soja]
Length=917

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 107/146 (73%), Gaps = 9/146 (6%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKK       WKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  769  TKVVRNRKRAVAVGSSLKSNKK-------WKAAKEELLEEEEEPDSVYEVLE-RKRQREI  820

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEEN-QQPDLNA  312
            EEW A+QIASGEAKDNANFQPLGGDWRE+VKRRRA+  KE+   P D  E N QQPD + 
Sbjct  821  EEWHAKQIASGEAKDNANFQPLGGDWREKVKRRRAQAAKESVSTPQDAIEHNQQQPDPSE  880

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
             S GLP+ WQAYWD+S+KQ+YYGN  
Sbjct  881  HSKGLPTNWQAYWDDSTKQIYYGNTV  906



>ref|XP_007020413.1| WW domain-containing protein, putative isoform 3 [Theobroma cacao]
 gb|EOY11938.1| WW domain-containing protein, putative isoform 3 [Theobroma cacao]
Length=905

 Score =   152 bits (383),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK AR KK TVA  S+LRSNKKVS+LVDKWKAAKEELH   E+E  + Y +LE+KRQR
Sbjct  763  VSSKAARTKKRTVAATSSLRSNKKVSSLVDKWKAAKEELHENAEDEPENPYAMLERKRQR  822

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRA-EKMKETEKKPTDGTEE-NQQPD  321
            EIEEWRAQQIASGEAKDNANFQPLGGDWRE+VKRRRA +K KE  + P++   + N+QPD
Sbjct  823  EIEEWRAQQIASGEAKDNANFQPLGGDWREKVKRRRAQQKAKEAAETPSEVVPDGNEQPD  882

Query  320  LNALSIGLPSGWQAY  276
            L+ LS  LPSGWQ Y
Sbjct  883  LDELSRDLPSGWQVY  897



>ref|XP_010465144.1| PREDICTED: formin-binding protein 4-like isoform X2 [Camelina 
sativa]
 ref|XP_010465145.1| PREDICTED: formin-binding protein 4-like isoform X2 [Camelina 
sativa]
Length=839

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 11/152 (7%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            +KV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEE+         +KRQRE
Sbjct  681  TKVKRPKKRTVGATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEDDDYGILD--RKRQRE  738

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRR--RAEKMK----ETEKKPTDGTEENQ  330
            IEEW+++QIASGEAKDNANFQP+ GDWRE+VKR+  RAEK +    E  +K  D  E+ Q
Sbjct  739  IEEWKSRQIASGEAKDNANFQPIVGDWREKVKRKKERAEKSQRKADENSQKKAD--EKQQ  796

Query  329  QPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            +PDL  LS  LPSGWQAYWDES+K+VYYGN +
Sbjct  797  KPDLTKLSANLPSGWQAYWDESTKKVYYGNTS  828



>ref|XP_010465146.1| PREDICTED: formin-binding protein 4-like isoform X3 [Camelina 
sativa]
 ref|XP_010465147.1| PREDICTED: formin-binding protein 4-like isoform X3 [Camelina 
sativa]
Length=775

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 11/152 (7%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            +KV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEE+         +KRQRE
Sbjct  617  TKVKRPKKRTVGATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEDDDYGILD--RKRQRE  674

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRR--RAEKMK----ETEKKPTDGTEENQ  330
            IEEW+++QIASGEAKDNANFQP+ GDWRE+VKR+  RAEK +    E  +K  D  E+ Q
Sbjct  675  IEEWKSRQIASGEAKDNANFQPIVGDWREKVKRKKERAEKSQRKADENSQKKAD--EKQQ  732

Query  329  QPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            +PDL  LS  LPSGWQAYWDES+K+VYYGN +
Sbjct  733  KPDLTKLSANLPSGWQAYWDESTKKVYYGNTS  764



>ref|XP_010644626.1| PREDICTED: uncharacterized protein LOC100249836 isoform X2 [Vitis 
vinifera]
Length=947

 Score =   152 bits (383),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SK +R +K T+ + S+LRSNKKVS+LVDKWKAAKEELH +EE E  + +EILEKKRQR I
Sbjct  791  SKASRTEKRTIGMTSSLRSNKKVSSLVDKWKAAKEELHEDEESEPENGFEILEKKRQRAI  850

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK-KPTDGTEENQQPDLNA  312
            EEWRAQQIASGEAKDNANFQPLGGDWRERV+R+RA K  E +K  P     ++QQPDL  
Sbjct  851  EEWRAQQIASGEAKDNANFQPLGGDWRERVRRKRARKSSEAKKSSPEPTAYKSQQPDLVE  910

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            LS  LPSGWQAYWDES+K VYYGNA 
Sbjct  911  LSRDLPSGWQAYWDESTKLVYYGNAV  936



>emb|CBI39790.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   151 bits (381),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SK +R +K T+ + S+LRSNKKVS+LVDKWKAAKEELH +EE E  + +EILEKKRQR I
Sbjct  664  SKASRTEKRTIGMTSSLRSNKKVSSLVDKWKAAKEELHEDEESEPENGFEILEKKRQRAI  723

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK-KPTDGTEENQQPDLNA  312
            EEWRAQQIASGEAKDNANFQPLGGDWRERV+R+RA K  E +K  P     ++QQPDL  
Sbjct  724  EEWRAQQIASGEAKDNANFQPLGGDWRERVRRKRARKSSEAKKSSPEPTAYKSQQPDLVE  783

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            LS  LPSGWQAYWDES+K VYYGNA 
Sbjct  784  LSRDLPSGWQAYWDESTKLVYYGNAV  809



>gb|KFK38660.1| hypothetical protein AALP_AA3G143500 [Arabis alpina]
Length=883

 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TV   STLRSNKKVS+LVDKWKAAKEE +  EEEE    Y IL++KR+REI
Sbjct  728  SKVKRTKKRTVTATSTLRSNKKVSSLVDKWKAAKEEFNDSEEEEEEEDYGILDRKRRREI  787

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+A   +E E+      E+ Q+PDL  L
Sbjct  788  EEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKARAEREAEEP-EKKDEKQQKPDLTKL  846

Query  308  SIGLPSGWQAYWDESSKQVYYGNAA  234
            S  LPSGWQAYWDES+K+VYYGN +
Sbjct  847  SAHLPSGWQAYWDESTKKVYYGNTS  871



>ref|XP_010644625.1| PREDICTED: uncharacterized protein LOC100249836 isoform X1 [Vitis 
vinifera]
Length=981

 Score =   151 bits (382),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SK +R +K T+ + S+LRSNKKVS+LVDKWKAAKEELH +EE E  + +EILEKKRQR I
Sbjct  825  SKASRTEKRTIGMTSSLRSNKKVSSLVDKWKAAKEELHEDEESEPENGFEILEKKRQRAI  884

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK-KPTDGTEENQQPDLNA  312
            EEWRAQQIASGEAKDNANFQPLGGDWRERV+R+RA K  E +K  P     ++QQPDL  
Sbjct  885  EEWRAQQIASGEAKDNANFQPLGGDWRERVRRKRARKSSEAKKSSPEPTAYKSQQPDLVE  944

Query  311  LSIGLPSGWQAYWDESSKQVYYGNAA  234
            LS  LPSGWQAYWDES+K VYYGNA 
Sbjct  945  LSRDLPSGWQAYWDESTKLVYYGNAV  970



>gb|KFK38659.1| hypothetical protein AALP_AA3G143500 [Arabis alpina]
Length=927

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK TV   STLRSNKKVS+LVDKWKAAKEE +  EEEE    Y IL++KR+REI
Sbjct  772  SKVKRTKKRTVTATSTLRSNKKVSSLVDKWKAAKEEFNDSEEEEEEEDYGILDRKRRREI  831

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEW+++QIASGEAKDNANFQPLGGDWRE+VKRR+A   +E E+      E+ Q+PDL  L
Sbjct  832  EEWKSRQIASGEAKDNANFQPLGGDWREKVKRRKARAEREAEEP-EKKDEKQQKPDLTKL  890

Query  308  SIGLPSGWQAYWDESSKQVYYGNAA  234
            S  LPSGWQAYWDES+K+VYYGN +
Sbjct  891  SAHLPSGWQAYWDESTKKVYYGNTS  915



>ref|XP_006857706.1| hypothetical protein AMTR_s00061p00171230 [Amborella trichopoda]
 gb|ERN19173.1| hypothetical protein AMTR_s00061p00171230 [Amborella trichopoda]
Length=1011

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 111/153 (73%), Gaps = 8/153 (5%)
 Frame = -2

Query  671   PSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasay-eilEKKRQR  495
             PSKV R KK T+AV  TLR+NKKVS LVDKWKAAKEEL  E EE+      E+ EKKRQ+
Sbjct  850   PSKVVRGKKRTIAVAPTLRANKKVSTLVDKWKAAKEELQEEGEEDELENAYELFEKKRQK  909

Query  494   EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR------AEKMKETEKKPTDGTEEN  333
             EIE+WR +QIASGEAKDNANFQPLGGDWR RVKR+R      A + +  E + T  TE+ 
Sbjct  910   EIEKWRMKQIASGEAKDNANFQPLGGDWRARVKRKRMAAASDAGQTQAMEPEAT-LTEKQ  968

Query  332   QQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
              QPDL  L+  LPS WQAYWDESS QVYY N A
Sbjct  969   LQPDLEELTKSLPSDWQAYWDESSGQVYYWNMA  1001



>ref|XP_006296953.1| hypothetical protein CARUB_v10012949mg [Capsella rubella]
 gb|EOA29851.1| hypothetical protein CARUB_v10012949mg [Capsella rubella]
Length=770

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK TVA  STLRSNKKVS+LVDKWKAAKEEL+  EEEE         +KRQREI
Sbjct  620  TKVKRTKKRTVAATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDYGILD--RKRQREI  677

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEW+++QIASGEAKDNANFQPL GDWRE+VKR++    K+++KK     E+ Q+PDL+ +
Sbjct  678  EEWKSRQIASGEAKDNANFQPLIGDWREKVKRKKERAEKKSQKK---DEEKQQKPDLSKI  734

Query  308  SIGLPSGWQAYWDESSKQVYYGNAA  234
            S  LPSGWQAYWDES+K+VYYGN +
Sbjct  735  SANLPSGWQAYWDESTKKVYYGNTS  759



>ref|XP_010465143.1| PREDICTED: formin-binding protein 4-like isoform X1 [Camelina 
sativa]
Length=889

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 11/152 (7%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            +KV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEE+         +KRQRE
Sbjct  731  TKVKRPKKRTVGATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEDDDYGILD--RKRQRE  788

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRR--RAEKMK----ETEKKPTDGTEENQ  330
            IEEW+++QIASGEAKDNANFQP+ GDWRE+VKR+  RAEK +    E  +K  D  E+ Q
Sbjct  789  IEEWKSRQIASGEAKDNANFQPIVGDWREKVKRKKERAEKSQRKADENSQKKAD--EKQQ  846

Query  329  QPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            +PDL  LS  LPSGWQAYWDES+K+VYYGN +
Sbjct  847  KPDLTKLSANLPSGWQAYWDESTKKVYYGNTS  878



>ref|XP_006296954.1| hypothetical protein CARUB_v10012949mg [Capsella rubella]
 gb|EOA29852.1| hypothetical protein CARUB_v10012949mg [Capsella rubella]
Length=883

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK TVA  STLRSNKKVS+LVDKWKAAKEEL+  EEEE         +KRQREI
Sbjct  733  TKVKRTKKRTVAATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDYGILD--RKRQREI  790

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            EEW+++QIASGEAKDNANFQPL GDWRE+VKR++    K+++KK     E+ Q+PDL+ +
Sbjct  791  EEWKSRQIASGEAKDNANFQPLIGDWREKVKRKKERAEKKSQKK---DEEKQQKPDLSKI  847

Query  308  SIGLPSGWQAYWDESSKQVYYGNAA  234
            S  LPSGWQAYWDES+K+VYYGN +
Sbjct  848  SANLPSGWQAYWDESTKKVYYGNTS  872



>ref|NP_187930.2| WW domain-containing protein [Arabidopsis thaliana]
 gb|AEE75317.1| WW domain-containing protein [Arabidopsis thaliana]
Length=771

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 104/134 (78%), Gaps = 6/134 (4%)
 Frame = -2

Query  635  AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREIEEWRAQQIASG  456
            A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE  S      +KR+REIEEW+++QIASG
Sbjct  633  AATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDSEILD--RKRKREIEEWKSRQIASG  690

Query  455  EAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNALSIGLPSGWQAY  276
            EAKDNANFQPLGGDWRE+VKR+R    K  +K P    E+ Q+PDL  LS  LPS WQAY
Sbjct  691  EAKDNANFQPLGGDWREKVKRKRERAEKSQKKDP----EKQQKPDLTKLSANLPSEWQAY  746

Query  275  WDESSKQVYYGNAA  234
            WDES+K+VYYGN +
Sbjct  747  WDESTKKVYYGNTS  760



>ref|NP_001154613.1| WW domain-containing protein [Arabidopsis thaliana]
 gb|AEE75318.1| WW domain-containing protein [Arabidopsis thaliana]
Length=892

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 104/134 (78%), Gaps = 6/134 (4%)
 Frame = -2

Query  635  AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREIEEWRAQQIASG  456
            A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE  S      +KR+REIEEW+++QIASG
Sbjct  754  AATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDSEILD--RKRKREIEEWKSRQIASG  811

Query  455  EAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNALSIGLPSGWQAY  276
            EAKDNANFQPLGGDWRE+VKR+R    K  +K P    E+ Q+PDL  LS  LPS WQAY
Sbjct  812  EAKDNANFQPLGGDWREKVKRKRERAEKSQKKDP----EKQQKPDLTKLSANLPSEWQAY  867

Query  275  WDESSKQVYYGNAA  234
            WDES+K+VYYGN +
Sbjct  868  WDESTKKVYYGNTS  881



>gb|AFW86408.1| hypothetical protein ZEAMMB73_868308 [Zea mays]
Length=439

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 5/148 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  V + S+LRSNKKVS+LVDKWKAAKEEL  EEEEE  SA E LE+KRQ+EI
Sbjct  279  TKVTRNKKRAVGITSSLRSNKKVSSLVDKWKAAKEELRNEEEEEPESALEALERKRQKEI  338

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK---KPTDGTEENQQ--P  324
            EEWR QQIASGEA++NANF P+ GDWR+RVKR+RA+   E++      + G+ E  +  P
Sbjct  339  EEWRKQQIASGEAQENANFIPVRGDWRDRVKRKRAQAKNESKDDIVAASLGSSEQHKGPP  398

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGN  240
            DL  LS  LP+GWQAY DE +KQVYYGN
Sbjct  399  DLAELSKDLPTGWQAYLDEYTKQVYYGN  426



>ref|XP_002436906.1| hypothetical protein SORBIDRAFT_10g010870 [Sorghum bicolor]
 gb|EER88273.1| hypothetical protein SORBIDRAFT_10g010870 [Sorghum bicolor]
Length=846

 Score =   145 bits (366),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 5/147 (3%)
 Frame = -2

Query  665  KVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREIE  486
            +V R KK  V + S++RSNKKVS+LVDKWKAAKEEL  EEEEE  SA E LE+KRQ+EIE
Sbjct  687  RVIRSKKRAVGITSSMRSNKKVSSLVDKWKAAKEELRGEEEEEPESALEALERKRQKEIE  746

Query  485  EWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQ-----PD  321
            EWR QQI SGEA++NANF P+ GDWR+RVKRRRAE  KE++      +  + +     PD
Sbjct  747  EWRKQQITSGEAQENANFVPVRGDWRDRVKRRRAEAKKESKDDTVAASLSSSEQHKGPPD  806

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGN  240
            L  LS GLP+ WQAY DES+KQVYYGN
Sbjct  807  LAELSKGLPTSWQAYLDESTKQVYYGN  833



>ref|XP_010487073.1| PREDICTED: formin-binding protein 4-like [Camelina sativa]
Length=903

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 114/158 (72%), Gaps = 16/158 (10%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            +KV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEE+     +   +KRQRE
Sbjct  738  TKVKRPKKRTVGATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEDDYGILD---RKRQRE  794

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRR--RAEKMKETEK----------KPTD  348
            IEEW+++QIASGEAKDNANFQP+ GDWRE+VKR+  RAEK ++ E+          K   
Sbjct  795  IEEWKSRQIASGEAKDNANFQPIVGDWREKVKRKKERAEKSQKKEQAEKSQNKSDEKSKK  854

Query  347  GTEENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
              E+ Q+PDL   S  LPSGW AYWDES+K+VYYGN +
Sbjct  855  VDEKQQKPDLTNFSTNLPSGWLAYWDESTKKVYYGNTS  892



>ref|NP_001146286.1| uncharacterized protein LOC100279861 [Zea mays]
 gb|ACL53630.1| unknown [Zea mays]
 gb|AFW86406.1| hypothetical protein ZEAMMB73_868308 [Zea mays]
 gb|AFW86407.1| hypothetical protein ZEAMMB73_868308 [Zea mays]
Length=812

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 5/148 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  V + S+LRSNKKVS+LVDKWKAAKEEL  EEEEE  SA E LE+KRQ+EI
Sbjct  652  TKVTRNKKRAVGITSSLRSNKKVSSLVDKWKAAKEELRNEEEEEPESALEALERKRQKEI  711

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK---KPTDGTEENQQ--P  324
            EEWR QQIASGEA++NANF P+ GDWR+RVKR+RA+   E++      + G+ E  +  P
Sbjct  712  EEWRKQQIASGEAQENANFIPVRGDWRDRVKRKRAQAKNESKDDIVAASLGSSEQHKGPP  771

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGN  240
            DL  LS  LP+GWQAY DE +KQVYYGN
Sbjct  772  DLAELSKDLPTGWQAYLDEYTKQVYYGN  799



>ref|XP_008658490.1| PREDICTED: uncharacterized protein LOC100279861 isoform X1 [Zea 
mays]
Length=855

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 5/148 (3%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  V + S+LRSNKKVS+LVDKWKAAKEEL  EEEEE  SA E LE+KRQ+EI
Sbjct  695  TKVTRNKKRAVGITSSLRSNKKVSSLVDKWKAAKEELRNEEEEEPESALEALERKRQKEI  754

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEK---KPTDGTEENQQ--P  324
            EEWR QQIASGEA++NANF P+ GDWR+RVKR+RA+   E++      + G+ E  +  P
Sbjct  755  EEWRKQQIASGEAQENANFIPVRGDWRDRVKRKRAQAKNESKDDIVAASLGSSEQHKGPP  814

Query  323  DLNALSIGLPSGWQAYWDESSKQVYYGN  240
            DL  LS  LP+GWQAY DE +KQVYYGN
Sbjct  815  DLAELSKDLPTGWQAYLDEYTKQVYYGN  842



>gb|EEE65564.1| hypothetical protein OsJ_21058 [Oryza sativa Japonica Group]
Length=891

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 117/191 (61%), Gaps = 47/191 (25%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SKV R KK  V+V ++LRSNKKVS+LVDKWKAAKEEL  EE+EE  SA + LE+KRQ++I
Sbjct  689  SKVVRSKKRAVSVATSLRSNKKVSSLVDKWKAAKEELRDEEDEEPESALDALERKRQKDI  748

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMK----ETEKKPTDGTEENQ-QP  324
            +EWR QQIASGEA++NANF PLGGDWR+RVKRRRAE  K    ET   P   T+ ++ QP
Sbjct  749  DEWRKQQIASGEAQENANFVPLGGDWRDRVKRRRAEAKKEANSETISAPVSVTDLHKGQP  808

Query  323  DLNALSIGLPSGWQ------------------------------------------AYWD  270
            DL  L  GLPSGWQ                                          AY D
Sbjct  809  DLAELCKGLPSGWQNILHLINLFTRDVITVEVQLHKDWLVSSMGKAPSSNLWSIFVAYLD  868

Query  269  ESSKQVYYGNA  237
            ES+KQVYYGN+
Sbjct  869  ESTKQVYYGNS  879



>gb|EPS69239.1| hypothetical protein M569_05527, partial [Genlisea aurea]
Length=127

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -2

Query  509  KKRQREIEEWRAQQIASGEAKDNANFQPLGGDWRERV-KRRRAEKMKETEKKPTDGTEEN  333
            KKRQREIEEWRA Q+A+G AKDNANFQPLGGDWRERV KR++ E   E  ++ +   E  
Sbjct  24   KKRQREIEEWRANQVATGAAKDNANFQPLGGDWRERVKKRKKVETTAEETRRTSPKDEAK  83

Query  332  QQPDLNALSIGLPSGWQAYWDESSKQVYYGNA  237
            ++PDL  L+ GLPSGWQAYWDESSKQVYYGN 
Sbjct  84   RKPDLVGLAKGLPSGWQAYWDESSKQVYYGNV  115



>dbj|BAB03122.1| unnamed protein product [Arabidopsis thaliana]
Length=907

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 100/149 (67%), Gaps = 21/149 (14%)
 Frame = -2

Query  635  AVGSTLRSNKKVSNLVDK---------------WKaakeelhaeeeeerasayeilEKKR  501
            A  STLRSNKKVS+LVDK               WK    +    + EE     EIL++KR
Sbjct  754  AATSTLRSNKKVSSLVDKILLDPKLKGVSTCAQWK--AAKEELNDSEEEEDDSEILDRKR  811

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPD  321
            +REIEEW+++QIASGEAKDNANFQPLGGDWRE+VKR+R    K  +K P    E+ Q+PD
Sbjct  812  KREIEEWKSRQIASGEAKDNANFQPLGGDWREKVKRKRERAEKSQKKDP----EKQQKPD  867

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGNAA  234
            L  LS  LPS WQAYWDES+K+VYYGN +
Sbjct  868  LTKLSANLPSEWQAYWDESTKKVYYGNTS  896



>gb|EMS61112.1| hypothetical protein TRIUR3_25390 [Triticum urartu]
Length=909

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R KK  VAV S+LRSNKKVS+LVDKWKAAKEEL  EEEEE   A E LE+KR++EI
Sbjct  774  TKVPRTKKRPVAVASSLRSNKKVSSLVDKWKAAKEELRDEEEEEPEDALEYLERKRRKEI  833

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQ--QPDLN  315
            + WR QQIASGEAK+NANF PLGGDWR+RVKR+RAE  KE + +P     E    +PDL+
Sbjct  834  DGWRKQQIASGEAKENANFVPLGGDWRDRVKRKRAEAKKEAKTEPIRAAAEQHKGEPDLS  893

Query  314  ALSIGLPSGWQ  282
             LS GLPSGWQ
Sbjct  894  ELSKGLPSGWQ  904



>ref|XP_004498163.1| PREDICTED: uncharacterized protein LOC101511978 isoform X1 [Cicer 
arietinum]
Length=915

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            +KV R +K  VAVGS+L+SNKKVS+LVDKWKAAKEEL  EEEE  +    +  +KRQREI
Sbjct  725  TKVVRSRKRAVAVGSSLKSNKKVSSLVDKWKAAKEELLEEEEEPDSVYEALE-RKRQREI  783

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEE-NQQ-PDLN  315
            EEW A+QI+SGEAKDNANFQPLGGDWRE+V+R+RA+   +T  K    TE  NQQ PD+ 
Sbjct  784  EEWCAKQISSGEAKDNANFQPLGGDWREKVRRKRAKAASDTVPKVQVATEHKNQQKPDIV  843

Query  314  ALSIGLPSGWQAYW  273
             LS GLPS WQ  +
Sbjct  844  ELSKGLPSNWQVCF  857



>ref|XP_010418959.1| PREDICTED: uncharacterized protein LOC104704597 [Camelina sativa]
Length=793

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 99/146 (68%), Gaps = 16/146 (11%)
 Frame = -2

Query  668  SKVARKKKGTV-AVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQRE  492
            +KV R KK TV A  STLRSNKKVS+LVDKWKAAKEEL+  EEEE         +KRQRE
Sbjct  633  TKVKRPKKRTVGATTSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDYGILD--RKRQRE  690

Query  491  IEEWRAQQIASGEAKDNANFQPLGGDWRERVKRR--RAEKM-----------KETEKKPT  351
            IEEW+++QIASGEAKDNANFQP+ GDWRE+VKR+  RAEK            K  EK   
Sbjct  691  IEEWKSRQIASGEAKDNANFQPIVGDWREKVKRKKERAEKSQKKERAEKSQNKSDEKSQK  750

Query  350  DGTEENQQPDLNALSIGLPSGWQAYW  273
               E+ Q+PDL  LS  LPSGWQ  +
Sbjct  751  KADEKQQKPDLTKLSTNLPSGWQVNY  776



>ref|XP_001760339.1| predicted protein [Physcomitrella patens]
 gb|EDQ74730.1| predicted protein [Physcomitrella patens]
Length=1103

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 104/168 (62%), Gaps = 29/168 (17%)
 Frame = -2

Query  656   RKKKGTVAVGSTLRSNKKVSNLVDKW---KaakeelhaeeeeerasayeilEKKRQREIE  486
             +K+  + AVG++L SNKKVS LV+KW   +         +E++     E LE+KRQ+EIE
Sbjct  924   KKRSHSAAVGASLMSNKKVSTLVNKWLAAQEELHSSDEADEDKDMFDVEALERKRQKEIE  983

Query  485   EWRAQQIASGEAKDNANFQPLGG-DWRERVKRR-----------RAEKMKETEKKPTDGT  342
             EWR Q +ASG A +NANFQPLG  DWRERVK+            ++ K +E++K+PT+ +
Sbjct  984   EWRHQTLASGGALENANFQPLGTLDWRERVKKAKEASKLATKKGKSAKSEESQKEPTNVS  1043

Query  341   EEN--------------QQPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
             +E+              ++PDL  L+ GLP+GWQA+WD  S +VYYGN
Sbjct  1044  DESSLDADKVAVNTTPPKRPDLKELTKGLPAGWQAFWDAESCEVYYGN  1091



>ref|XP_006452661.1| hypothetical protein CICLE_v10007493mg [Citrus clementina]
 gb|ESR65901.1| hypothetical protein CICLE_v10007493mg [Citrus clementina]
Length=804

 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 100/147 (68%), Gaps = 19/147 (13%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL+  EE+E  +AYEILE+KRQR
Sbjct  662  VQSKV-RNKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELNENEEDEPENAYEILERKRQR  720

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEK--MKETEKKPTDGTEENQQPD  321
            EIEEWRAQQIASGEAKDNANFQPLG       K ++  K       KK  +G        
Sbjct  721  EIEEWRAQQIASGEAKDNANFQPLGELLSSAGKYQKTNKGFCLFCPKKEGNG--------  772

Query  320  LNALSIGLPSGWQAYWDESSKQVYYGN  240
             + L +       AYWDESSKQ+YYGN
Sbjct  773  -HLLEV-------AYWDESSKQIYYGN  791



>gb|KCW68367.1| hypothetical protein EUGRSUZ_F02026 [Eucalyptus grandis]
Length=728

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL  ++E+E  +A  +LEKKRQR
Sbjct  635  VQSKVLRSKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELQEDDEDEAKTALALLEKKRQR  694

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDW  411
            EIEEWRAQQIASGEAK+NANFQPLGGDW
Sbjct  695  EIEEWRAQQIASGEAKENANFQPLGGDW  722



>ref|XP_007020416.1| WW domain-containing protein, putative isoform 6, partial [Theobroma 
cacao]
 gb|EOY11941.1| WW domain-containing protein, putative isoform 6, partial [Theobroma 
cacao]
Length=887

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SK AR KK TVA  S+LRSNKKVS+LVDKWKAAKEELH   E+E  + Y +LE+KRQR
Sbjct  800  VSSKAARTKKRTVAATSSLRSNKKVSSLVDKWKAAKEELHENAEDEPENPYAMLERKRQR  859

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGDW  411
            EIEEWRAQQIASGEAKDNANFQPLGGDW
Sbjct  860  EIEEWRAQQIASGEAKDNANFQPLGGDW  887



>ref|XP_010061426.1| PREDICTED: uncharacterized protein LOC104449101 isoform X3 [Eucalyptus 
grandis]
Length=858

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  674  VPSKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            V SKV R KK TVAV  +LRSNKKVS+LVDKWKAAKEEL  ++E+E  +A  +LEKKRQR
Sbjct  772  VQSKVLRSKKRTVAVAPSLRSNKKVSSLVDKWKAAKEELQEDDEDEAKTALALLEKKRQR  831

Query  494  EIEEWRAQQIASGEAKDNANFQPLGGD  414
            EIEEWRAQQIASGEAK+NANFQPLGGD
Sbjct  832  EIEEWRAQQIASGEAKENANFQPLGGD  858



>ref|XP_002979087.1| hypothetical protein SELMODRAFT_418782 [Selaginella moellendorffii]
 gb|EFJ20044.1| hypothetical protein SELMODRAFT_418782 [Selaginella moellendorffii]
Length=548

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 89/146 (61%), Gaps = 18/146 (12%)
 Frame = -2

Query  656  RKKKGTVAVGSTLRSNKKVSNLVDKW---KaakeelhaeeeeerasayeilEKKRQREIE  486
            R KKG   V   +    K+S+LV+KW   K    E   E+ E+    +E +E+KRQREI+
Sbjct  401  RMKKGNAPV--LVSKTSKMSSLVNKWMAAKQELHESDDEDGEKELYDHEAIERKRQREID  458

Query  485  EWRAQQIASGEAKDNANFQPLGG-DWRERVKRRRAE---KMKETEKKPTDGTEENQQPDL  318
            +WR +QIASG+A DN NFQPLG  DWR+RVKR R E   K+  T KK          P+L
Sbjct  459  DWRREQIASGQALDNVNFQPLGPIDWRDRVKRARKEGQSKVSSTSKK---------HPNL  509

Query  317  NALSIGLPSGWQAYWDESSKQVYYGN  240
            + LS GL  GW+A++DE S  VYYGN
Sbjct  510  DVLSKGLAPGWKAFYDEKSGDVYYGN  535



>ref|XP_002993992.1| hypothetical protein SELMODRAFT_431966 [Selaginella moellendorffii]
 gb|EFJ04932.1| hypothetical protein SELMODRAFT_431966 [Selaginella moellendorffii]
Length=548

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 89/146 (61%), Gaps = 18/146 (12%)
 Frame = -2

Query  656  RKKKGTVAVGSTLRSNKKVSNLVDKW---KaakeelhaeeeeerasayeilEKKRQREIE  486
            R KKG   V   +    K+S+LV+KW   K    E   E+ E+    +E +E+KRQREI+
Sbjct  401  RMKKGNAPV--LVSKTSKMSSLVNKWMAAKQELHESDDEDGEKELYDHEAIERKRQREID  458

Query  485  EWRAQQIASGEAKDNANFQPLGG-DWRERVKRRRAE---KMKETEKKPTDGTEENQQPDL  318
            +WR +QIASG+A DN NFQPLG  DWR+RVKR R E   K+  T KK          P+L
Sbjct  459  DWRREQIASGQALDNVNFQPLGPIDWRDRVKRARKEGQSKVSSTSKK---------HPNL  509

Query  317  NALSIGLPSGWQAYWDESSKQVYYGN  240
            + LS GL  GW+A++DE S  VYYGN
Sbjct  510  DVLSKGLAPGWKAFYDEKSGDVYYGN  535



>ref|XP_005648919.1| hypothetical protein COCSUDRAFT_83679 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24375.1| hypothetical protein COCSUDRAFT_83679 [Coccomyxa subellipsoidea 
C-169]
Length=788

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 98/150 (65%), Gaps = 13/150 (9%)
 Frame = -2

Query  656  RKKKGTVAVG------STLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQR  495
            +++K TV +G        L+ +K  S+L+DKW A +++L   EEE+     + LE+KR R
Sbjct  542  KREKATVGIGPLAKKKKALKGSKATSSLIDKWAAVRKDLVEAEEEDEVLDADALERKRLR  601

Query  494  EIEEWRAQQIASG-EAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEE----NQ  330
            E EEWR +Q+ +G  ++DN+NFQPL  DWRE++K  +A    E ++KP    +      +
Sbjct  602  EAEEWRLKQLRAGVSSEDNSNFQPLAVDWREKLKTTKA--AAEKKRKPVSAQQAPVTYTE  659

Query  329  QPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
            +PDL ALS+GLP+GW+A WD++SK+VYY N
Sbjct  660  KPDLEALSVGLPAGWKALWDKASKEVYYAN  689



>emb|CAN72861.1| hypothetical protein VITISV_026660 [Vitis vinifera]
Length=993

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 23/145 (16%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDKWKaakeelhaeeeeerasayeilEKKRQREI  489
            SK +R +K T+ + S+LRSNKKVS+LVDKWKAAKEELH +EE            + +   
Sbjct  861  SKASRTEKRTIGMTSSLRSNKKVSSLVDKWKAAKEELHEDEE-----------SEPENGF  909

Query  488  EEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDGTEENQQPDLNAL  309
            E++R +      AK N   + LG    E + + R+  +K T  K       +QQPDL  L
Sbjct  910  EDFREEA-----AKGNRGVRGLGASELESLVKLRSLHLKPTAYK-------SQQPDLVEL  957

Query  308  SIGLPSGWQAYWDESSKQVYYGNAA  234
            S  LPSGWQAYWDES+K VYYGNA 
Sbjct  958  SRDLPSGWQAYWDESTKLVYYGNAV  982



>ref|XP_007020417.1| WW domain-containing protein, putative isoform 7 [Theobroma cacao]
 gb|EOY11942.1| WW domain-containing protein, putative isoform 7 [Theobroma cacao]
Length=902

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = -2

Query  416  DWRERVKRRRAE-KMKETEKKPTDGTEE-NQQPDLNALSIGLPSGWQAYWDESSKQVYYG  243
            D RE+VKRRRA+ K KE  + P++   + N+QPDL+ LS  LPSGWQAYWDE+SKQVYYG
Sbjct  829  DKREKVKRRRAQQKAKEAAETPSEVVPDGNEQPDLDELSRDLPSGWQAYWDETSKQVYYG  888

Query  242  NA  237
            N 
Sbjct  889  NV  890



>ref|XP_007020415.1| WW domain-containing protein, putative isoform 5 [Theobroma cacao]
 gb|EOY11940.1| WW domain-containing protein, putative isoform 5 [Theobroma cacao]
Length=865

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = -2

Query  416  DWRERVKRRRAE-KMKETEKKPTDGTEE-NQQPDLNALSIGLPSGWQAYWDESSKQVYYG  243
            D RE+VKRRRA+ K KE  + P++   + N+QPDL+ LS  LPSGWQAYWDE+SKQVYYG
Sbjct  792  DKREKVKRRRAQQKAKEAAETPSEVVPDGNEQPDLDELSRDLPSGWQAYWDETSKQVYYG  851

Query  242  NA  237
            N 
Sbjct  852  NV  853



>ref|XP_005851747.1| hypothetical protein CHLNCDRAFT_133122 [Chlorella variabilis]
 gb|EFN59645.1| hypothetical protein CHLNCDRAFT_133122 [Chlorella variabilis]
Length=759

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 57/104 (55%), Gaps = 21/104 (20%)
 Frame = -2

Query  482  WRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKM--------------------KETE  363
            WR QQ+ SG A  NANF P+ GDWR+RV+++  ++                      E +
Sbjct  646  WRLQQLRSGAADANANFAPMPGDWRQRVQQQPQQQQWRPHNEAAGAAAAVATAVLPPEAQ  705

Query  362  KKPTDG-TEENQQPDLNALSIGLPSGWQAYWDESSKQVYYGNAA  234
               + G   E + PDL+ALS GLP GWQA WD+  K+VYYG+ A
Sbjct  706  ADASAGAVGEFEMPDLDALSAGLPPGWQAMWDKGHKRVYYGHLA  749



>ref|XP_007910560.1| PREDICTED: formin-binding protein 4 [Callorhinchus milii]
Length=897

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ I+EW+AQQ+ SG A+ NANF+ L  DWRER+KRR+
Sbjct  855  QKRIDEWKAQQLVSGRAEKNANFEALPADWRERLKRRK  892



>emb|CEG00791.1| WW domain [Ostreococcus tauri]
Length=147

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 12/100 (12%)
 Frame = -2

Query  506  KRQREIEEWRAQQIASG-EAKDNANFQPLGGDWRERVK--RR-------RAEKMKETEKK  357
            K+ REIE WR+ +   G +   N NF P+G DWR +V   RR       RA + +ET   
Sbjct  36   KKAREIEAWRSTRAREGVDGSTNPNFVPVG-DWRAKVAAARREAKLEEFRALRARETATA  94

Query  356  PTDGTEENQQPDLNAL-SIGLPSGWQAYWDESSKQVYYGN  240
                 E   +  + +     LPSGW+A+ DE+S +V+YG+
Sbjct  95   TASRVEHEGETRVKSTEDATLPSGWRAFVDEASGEVFYGH  134



>gb|KIZ05972.1| hypothetical protein MNEG_1980 [Monoraphidium neglectum]
Length=657

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 15/96 (16%)
 Frame = -2

Query  482  WRAQQIASGEAKDNANFQPLGGDWRERVKRRRAEKMKETEKKPTDG--------------  345
            WR +Q+A+G    N NF PLGG           +  K+   K                  
Sbjct  455  WRREQLAAGAGSSNPNFAPLGGGAGAIAAAVGKKPKKKAAAKGALAAAAAGGAAGGAGGH  514

Query  344  -TEENQQPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
             T   ++PDL+ALS+GLP GW+A W+++S  +YYGN
Sbjct  515  PTHSAEKPDLDALSVGLPVGWRAMWEKASGAIYYGN  550



>ref|XP_010227751.1| PREDICTED: formin-binding protein 4 isoform X4 [Brachypodium 
distachyon]
Length=776

 Score = 40.8 bits (94),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  668  SKVARKKKGTVAVGSTLRSNKKVSNLVDK  582
            +KV R KK  VAV S+LRSNKKVS+LVDK
Sbjct  705  TKVHRTKKRPVAVASSLRSNKKVSSLVDK  733


 Score = 32.3 bits (72),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  583  SGRLQKKSCMQKKKRNVQVHMKY*RRNVNEK  491
            SG+L K+SC+ K+KRN+++  ++ ++N   K
Sbjct  746  SGKLPKRSCVMKRKRNLKMLWRHLKKNAGRK  776



>ref|XP_003967430.1| PREDICTED: formin-binding protein 4-like [Takifugu rubripes]
Length=876

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            +R IE+W+ QQI +G+A  NANF+ L  DWRER+KRR+
Sbjct  836  KRSIEDWKHQQILTGKASKNANFEALPEDWRERIKRRK  873



>ref|XP_010403680.1| PREDICTED: formin-binding protein 4 [Corvus cornix cornix]
Length=727

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRA  384
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+A
Sbjct  685  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRKA  723



>ref|XP_002955634.1| hypothetical protein VOLCADRAFT_106914 [Volvox carteri f. nagariensis]
 gb|EFJ43274.1| hypothetical protein VOLCADRAFT_106914 [Volvox carteri f. nagariensis]
Length=1427

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  329   QPDLNALSIGLPSGWQAYWDESSKQVYYGN  240
             +PDL+ALS GLPSGW+A WD++S  VYYGN
Sbjct  1386  KPDLDALSAGLPSGWRAMWDKNSGDVYYGN  1415



>ref|XP_002127483.1| PREDICTED: formin-binding protein 4-like [Ciona intestinalis]
Length=783

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            +++I EWR +Q  SG+A  NANFQP+G DW++RVK+R+
Sbjct  742  KKKIVEWRREQFKSGKAASNANFQPIGDDWKKRVKQRK  779



>ref|XP_007432656.1| PREDICTED: formin-binding protein 4 [Python bivittatus]
Length=881

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = -2

Query  677  NVPSKVARKKKGTVAVGSTLRSNK-KVSNLVDKWKaakeelhaeeeeerasayeilEKKR  501
            +VP  +  +K   +  GS  + NK K+ +LV KW++ + EL  EE    +     +    
Sbjct  781  HVPKSLPLEKSKKLRRGSKRKKNKTKMPSLVKKWQSIQRELDEEENSSSSDEDREVMS--  838

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRA  384
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+A
Sbjct  839  QKRIEEWKQQQLISGMAERNANFEALPEDWRARLKRRKA  877



>ref|XP_004914259.1| PREDICTED: formin-binding protein 4-like [Xenopus (Silurana) 
tropicalis]
Length=851

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+  Q+ SG A+ NANF+ L  DWR+R+KRR+
Sbjct  809  QKRIEEWKIHQLTSGMAEKNANFEALPEDWRDRLKRRK  846



>ref|XP_008071879.1| PREDICTED: formin-binding protein 4-like, partial [Tarsius syrichta]
Length=354

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  312  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  349



>ref|XP_006984450.1| PREDICTED: formin-binding protein 4 [Peromyscus maniculatus bairdii]
Length=1103

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1061  QRRIEEWKQQQLVSGLAERNANFEALPEDWRARLKRRK  1098



>ref|XP_004941312.1| PREDICTED: formin-binding protein 4 isoform X13 [Gallus gallus]
Length=1096

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1054  QRRIEEWKQQQLLSGMAERNANFEALPEDWRARLKRRK  1091



>ref|XP_010610971.1| PREDICTED: formin-binding protein 4 [Fukomys damarensis]
Length=953

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  911  QRRIEEWKQQQLVSGLAERNANFEALPEDWRARLKRRK  948



>ref|XP_005529187.1| PREDICTED: formin-binding protein 4 [Pseudopodoces humilis]
Length=1000

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  958  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  995



>ref|XP_008631485.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Corvus 
brachyrhynchos]
Length=888

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  846  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  883



>ref|XP_009095510.1| PREDICTED: formin-binding protein 4 [Serinus canaria]
Length=938

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  896  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  933



>ref|XP_010562680.1| PREDICTED: formin-binding protein 4 [Haliaeetus leucocephalus]
Length=1024

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  982   QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  1019



>ref|XP_005496963.1| PREDICTED: formin-binding protein 4 [Zonotrichia albicollis]
Length=858

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  816  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  853



>ref|XP_004174565.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Taeniopygia 
guttata]
Length=962

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  920  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  957



>ref|XP_005426589.1| PREDICTED: formin-binding protein 4 [Geospiza fortis]
Length=760

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  718  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  755



>ref|XP_005046801.1| PREDICTED: formin-binding protein 4, partial [Ficedula albicollis]
Length=925

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  883  QRRIEEWKQQQLMSGMAERNANFEALPEDWRSRLKRRK  920



>ref|XP_005987018.1| PREDICTED: formin-binding protein 4-like [Latimeria chalumnae]
Length=933

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             + IEEW+ QQ+ SG A+ NANF+ L  DWRER+KRR+
Sbjct  891  HKRIEEWKQQQLVSGMAERNANFEALPEDWRERLKRRK  928



>ref|XP_424260.4| PREDICTED: formin-binding protein 4 isoform X9 [Gallus gallus]
Length=1023

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  981   QRRIEEWKQQQLLSGMAERNANFEALPEDWRARLKRRK  1018



>ref|XP_004619146.1| PREDICTED: formin-binding protein 4 [Sorex araneus]
Length=1026

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  984   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1021



>ref|XP_009680890.1| PREDICTED: formin-binding protein 4 [Struthio camelus australis]
Length=816

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  774  QRRIEEWKQQQLLSGMAERNANFEALPEDWRARLKRRK  811



>ref|XP_009890763.1| PREDICTED: formin-binding protein 4, partial [Charadrius vociferus]
Length=664

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  622  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  659



>ref|XP_008504314.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Calypte 
anna]
Length=781

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  739  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  776



>ref|XP_010709208.1| PREDICTED: formin-binding protein 4, partial [Meleagris gallopavo]
Length=1665

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1623  QRRIEEWKQQQLLSGMAERNANFEALPEDWRARLKRRK  1660



>gb|ETE72718.1| Formin-binding protein 4, partial [Ophiophagus hannah]
Length=905

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 3/98 (3%)
 Frame = -2

Query  677  NVPSKVARKKKGTVAVGSTLRSNK-KVSNLVDKWKaakeelhaeeeeerasayeilEKKR  501
            +VP  +  +K   +  GS  + NK K+ +LV KW++ + EL  EE    +     +    
Sbjct  805  HVPKSLPLEKSKKLRRGSKRKKNKTKMPSLVKKWQSIQRELDEEENSSSSDEDREVMS--  862

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  863  QKRIEEWKQQQLISGMAERNANFEALPEDWRARLKRRK  900



>ref|XP_009472269.1| PREDICTED: formin-binding protein 4 [Nipponia nippon]
Length=723

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  681  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  718



>ref|XP_005690276.1| PREDICTED: formin-binding protein 4 [Capra hircus]
Length=949

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  907  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  944



>ref|XP_005984649.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Pantholops 
hodgsonii]
Length=975

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  933  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  970



>ref|XP_005514896.1| PREDICTED: formin-binding protein 4 [Columba livia]
Length=708

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  666  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  703



>ref|XP_008841852.1| PREDICTED: formin-binding protein 4 [Nannospalax galili]
Length=1024

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  982   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1019



>ref|XP_008572269.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Galeopterus 
variegatus]
Length=907

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  865  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  902



>gb|EGW03959.1| Formin-binding protein 4 [Cricetulus griseus]
 gb|ERE70224.1| formin-binding protein 4 [Cricetulus griseus]
Length=932

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  890  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  927



>ref|XP_007608875.1| PREDICTED: formin-binding protein 4 isoform X1, partial [Cricetulus 
griseus]
Length=967

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  925  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  962



>gb|EPQ10535.1| Formin-binding protein 4 [Myotis brandtii]
Length=932

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  890  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  927



>ref|XP_004585382.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Ochotona 
princeps]
Length=1059

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1017  QKRIEEWKLQQLVSGMAERNANFEALPEDWRARLKRRK  1054



>ref|XP_006157913.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4, partial 
[Tupaia chinensis]
Length=956

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  914  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  951



>ref|XP_005438440.1| PREDICTED: formin-binding protein 4 [Falco cherrug]
Length=760

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  718  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  755



>ref|XP_010219680.1| PREDICTED: formin-binding protein 4 [Tinamus guttatus]
Length=684

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  642  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  679



>ref|XP_009565112.1| PREDICTED: formin-binding protein 4 [Cuculus canorus]
Length=791

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  749  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  786



>ref|XP_009278792.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Aptenodytes 
forsteri]
Length=625

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  583  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  620



>ref|XP_005064618.1| PREDICTED: formin-binding protein 4, partial [Mesocricetus auratus]
Length=515

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  476  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  513



>ref|XP_005577974.1| PREDICTED: formin-binding protein 4 isoform X3 [Macaca fascicularis]
Length=921

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  879  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  916



>ref|XP_005870929.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Myotis 
brandtii]
Length=1012

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  970   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1007



>ref|XP_010811181.1| PREDICTED: formin-binding protein 4 isoform X2 [Bos taurus]
Length=1374

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1332  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1369



>gb|ELW48873.1| Formin-binding protein 4 [Tupaia chinensis]
Length=851

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  809  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  846



>ref|XP_011355314.1| PREDICTED: formin-binding protein 4 [Pteropus vampyrus]
Length=1018

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  976   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1013



>ref|XP_009184334.1| PREDICTED: formin-binding protein 4 [Papio anubis]
Length=922

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  880  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  917



>ref|XP_006865168.1| PREDICTED: formin-binding protein 4 [Chrysochloris asiatica]
Length=1008

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  966   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1003



>ref|XP_006908190.1| PREDICTED: formin-binding protein 4 [Pteropus alecto]
 gb|ELK16108.1| Formin-binding protein 4 [Pteropus alecto]
Length=1018

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  976   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1013



>gb|EHH56277.1| Formin-binding protein 30, partial [Macaca fascicularis]
Length=940

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  898  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  935



>ref|XP_007123822.1| PREDICTED: formin-binding protein 4 [Physeter catodon]
Length=1012

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  970   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1007



>ref|XP_007082258.1| PREDICTED: formin-binding protein 4 [Panthera tigris altaica]
Length=958

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  916  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  953



>gb|ELK23839.1| Formin-binding protein 4 [Myotis davidii]
Length=1028

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  986   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1023



>ref|XP_003781357.1| PREDICTED: formin-binding protein 4 [Otolemur garnettii]
Length=1029

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  987   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1024



>ref|XP_007497493.1| PREDICTED: formin-binding protein 4 isoform X2 [Monodelphis domestica]
Length=1050

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1008  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1045



>ref|XP_007455781.1| PREDICTED: formin-binding protein 4 [Lipotes vexillifer]
Length=1011

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  969   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1006



>ref|XP_007181320.1| PREDICTED: formin-binding protein 4 [Balaenoptera acutorostrata 
scammoni]
Length=1012

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  970   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1007



>ref|XP_010840760.1| PREDICTED: formin-binding protein 4 [Bison bison bison]
Length=958

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  916  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  953



>ref|XP_004458039.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Dasypus 
novemcinctus]
Length=1042

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1000  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1037



>ref|XP_005364254.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Microtus 
ochrogaster]
Length=1049

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1007  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1044



>ref|XP_004016511.1| PREDICTED: formin-binding protein 4 [Ovis aries]
Length=992

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  950  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  987



>emb|CAF98248.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=429

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            ++ IEEW+ QQI +G+A  NANF+ L  DWR+R+KRR+
Sbjct  391  KKSIEEWKHQQILTGKASKNANFEALPEDWRDRIKRRK  428



>ref|XP_009898310.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Picoides 
pubescens]
Length=762

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  720  QRRIEEWKQQQLISGMAERNANFEALPEDWRARLKRRK  757



>ref|XP_003773809.1| PREDICTED: formin-binding protein 4 [Sarcophilus harrisii]
Length=1036

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  994   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1031



>ref|XP_004657307.1| PREDICTED: formin-binding protein 4 [Jaculus jaculus]
Length=1052

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1010  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1047



>ref|XP_004264160.1| PREDICTED: formin-binding protein 4 [Orcinus orca]
Length=1012

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  970   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1007



>ref|XP_006748335.1| PREDICTED: formin-binding protein 4 isoform X2 [Leptonychotes 
weddellii]
Length=1019

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  977   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1014



>ref|XP_004399566.1| PREDICTED: formin-binding protein 4 [Odobenus rosmarus divergens]
Length=1019

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  977   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1014



>ref|XP_007497492.1| PREDICTED: formin-binding protein 4 isoform X1 [Monodelphis domestica]
Length=1053

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1011  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1048



>ref|XP_011285148.1| PREDICTED: formin-binding protein 4 isoform X2 [Felis catus]
Length=1020

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  978   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1015



>ref|XP_008917822.1| PREDICTED: formin-binding protein 4 [Manacus vitellinus]
Length=632

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            QR IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  590  QRRIEEWKQQQLMSGMAERNANFEALPEDWRARLKRRK  627



>ref|XP_002921697.2| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Ailuropoda 
melanoleuca]
Length=1017

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  975   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1012



>ref|XP_004682869.1| PREDICTED: formin-binding protein 4 [Condylura cristata]
Length=1026

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  984   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1021



>ref|XP_006772377.1| PREDICTED: formin-binding protein 4 [Myotis davidii]
Length=1055

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1013  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1050



>ref|XP_006212307.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Vicugna 
pacos]
Length=1016

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  974   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1011



>ref|XP_010335732.1| PREDICTED: formin-binding protein 4 [Saimiri boliviensis boliviensis]
Length=543

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  501  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  538



>ref|XP_006748334.1| PREDICTED: formin-binding protein 4 isoform X1 [Leptonychotes 
weddellii]
Length=1021

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  979   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1016



>ref|XP_009006355.1| PREDICTED: formin-binding protein 4 [Callithrix jacchus]
Length=1021

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  979   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1016



>dbj|BAB14348.1| unnamed protein product [Homo sapiens]
Length=560

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  518  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  555



>ref|XP_006092154.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Myotis 
lucifugus]
Length=1028

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  986   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1023



>ref|XP_005577973.1| PREDICTED: formin-binding protein 4 isoform X2 [Macaca fascicularis]
Length=1014

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  972   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1009



>ref|XP_008699305.1| PREDICTED: formin-binding protein 4 [Ursus maritimus]
Length=963

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  921  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  958



>ref|XP_004897606.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Heterocephalus 
glaber]
Length=978

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  936  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  973



>ref|XP_004763090.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Mustela 
putorius furo]
Length=1053

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1011  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1048



>ref|XP_005577972.1| PREDICTED: formin-binding protein 4 isoform X1 [Macaca fascicularis]
Length=1016

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  974   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1011



>ref|XP_004437020.1| PREDICTED: formin-binding protein 4 [Ceratotherium simum simum]
Length=1019

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  977   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1014



>gb|ELR46049.1| Formin-binding protein 4, partial [Bos mutus]
Length=1047

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1005  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1042



>ref|XP_008268954.1| PREDICTED: formin-binding protein 4 isoform X3 [Oryctolagus cuniculus]
Length=1049

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1007  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1044



>ref|XP_006190347.1| PREDICTED: formin-binding protein 4 [Camelus ferus]
Length=998

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  956  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  993



>ref|XP_010369442.1| PREDICTED: formin-binding protein 4 isoform X2 [Rhinopithecus 
roxellana]
Length=1016

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  974   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1011



>ref|XP_540739.3| PREDICTED: formin-binding protein 4 isoform X3 [Canis lupus familiaris]
Length=1021

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  979   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1016



>ref|XP_011474945.1| PREDICTED: formin-binding protein 4 [Oryzias latipes]
Length=763

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            ++ IEEW+ QQ+ +G+A  NANF+ L  DWRERVK+R+
Sbjct  722  KKSIEEWKHQQLLTGKASKNANFEALPEDWRERVKKRK  759



>ref|XP_007664750.1| PREDICTED: formin-binding protein 4 [Ornithorhynchus anatinus]
Length=926

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  884  QKRIEEWKQQQLVSGLAERNANFEALPEDWRARLKRRK  921



>ref|XP_007619634.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 isoform 
X2 [Cricetulus griseus]
Length=1002

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  960  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  997



>ref|XP_010821225.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 isoform 
X1 [Bos taurus]
Length=1015

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  973   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1010



>ref|XP_008109909.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Anolis 
carolinensis]
Length=991

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRRA  384
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+ 
Sbjct  949  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRKV  987



>ref|XP_010369441.1| PREDICTED: formin-binding protein 4 isoform X1 [Rhinopithecus 
roxellana]
Length=1018

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  976   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1013



>ref|XP_011285147.1| PREDICTED: formin-binding protein 4 isoform X1 [Felis catus]
Length=1022

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  980   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1017



>ref|XP_008536737.1| PREDICTED: formin-binding protein 4 [Equus przewalskii]
Length=972

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  930  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  967



>ref|XP_008145202.1| PREDICTED: formin-binding protein 4 [Eptesicus fuscus]
Length=1002

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  960  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  997



>ref|XP_009244653.1| PREDICTED: formin-binding protein 4 [Pongo abelii]
Length=1016

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  974   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1011



>ref|XP_005631279.1| PREDICTED: formin-binding protein 4 isoform X1 [Canis lupus familiaris]
Length=1023

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  981   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1018



>ref|XP_008268943.1| PREDICTED: formin-binding protein 4 isoform X1 [Oryctolagus cuniculus]
Length=1050

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1008  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1045



>ref|XP_007519094.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Erinaceus 
europaeus]
Length=1065

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1023  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1060



>emb|CAB70761.1| hypothetical protein [Homo sapiens]
Length=1013

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  971   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1008



>gb|AAH37404.1| Formin binding protein 4 [Homo sapiens]
 gb|EAW67885.1| formin binding protein 4, isoform CRA_b [Homo sapiens]
 gb|ACE86837.1| formin binding protein 4 protein [synthetic construct]
 gb|ACE87524.1| formin binding protein 4 protein [synthetic construct]
 gb|AIC59856.1| FNBP4, partial [synthetic construct]
Length=1015

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  973   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1010



>dbj|BAC98073.2| mKIAA1014 protein [Mus musculus]
Length=1052

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1010  QKRIEEWKQQQLVSGLAERNANFEALPEDWRARLKRRK  1047



>ref|XP_004051127.1| PREDICTED: formin-binding protein 4 [Gorilla gorilla gorilla]
Length=1012

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  970   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1007



>ref|XP_006057462.1| PREDICTED: formin-binding protein 4 isoform X2 [Bubalus bubalis]
Length=1019

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  977   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1014



>ref|XP_005631280.1| PREDICTED: formin-binding protein 4 isoform X2 [Canis lupus familiaris]
Length=997

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  955  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  992



>ref|XP_003465203.2| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 4 [Cavia 
porcellus]
Length=1014

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  972   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1009



>gb|EAW67887.1| formin binding protein 4, isoform CRA_d [Homo sapiens]
 gb|EAW67888.1| formin binding protein 4, isoform CRA_d [Homo sapiens]
 dbj|BAG09937.1| formin-binding protein 4 [synthetic construct]
Length=1017

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  975   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1012



>ref|XP_004387776.1| PREDICTED: formin-binding protein 4 [Trichechus manatus latirostris]
Length=1019

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  977   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1014



>ref|XP_010590359.1| PREDICTED: formin-binding protein 4 [Loxodonta africana]
Length=1021

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  979   QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1016



>sp|Q6ZQ03.2|FNBP4_MOUSE RecName: Full=Formin-binding protein 4; AltName: Full=Formin-binding 
protein 30 [Mus musculus]
 dbj|BAC39098.1| unnamed protein product [Mus musculus]
Length=1031

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  989   QKRIEEWKQQQLVSGLAERNANFEALPEDWRARLKRRK  1026



>ref|XP_009458647.1| PREDICTED: formin-binding protein 4 isoform X3 [Pan troglodytes]
Length=801

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500  QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
            Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  759  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  796



>dbj|BAA76858.2| KIAA1014 protein [Homo sapiens]
Length=1050

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1008  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1045



>ref|XP_008268948.1| PREDICTED: formin-binding protein 4 isoform X2 [Oryctolagus cuniculus]
Length=1051

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  500   QREIEEWRAQQIASGEAKDNANFQPLGGDWRERVKRRR  387
             Q+ IEEW+ QQ+ SG A+ NANF+ L  DWR R+KRR+
Sbjct  1009  QKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRK  1046



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500