BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034B16

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13288.1|  unnamed protein product                                250   1e-79   Coffea canephora [robusta coffee]
ref|XP_011086719.1|  PREDICTED: uncharacterized protein LOC105168359    249   6e-79   Sesamum indicum [beniseed]
ref|XP_010248828.1|  PREDICTED: uncharacterized protein LOC104591617    245   1e-77   Nelumbo nucifera [Indian lotus]
gb|EPS68757.1|  hypothetical protein M569_06012                         242   2e-76   Genlisea aurea
ref|XP_006341763.1|  PREDICTED: uncharacterized protein LOC102591507    242   2e-76   Solanum tuberosum [potatoes]
ref|XP_008444407.1|  PREDICTED: uncharacterized protein LOC103487745    242   2e-76   Cucumis melo [Oriental melon]
ref|XP_009606772.1|  PREDICTED: uncharacterized protein LOC104101068    241   4e-76   Nicotiana tomentosiformis
ref|XP_009780030.1|  PREDICTED: uncharacterized protein LOC104229142    241   5e-76   Nicotiana sylvestris
ref|XP_004239174.1|  PREDICTED: uncharacterized protein LOC101256588    239   1e-75   Solanum lycopersicum
ref|XP_004142952.1|  PREDICTED: uncharacterized protein LOC101203...    239   2e-75   Cucumis sativus [cucumbers]
ref|XP_004142951.1|  PREDICTED: uncharacterized protein LOC101203...    239   2e-75   Cucumis sativus [cucumbers]
ref|XP_006590262.1|  PREDICTED: uncharacterized protein LOC100306...    239   3e-75   Glycine max [soybeans]
ref|NP_001237795.1|  uncharacterized protein LOC100306628               239   3e-75   Glycine max [soybeans]
gb|KDP26738.1|  hypothetical protein JCGZ_17896                         238   3e-75   Jatropha curcas
ref|XP_006438141.1|  hypothetical protein CICLE_v10032669mg             238   5e-75   Citrus clementina [clementine]
ref|XP_006484021.1|  PREDICTED: uncharacterized protein LOC102611015    238   5e-75   Citrus sinensis [apfelsine]
ref|XP_006438139.1|  hypothetical protein CICLE_v10032669mg             238   6e-75   Citrus clementina [clementine]
gb|KDO82054.1|  hypothetical protein CISIN_1g027148mg                   238   6e-75   Citrus sinensis [apfelsine]
ref|XP_010655080.1|  PREDICTED: uncharacterized protein LOC100256...    238   8e-75   Vitis vinifera
ref|XP_002272215.2|  PREDICTED: uncharacterized protein LOC100256...    238   8e-75   Vitis vinifera
gb|KHN44402.1|  hypothetical protein glysoja_014443                     239   1e-74   Glycine soja [wild soybean]
gb|EYU25950.1|  hypothetical protein MIMGU_mgv1a012571mg                238   1e-74   Erythranthe guttata [common monkey flower]
gb|EYU25951.1|  hypothetical protein MIMGU_mgv1a012571mg                238   1e-74   Erythranthe guttata [common monkey flower]
ref|XP_007163718.1|  hypothetical protein PHAVU_001G258300g             236   3e-74   Phaseolus vulgaris [French bean]
ref|XP_008807203.1|  PREDICTED: uncharacterized protein LOC103719642    236   4e-74   Phoenix dactylifera
ref|XP_009403641.1|  PREDICTED: uncharacterized protein LOC103987153    236   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB78038.1|  hypothetical protein B456_012G174200                    236   6e-74   Gossypium raimondii
gb|KJB78040.1|  hypothetical protein B456_012G174200                    236   7e-74   Gossypium raimondii
ref|XP_002314565.1|  hypothetical protein POPTR_0010s06350g             235   1e-73   Populus trichocarpa [western balsam poplar]
gb|KHG12697.1|  Multidrug resistance pgp-1                              235   1e-73   Gossypium arboreum [tree cotton]
emb|CDY07411.1|  BnaA07g24900D                                          234   2e-73   Brassica napus [oilseed rape]
ref|XP_011042325.1|  PREDICTED: uncharacterized protein LOC105138036    234   2e-73   Populus euphratica
emb|CDY28870.1|  BnaC06g26580D                                          234   2e-73   Brassica napus [oilseed rape]
ref|XP_002515011.1|  oligopeptidase, putative                           234   2e-73   Ricinus communis
ref|XP_009105106.1|  PREDICTED: uncharacterized protein LOC103831017    234   3e-73   Brassica rapa
ref|XP_006852149.1|  hypothetical protein AMTR_s00049p00073250          235   3e-73   
ref|XP_010470685.1|  PREDICTED: uncharacterized protein LOC104750...    233   7e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010415348.1|  PREDICTED: uncharacterized protein LOC104701...    233   9e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010470686.1|  PREDICTED: uncharacterized protein LOC104750...    232   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010415350.1|  PREDICTED: uncharacterized protein LOC104701...    232   1e-72   Camelina sativa [gold-of-pleasure]
emb|CDX96071.1|  BnaA07g26600D                                          232   1e-72   
ref|XP_006302772.1|  hypothetical protein CARUB_v10020893mg             232   1e-72   Capsella rubella
ref|XP_009105311.1|  PREDICTED: uncharacterized protein LOC103831...    232   1e-72   
ref|XP_010511723.1|  PREDICTED: uncharacterized protein LOC104787...    232   2e-72   Camelina sativa [gold-of-pleasure]
ref|NP_564903.3|  uncharacterized protein                               232   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511722.1|  PREDICTED: uncharacterized protein LOC104787...    232   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009105310.1|  PREDICTED: uncharacterized protein LOC103831...    232   2e-72   Brassica rapa
ref|NP_850972.1|  uncharacterized protein                               232   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010025366.1|  PREDICTED: uncharacterized protein LOC104415723    232   2e-72   Eucalyptus grandis [rose gum]
ref|XP_010930033.1|  PREDICTED: uncharacterized protein LOC105051...    231   6e-72   Elaeis guineensis
ref|XP_007223900.1|  hypothetical protein PRUPE_ppa010899mg             229   2e-71   
ref|XP_010556180.1|  PREDICTED: uncharacterized protein LOC104825...    229   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_010556182.1|  PREDICTED: uncharacterized protein LOC104825...    229   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_010690008.1|  PREDICTED: uncharacterized protein LOC104903638    229   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011457438.1|  PREDICTED: uncharacterized protein LOC101291014    229   2e-71   Fragaria vesca subsp. vesca
ref|XP_008221980.1|  PREDICTED: uncharacterized protein LOC103321904    229   3e-71   Prunus mume [ume]
ref|XP_009359285.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    229   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_010930032.1|  PREDICTED: uncharacterized protein LOC105051...    228   1e-70   Elaeis guineensis
ref|XP_006391234.1|  hypothetical protein EUTSA_v10019020mg             228   1e-70   Eutrema salsugineum [saltwater cress]
ref|XP_004502335.1|  PREDICTED: uncharacterized protein LOC101493538    227   1e-70   Cicer arietinum [garbanzo]
ref|XP_007044959.1|  Uncharacterized protein TCM_010707                 227   3e-70   
ref|XP_008389783.1|  PREDICTED: uncharacterized protein LOC103452079    226   3e-70   
ref|NP_001185346.1|  uncharacterized protein                            225   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601843.1|  hypothetical protein MTR_3g086040                  224   1e-69   Medicago truncatula
ref|XP_006665147.1|  PREDICTED: uncharacterized protein LOC102722271    223   2e-69   
ref|XP_010100301.1|  hypothetical protein L484_027609                   221   2e-68   
ref|NP_001047344.1|  Os02g0600200                                       219   3e-67   
dbj|BAJ85479.1|  predicted protein                                      218   6e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY01837.1|  BnaC06g28770D                                          232   7e-67   
ref|XP_010235641.1|  PREDICTED: uncharacterized protein LOC104583...    218   9e-67   
gb|EEC73537.1|  hypothetical protein OsI_07935                          219   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_004952998.1|  PREDICTED: uncharacterized protein LOC101783...    217   5e-66   
ref|XP_004952999.1|  PREDICTED: uncharacterized protein LOC101783...    215   7e-66   Setaria italica
ref|NP_001141155.1|  uncharacterized protein LOC100273241               212   2e-64   Zea mays [maize]
emb|CBI27531.3|  unnamed protein product                                204   1e-62   Vitis vinifera
gb|EMT22924.1|  hypothetical protein F775_29812                         207   2e-62   
gb|AAG28905.1|AC008113_21  F12A21.16                                    218   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006648812.1|  PREDICTED: uncharacterized protein LOC102699572    188   6e-56   
ref|XP_010235643.1|  PREDICTED: uncharacterized protein LOC104583...    188   3e-55   
gb|KDO82053.1|  hypothetical protein CISIN_1g027148mg                   178   7e-52   Citrus sinensis [apfelsine]
gb|KDO82056.1|  hypothetical protein CISIN_1g027148mg                   174   1e-50   Citrus sinensis [apfelsine]
gb|ABK23133.1|  unknown                                                 175   2e-50   Picea sitchensis
gb|KEH35275.1|  plant/F12A21-30 protein, putative                       168   5e-48   Medicago truncatula
ref|XP_002887139.1|  F12A21.16                                          176   9e-47   
ref|XP_001765741.1|  predicted protein                                  161   3e-45   
gb|KDO82058.1|  hypothetical protein CISIN_1g027148mg                   131   1e-34   Citrus sinensis [apfelsine]
gb|EAY86575.1|  hypothetical protein OsI_07955                          138   2e-34   Oryza sativa Indica Group [Indian rice]
gb|AFW72182.1|  hypothetical protein ZEAMMB73_079373                    124   1e-31   
ref|XP_010930034.1|  PREDICTED: uncharacterized protein LOC105051...    122   2e-30   Elaeis guineensis
ref|XP_002983221.1|  hypothetical protein SELMODRAFT_422572             121   3e-30   
ref|XP_002961342.1|  hypothetical protein SELMODRAFT_403146             119   1e-29   
gb|KHN24102.1|  Small heat shock protein, chloroplastic               99.8    3e-21   Glycine soja [wild soybean]
gb|AFB34514.1|  hypothetical protein CL4511Contig1_02                 86.7    4e-18   Pinus mugo [mountain pine]
ref|XP_005648734.1|  hypothetical protein COCSUDRAFT_53257            89.4    4e-18   Coccomyxa subellipsoidea C-169
gb|AEW09177.1|  hypothetical protein CL4511Contig1_02                 86.3    5e-18   Pinus radiata
gb|AFB34513.1|  hypothetical protein CL4511Contig1_02                 84.7    2e-17   Larix decidua
ref|XP_001415572.1|  predicted protein                                84.3    1e-16   Ostreococcus lucimarinus CCE9901
ref|XP_011397511.1|  Uncharacterized protein YhiN                     87.4    2e-16   Auxenochlorella protothecoides
ref|XP_003074445.1|  Metalloendopeptidase family-saccharolysin & ...  81.3    3e-15   Ostreococcus tauri
ref|XP_005852074.1|  hypothetical protein CHLNCDRAFT_133084           77.4    7e-14   Chlorella variabilis
ref|XP_002507497.1|  hypothetical protein MICPUN_113391               71.6    7e-12   Micromonas commoda
ref|XP_003056036.1|  hypothetical protein MICPUCDRAFT_70697           70.5    2e-11   Micromonas pusilla CCMP1545
ref|XP_001695603.1|  hypothetical protein CHLREDRAFT_205992           68.9    6e-11   Chlamydomonas reinhardtii
ref|XP_002184929.1|  predicted protein                                58.9    2e-07   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007509245.1|  predicted protein                                58.2    2e-07   Bathycoccus prasinos
ref|XP_005534863.1|  hypothetical protein CYME_CMJ126C                58.2    5e-07   Cyanidioschyzon merolae strain 10D
gb|KIZ07565.1|  hypothetical protein MNEG_0380                        53.9    6e-06   Monoraphidium neglectum
gb|ADU15868.1|  CLCuV responsive protein                              49.7    7e-05   Gossypium hirsutum [American cotton]
ref|XP_002953545.1|  hypothetical protein VOLCADRAFT_121174           52.4    7e-05   Volvox carteri f. nagariensis
ref|XP_005718910.1|  unnamed protein product                          50.4    3e-04   Chondrus crispus [carageen]



>emb|CDP13288.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYP+N+VTGGTTAKIMVAAKDNFLGKYIYKDTL RNLA
Sbjct  72   PKIEDDGNPRFVIFIRMANVYLWYPINLVTGGTTAKIMVAAKDNFLGKYIYKDTLDRNLA  131

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK+A KQ RVLR+ST+FRYGYKLVENNNLR ALS+ ++IELPRQEELKTV
Sbjct  132  AVIYRDEKEIQKMAMKQHRVLRSSTEFRYGYKLVENNNLRAALSSNDVIELPRQEELKTV  191

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  192  LDKVKDFFGDAKESFG  207



>ref|XP_011086719.1| PREDICTED: uncharacterized protein LOC105168359 [Sesamum indicum]
Length=243

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PKLEDDGNPKFVIFIR+A+V LWYPLNIVTGGTTAKIMV+AKDNFLGKYIYKDTLARNLA
Sbjct  76   PKLEDDGNPKFVIFIRVANVYLWYPLNIVTGGTTAKIMVSAKDNFLGKYIYKDTLARNLA  135

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK+A KQFRVLR++TDFRYGYKLVENNNLR AL+  ++IELP Q+ELKTV
Sbjct  136  AVIYRDEKEIQKMAMKQFRVLRSATDFRYGYKLVENNNLRAALAANDVIELPTQDELKTV  195

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  196  LDKVKDFFGDAKESFG  211



>ref|XP_010248828.1| PREDICTED: uncharacterized protein LOC104591617 [Nelumbo nucifera]
Length=223

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDT+ARNLA
Sbjct  66   PKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTIARNLA  125

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A +Q+RVLR++TDFRYGYKLVEN+N+R A+STT++IELPR+EELKTV
Sbjct  126  AVIYRDEKEIQKTAFRQYRVLRSTTDFRYGYKLVENSNVRAAISTTDVIELPRKEELKTV  185

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  186  LDKVKDFFGDAKESFG  201



>gb|EPS68757.1| hypothetical protein M569_06012, partial [Genlisea aurea]
Length=223

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PKLEDDGNPKFVIFIRMA+V LWYPLNIV GGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  72   PKLEDDGNPKFVIFIRMANVYLWYPLNIVNGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  131

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE++K+A KQFRVLR++TDFRYGYK+VENNNLR AL+  ++IELP Q+ELKTV
Sbjct  132  AVIYKDEKEIRKMAVKQFRVLRSATDFRYGYKIVENNNLRAALAANDVIELPTQDELKTV  191

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG AKESFG
Sbjct  192  FDKVKDFFGDAKESFG  207



>ref|XP_006341763.1| PREDICTED: uncharacterized protein LOC102591507 [Solanum tuberosum]
Length=230

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY DEKE+QKLA KQ RVL+++T+FRYGYKLVENNNLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYNDEKEIQKLAMKQHRVLKSATEFRYGYKLVENNNLRAALSTSDVIELPTPDKLKTV  188

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  189  VDKVKDFFGDAKESFG  204



>ref|XP_008444407.1| PREDICTED: uncharacterized protein LOC103487745 [Cucumis melo]
Length=231

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+ALSTT++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSALSTTDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  191  LDKVKDFFGDAKESFG  206



>ref|XP_009606772.1| PREDICTED: uncharacterized protein LOC104101068 [Nicotiana tomentosiformis]
Length=231

 Score =   241 bits (615),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIF+RMA+V LWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  75   PKIEDDGNPKFVIFVRMANVYLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  134

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY DEK +QKLA KQ RVL+++T+FRYGYKLVENNNLR ALSTT++IELP  ++LKTV
Sbjct  135  AVIYNDEKNIQKLAMKQHRVLKSATEFRYGYKLVENNNLRAALSTTDVIELPTPDQLKTV  194

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  195  VDKVKDFFGDAKESFG  210



>ref|XP_009780030.1| PREDICTED: uncharacterized protein LOC104229142 [Nicotiana sylvestris]
Length=228

 Score =   241 bits (614),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIF+RMA+V LWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  72   PKIEDDGNPKFVIFVRMANVYLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  131

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY DEK +QKLA KQ RVL+++T+FRYGYKLVENNNLR ALSTT++IELP  ++LKTV
Sbjct  132  AVIYNDEKNIQKLAMKQHRVLKSATEFRYGYKLVENNNLRAALSTTDVIELPTPDQLKTV  191

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  192  VDKVKDFFGDAKESFG  207



>ref|XP_004239174.1| PREDICTED: uncharacterized protein LOC101256588 [Solanum lycopersicum]
Length=226

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPLNI+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPKFVIFIRMANVYLWYPLNIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY DEKE++KLA KQ RVL+++T+FRYGYKLVENNNLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYNDEKEIKKLAMKQHRVLKSATEFRYGYKLVENNNLRAALSTSDVIELPTPDKLKTV  188

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  189  VDKVKDFFGDAKESFG  204



>ref|XP_004142952.1| PREDICTED: uncharacterized protein LOC101203734 isoform 2 [Cucumis 
sativus]
 ref|XP_004159564.1| PREDICTED: uncharacterized protein LOC101226204 isoform 2 [Cucumis 
sativus]
Length=228

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKDNF+GKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKDNFVGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+ALSTT++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSALSTTDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AK+SFG
Sbjct  191  LDKVKDFFGDAKDSFG  206



>ref|XP_004142951.1| PREDICTED: uncharacterized protein LOC101203734 isoform 1 [Cucumis 
sativus]
 ref|XP_004159563.1| PREDICTED: uncharacterized protein LOC101226204 isoform 1 [Cucumis 
sativus]
 gb|KGN62348.1| hypothetical protein Csa_2G350310 [Cucumis sativus]
Length=231

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKDNF+GKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKDNFVGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+ALSTT++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSALSTTDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AK+SFG
Sbjct  191  LDKVKDFFGDAKDSFG  206



>ref|XP_006590262.1| PREDICTED: uncharacterized protein LOC100306628 isoform X1 [Glycine 
max]
Length=236

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGKYIYKDTL RNLA
Sbjct  79   PKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKYIYKDTLDRNLA  138

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+R ALSTT++IELP Q++LKTV
Sbjct  139  AVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENGNIRAALSTTDVIELPTQDKLKTV  198

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  199  LDKVKDFFGDAKESFG  214



>ref|NP_001237795.1| uncharacterized protein LOC100306628 [Glycine max]
 gb|ACU14904.1| unknown [Glycine max]
Length=239

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGKYIYKDTL RNLA
Sbjct  79   PKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKYIYKDTLDRNLA  138

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+R ALSTT++IELP Q++LKTV
Sbjct  139  AVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENGNIRAALSTTDVIELPTQDKLKTV  198

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  199  LDKVKDFFGDAKESFG  214



>gb|KDP26738.1| hypothetical protein JCGZ_17896 [Jatropha curcas]
Length=226

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKI VAAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKITVAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR++T+FRYGYKLVEN N+R ALST+++IELP +++LKTV
Sbjct  131  AVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKLVENGNMRAALSTSDVIELPTEDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFGGAKESFG
Sbjct  191  FDKVKDFFGGAKESFG  206



>ref|XP_006438141.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51381.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
Length=227

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVIELPTPDKLKTV  188

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  189  LDKVKDFFGDAKESFG  204



>ref|XP_006484021.1| PREDICTED: uncharacterized protein LOC102611015 [Citrus sinensis]
 gb|KDO82052.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=227

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVIELPTPDKLKTV  188

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  189  LDKVKDFFGDAKESFG  204



>ref|XP_006438139.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 ref|XP_006438140.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51379.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51380.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
Length=226

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVIELPTPDKLKTV  188

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  189  LDKVKDFFGDAKESFG  204



>gb|KDO82054.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
 gb|KDO82055.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=226

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVIELPTPDKLKTV  188

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  189  LDKVKDFFGDAKESFG  204



>ref|XP_010655080.1| PREDICTED: uncharacterized protein LOC100256260 isoform X2 [Vitis 
vinifera]
Length=226

 Score =   238 bits (606),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIY+DT+ARNLA
Sbjct  70   PKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYRDTIARNLA  129

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE+QK A +Q+RVLR++ +FRYGYKLVENNN+R+ALSTT++IELP Q ELKTV
Sbjct  130  AVIYKDEKEIQKTAFRQYRVLRSAKEFRYGYKLVENNNVRSALSTTDVIELPTQGELKTV  189

Query  315  LDKVKDFFGGAKESFG  268
            LDKV+DFFG AKESFG
Sbjct  190  LDKVRDFFGDAKESFG  205



>ref|XP_002272215.2| PREDICTED: uncharacterized protein LOC100256260 isoform X1 [Vitis 
vinifera]
Length=229

 Score =   238 bits (606),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIY+DT+ARNLA
Sbjct  70   PKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYRDTIARNLA  129

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE+QK A +Q+RVLR++ +FRYGYKLVENNN+R+ALSTT++IELP Q ELKTV
Sbjct  130  AVIYKDEKEIQKTAFRQYRVLRSAKEFRYGYKLVENNNVRSALSTTDVIELPTQGELKTV  189

Query  315  LDKVKDFFGGAKESFG  268
            LDKV+DFFG AKESFG
Sbjct  190  LDKVRDFFGDAKESFG  205



>gb|KHN44402.1| hypothetical protein glysoja_014443 [Glycine soja]
Length=279

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGKYIYKDTL RNLA
Sbjct  77   PKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKYIYKDTLDRNLA  136

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+R ALSTT++IELP Q++LKTV
Sbjct  137  AVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENGNIRAALSTTDVIELPTQDKLKTV  196

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  197  LDKVKDFFGDAKESFG  212



>gb|EYU25950.1| hypothetical protein MIMGU_mgv1a012571mg [Erythranthe guttata]
Length=246

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PKL+DDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  83   PKLDDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  142

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            +VIYRDEKE+QK+A K FRVLR++T+FRYGYK+VENNN+R AL+  ++IELP Q++LKTV
Sbjct  143  SVIYRDEKEIQKMAVKTFRVLRSATEFRYGYKIVENNNVRAALAANDVIELPTQDKLKTV  202

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  203  VDKVKDFFGDAKESFG  218



>gb|EYU25951.1| hypothetical protein MIMGU_mgv1a012571mg [Erythranthe guttata]
Length=243

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PKL+DDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  83   PKLDDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  142

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            +VIYRDEKE+QK+A K FRVLR++T+FRYGYK+VENNN+R AL+  ++IELP Q++LKTV
Sbjct  143  SVIYRDEKEIQKMAVKTFRVLRSATEFRYGYKIVENNNVRAALAANDVIELPTQDKLKTV  202

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  203  VDKVKDFFGDAKESFG  218



>ref|XP_007163718.1| hypothetical protein PHAVU_001G258300g [Phaseolus vulgaris]
 gb|ESW35712.1| hypothetical protein PHAVU_001G258300g [Phaseolus vulgaris]
Length=234

 Score =   236 bits (603),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGKYIYKDTL RNLA
Sbjct  74   PKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKYIYKDTLDRNLA  133

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  134  AVIYKDEKEVQKSAFKQYRVLRTATDFRYGYKLVENTNIRAALSTSDVIELPTQDKLKTV  193

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  194  LDKVKDFFGDAKESFG  209



>ref|XP_008807203.1| PREDICTED: uncharacterized protein LOC103719642 [Phoenix dactylifera]
Length=235

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 127/140 (91%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR  +V LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDT+ARNLA
Sbjct  75   PKIEDDGNPRFVIFIRTTNVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTIARNLA  134

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR++T FRYGYKLVENNNLR ALST ++IELP QEELKTV
Sbjct  135  AVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLVENNNLRAALSTNDVIELPTQEELKTV  194

Query  315  LDKVKDFFG----GAKESFG  268
            LDKVKDFFG    GAKESFG
Sbjct  195  LDKVKDFFGDAASGAKESFG  214



>ref|XP_009403641.1| PREDICTED: uncharacterized protein LOC103987153 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 128/140 (91%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FV+FIR ++V LWYPL+I++GGTTAKIMVAAKDNFLGKYIYKDT+ARN+A
Sbjct  74   PKIEDDGNPRFVVFIRTSNVYLWYPLSIISGGTTAKIMVAAKDNFLGKYIYKDTIARNIA  133

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR++T FRYGYKLVENNNLR A+ST+N+IELP QEELKTV
Sbjct  134  AVIYRDEKEIQKTAVKQYRVLRSATSFRYGYKLVENNNLRAAISTSNVIELPTQEELKTV  193

Query  315  LDKVKDFFGG----AKESFG  268
            LDKVKDFFG     AKESFG
Sbjct  194  LDKVKDFFGNATSDAKESFG  213



>gb|KJB78038.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
 gb|KJB78039.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
Length=237

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDT+ARNLAA
Sbjct  83   KIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTIARNLAA  142

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N+++ALST ++IELP Q++LKTV+
Sbjct  143  VIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNVKSALSTNDVIELPTQDQLKTVV  202

Query  312  DKVKDFFGGAKESFG  268
            DKVKDFFG AKESFG
Sbjct  203  DKVKDFFGDAKESFG  217



>gb|KJB78040.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
 gb|KJB78041.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
Length=241

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDT+ARNLAA
Sbjct  83   KIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTIARNLAA  142

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N+++ALST ++IELP Q++LKTV+
Sbjct  143  VIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNVKSALSTNDVIELPTQDQLKTVV  202

Query  312  DKVKDFFGGAKESFG  268
            DKVKDFFG AKESFG
Sbjct  203  DKVKDFFGDAKESFG  217



>ref|XP_002314565.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 ref|XP_006378275.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 gb|ABK95743.1| unknown [Populus trichocarpa]
 gb|EEF00736.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 gb|ERP56072.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
Length=237

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKF+IFIR+A+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  80   PKIEDDGNPKFLIFIRVANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  139

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE+QK A KQ RVLR++T+FRYGYKLVEN NLR ALS T++IELP Q++LKTV
Sbjct  140  AVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNLRAALSITDVIELPTQDKLKTV  199

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  200  LDKVKDFFGDAKESFG  215



>gb|KHG12697.1| Multidrug resistance pgp-1 [Gossypium arboreum]
Length=237

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDT+ARNLAA
Sbjct  83   KIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTIARNLAA  142

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N++ ALST ++IELP Q++LKTV+
Sbjct  143  VIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNVKAALSTNDVIELPTQDQLKTVV  202

Query  312  DKVKDFFGGAKESFG  268
            DKVKDFFG AKESFG
Sbjct  203  DKVKDFFGDAKESFG  217



>emb|CDY07411.1| BnaA07g24900D [Brassica napus]
Length=227

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  71   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  191  LDKVKDFFGDAKESFG  206



>ref|XP_011042325.1| PREDICTED: uncharacterized protein LOC105138036 [Populus euphratica]
Length=237

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKF+IFIR A+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  80   PKIEDDGNPKFLIFIRAANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  139

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE+QK A KQ RVLR++T+FRYGYKLVEN NLR ALS T++IELP Q++LKTV
Sbjct  140  AVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNLRAALSITDVIELPTQDKLKTV  199

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  200  LDKVKDFFGDAKESFG  215



>emb|CDY28870.1| BnaC06g26580D [Brassica napus]
Length=227

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  71   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  191  LDKVKDFFGDAKESFG  206



>ref|XP_002515011.1| oligopeptidase, putative [Ricinus communis]
 gb|EEF47565.1| oligopeptidase, putative [Ricinus communis]
Length=233

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKIMVAAKDNFLGKYIYK+TL RNLA
Sbjct  74   PKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKIMVAAKDNFLGKYIYKNTLDRNLA  133

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQFRVLR++T+FRYGYKLVEN N+R ALSTT++IELP  ++LKTV
Sbjct  134  AVIYRDEKEIQKTAFKQFRVLRSATEFRYGYKLVENGNVRAALSTTDVIELPTPDQLKTV  193

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  194  VDKVKDFFGDAKESFG  209



>ref|XP_009105106.1| PREDICTED: uncharacterized protein LOC103831017 [Brassica rapa]
Length=249

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  93   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  152

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  153  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  212

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  213  LDKVKDFFGDAKESFG  228



>ref|XP_006852149.1| hypothetical protein AMTR_s00049p00073250 [Amborella trichopoda]
 gb|ERN13616.1| hypothetical protein AMTR_s00049p00073250 [Amborella trichopoda]
Length=265

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PKLEDDGNPKFVIFIR A V LWYPL++VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  81   PKLEDDGNPKFVIFIRTAKVYLWYPLSVVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  140

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A K++RVLR++++FRYGYKLVEN NLR AL+T+++IELP QEELKTV
Sbjct  141  AVIYRDEKEVQKTAFKRYRVLRSASEFRYGYKLVENGNLRAALATSDVIELPTQEELKTV  200

Query  315  LDKVKDFFG----GAKESFG  268
            LDKVKD+FG    GAKESFG
Sbjct  201  LDKVKDYFGNATSGAKESFG  220



>ref|XP_010470685.1| PREDICTED: uncharacterized protein LOC104750573 isoform X1 [Camelina 
sativa]
Length=231

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGNAKESFG  208



>ref|XP_010415348.1| PREDICTED: uncharacterized protein LOC104701376 isoform X1 [Camelina 
sativa]
Length=231

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>ref|XP_010470686.1| PREDICTED: uncharacterized protein LOC104750573 isoform X2 [Camelina 
sativa]
Length=230

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGNAKESFG  208



>ref|XP_010415350.1| PREDICTED: uncharacterized protein LOC104701376 isoform X2 [Camelina 
sativa]
Length=230

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>emb|CDX96071.1| BnaA07g26600D [Brassica napus]
Length=228

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  71   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG AKESFG
Sbjct  191  FDKVKDFFGDAKESFG  206



>ref|XP_006302772.1| hypothetical protein CARUB_v10020893mg [Capsella rubella]
 gb|EOA35670.1| hypothetical protein CARUB_v10020893mg [Capsella rubella]
Length=231

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>ref|XP_009105311.1| PREDICTED: uncharacterized protein LOC103831192 isoform X2 [Brassica 
rapa]
Length=228

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  71   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG AKESFG
Sbjct  191  FDKVKDFFGDAKESFG  206



>ref|XP_010511723.1| PREDICTED: uncharacterized protein LOC104787786 isoform X2 [Camelina 
sativa]
Length=230

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>ref|NP_564903.3| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8LDL0.1|HHL1_ARATH RecName: Full=Protein HHL1, chloroplastic; AltName: Full=Hypersensitive 
to high light 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM63154.1| unknown [Arabidopsis thaliana]
 dbj|BAH19661.1| AT1G67700 [Arabidopsis thaliana]
 gb|AEE34684.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=231

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>ref|XP_010511722.1| PREDICTED: uncharacterized protein LOC104787786 isoform X1 [Camelina 
sativa]
Length=231

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>ref|XP_009105310.1| PREDICTED: uncharacterized protein LOC103831192 isoform X1 [Brassica 
rapa]
Length=231

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  71   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  131  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG AKESFG
Sbjct  191  FDKVKDFFGDAKESFG  206



>ref|NP_850972.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK91348.1| At1g67700/F12A21_30 [Arabidopsis thaliana]
 gb|AAM51570.1| At1g67700/F12A21_30 [Arabidopsis thaliana]
 gb|AEE34683.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=230

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  192

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  193  FDKVKDYFGDAKESFG  208



>ref|XP_010025366.1| PREDICTED: uncharacterized protein LOC104415723 [Eucalyptus grandis]
 gb|KCW62010.1| hypothetical protein EUGRSUZ_H04690 [Eucalyptus grandis]
Length=240

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA
Sbjct  79   KIEDDGNPRFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  138

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQ RVLR +T+FRYGYK+VEN N+R ALSTT++IELP Q++LKTV 
Sbjct  139  VIYRDEKEIQKTALKQHRVLRTATEFRYGYKIVENGNVRAALSTTDVIELPTQDQLKTVF  198

Query  312  DKVKDFFGGAKESFG  268
            DKVKD FG AKESFG
Sbjct  199  DKVKDLFGDAKESFG  213



>ref|XP_010930033.1| PREDICTED: uncharacterized protein LOC105051352 isoform X2 [Elaeis 
guineensis]
Length=235

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIR   V LWYPL++VTGGTTAKIMVAAKDNFLGKYIYKDT+ARNLAA
Sbjct  76   KIEDDGNPRFVIFIRTTKVYLWYPLSVVTGGTTAKIMVAAKDNFLGKYIYKDTIARNLAA  135

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A+ST ++IELP QEELKTVL
Sbjct  136  VIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAAISTNDVIELPTQEELKTVL  195

Query  312  DKVKDFF----GGAKESFG  268
            DKVKDF     GGAKESFG
Sbjct  196  DKVKDFVGNAAGGAKESFG  214



>ref|XP_007223900.1| hypothetical protein PRUPE_ppa010899mg [Prunus persica]
 gb|EMJ25099.1| hypothetical protein PRUPE_ppa010899mg [Prunus persica]
Length=231

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  669  LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  490
            +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV
Sbjct  76   IEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  135

Query  489  IYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLD  310
            IYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R ALST+++IELP +++LKT  D
Sbjct  136  IYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRAALSTSDVIELPTKDKLKTTFD  195

Query  309  KVKDFFGGAKESFG  268
            KVKDFFG AKESFG
Sbjct  196  KVKDFFGDAKESFG  209



>ref|XP_010556180.1| PREDICTED: uncharacterized protein LOC104825532 isoform X1 [Tarenaya 
hassleriana]
Length=234

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDN LGKYIYKDT+ARNLAA
Sbjct  77   KIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNLLGKYIYKDTIARNLAA  136

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIY+DEKE+QK A KQFRVLR +T+FRYGYKLVEN N+R AL+TT++IELP Q++LKTV+
Sbjct  137  VIYKDEKEIQKTAFKQFRVLRNATEFRYGYKLVENGNVRAALTTTDVIELPTQDKLKTVV  196

Query  312  DKVKDFFGGAKESFG  268
            DKVKDFFG AKESFG
Sbjct  197  DKVKDFFGDAKESFG  211



>ref|XP_010556182.1| PREDICTED: uncharacterized protein LOC104825532 isoform X2 [Tarenaya 
hassleriana]
Length=233

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDN LGKYIYKDT+ARNLAA
Sbjct  77   KIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNLLGKYIYKDTIARNLAA  136

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIY+DEKE+QK A KQFRVLR +T+FRYGYKLVEN N+R AL+TT++IELP Q++LKTV+
Sbjct  137  VIYKDEKEIQKTAFKQFRVLRNATEFRYGYKLVENGNVRAALTTTDVIELPTQDKLKTVV  196

Query  312  DKVKDFFGGAKESFG  268
            DKVKDFFG AKESFG
Sbjct  197  DKVKDFFGDAKESFG  211



>ref|XP_010690008.1| PREDICTED: uncharacterized protein LOC104903638 [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPLN+VTGGTTAKIMVAAKDN LGKYIYKDT+ARNLA
Sbjct  74   PKIEDDGNPRFVIFIRMANVYLWYPLNLVTGGTTAKIMVAAKDNILGKYIYKDTIARNLA  133

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AV+Y+DEK L K+A+KQFR LR +TDFRYGYKLVEN ++RTAL+  ++IELP Q++LKTV
Sbjct  134  AVVYQDEKGLIKIAQKQFRTLRTATDFRYGYKLVENADVRTALTPKDVIELPTQDQLKTV  193

Query  315  LDKVKDFFGGAKESFG  268
            +DKVKDFFG AKESFG
Sbjct  194  VDKVKDFFGDAKESFG  209



>ref|XP_011457438.1| PREDICTED: uncharacterized protein LOC101291014 [Fragaria vesca 
subsp. vesca]
Length=230

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FV+FIRMA+V LWYPL++++GGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  72   PKIEDDGNPRFVVFIRMANVYLWYPLSVISGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  131

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ+RVLR++T+FRYGYK+VEN N+R AL+T+++IELP  ++L+T 
Sbjct  132  AVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKIVENGNMRAALATSDVIELPTPDQLRTT  191

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG AKESFG
Sbjct  192  FDKVKDFFGDAKESFG  207



>ref|XP_008221980.1| PREDICTED: uncharacterized protein LOC103321904 [Prunus mume]
Length=235

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  669  LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  490
            +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV
Sbjct  77   IEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  136

Query  489  IYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLD  310
            IYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R ALST+++IELP +++LKT  D
Sbjct  137  IYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRAALSTSDVIELPTKDKLKTTFD  196

Query  309  KVKDFFGGAKESFG  268
            KVKDFFG AKESFG
Sbjct  197  KVKDFFGDAKESFG  210



>ref|XP_009359285.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103949875 
[Pyrus x bretschneideri]
Length=236

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  669  LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  490
            +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIM+AAKDNFLGKYIYKDTLARNLAAV
Sbjct  78   IEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMIAAKDNFLGKYIYKDTLARNLAAV  137

Query  489  IYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLD  310
            IYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R ALST+++IELP +++LKT  D
Sbjct  138  IYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRAALSTSDVIELPTKDKLKTTFD  197

Query  309  KVKDFFGGAKESFG  268
            KVKDFFG AKESFG
Sbjct  198  KVKDFFGDAKESFG  211



>ref|XP_010930032.1| PREDICTED: uncharacterized protein LOC105051352 isoform X1 [Elaeis 
guineensis]
Length=237

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 6/141 (4%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVD--LWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNL  499
            K+EDDGNP+FVIFIR   V   LWYPL++VTGGTTAKIMVAAKDNFLGKYIYKDT+ARNL
Sbjct  76   KIEDDGNPRFVIFIRTTKVSVYLWYPLSVVTGGTTAKIMVAAKDNFLGKYIYKDTIARNL  135

Query  498  AAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKT  319
            AAVIYRDEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A+ST ++IELP QEELKT
Sbjct  136  AAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAAISTNDVIELPTQEELKT  195

Query  318  VLDKVKDFF----GGAKESFG  268
            VLDKVKDF     GGAKESFG
Sbjct  196  VLDKVKDFVGNAAGGAKESFG  216



>ref|XP_006391234.1| hypothetical protein EUTSA_v10019020mg [Eutrema salsugineum]
 gb|ESQ28520.1| hypothetical protein EUTSA_v10019020mg [Eutrema salsugineum]
Length=259

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  99   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  158

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DEKE+QK A KQ RVLR + +FRYGYKLVEN N+R ALST+++IELP  ++LKTV
Sbjct  159  AVIYKDEKEIQKTAIKQHRVLRTAKEFRYGYKLVENGNMRAALSTSDVIELPTPDQLKTV  218

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  219  LDKVKDFFGDAKESFG  234



>ref|XP_004502335.1| PREDICTED: uncharacterized protein LOC101493538 [Cicer arietinum]
Length=232

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 1/136 (1%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGKYIYKDTL RNLAA
Sbjct  75   KIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKYIYKDTLDRNLAA  134

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN-NNLRTALSTTNIIELPRQEELKTV  316
            VIY+DEKE+QK A KQ R LR++T+FRYGYKLVEN NN+R ALSTT++IELP  ++LKTV
Sbjct  135  VIYKDEKEIQKSAFKQHRTLRSATEFRYGYKLVENYNNVRAALSTTDVIELPTPDKLKTV  194

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  195  LDKVKDFFGDAKESFG  210



>ref|XP_007044959.1| Uncharacterized protein TCM_010707 [Theobroma cacao]
 gb|EOY00791.1| Uncharacterized protein TCM_010707 [Theobroma cacao]
Length=258

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 128/153 (84%), Gaps = 18/153 (12%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA V+LWYPL+++TGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA
Sbjct  81   KIEDDGNPRFVIFIRMAGVNLWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  140

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV------------------ENNNLRTAL  367
            VIYRDEKE+QK A KQFRVL+++TDFRYGYKLV                  EN N+R+AL
Sbjct  141  VIYRDEKEIQKTAFKQFRVLQSATDFRYGYKLVMMEKFANSFSEFCVLNIQENGNVRSAL  200

Query  366  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  268
            ST ++IELP Q++LKTVLDKVKDFFG AK+SFG
Sbjct  201  STNDVIELPTQDQLKTVLDKVKDFFGDAKDSFG  233



>ref|XP_008389783.1| PREDICTED: uncharacterized protein LOC103452079 [Malus domestica]
Length=236

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FV+FIRMA+V LWYPL++++GGTTAKIM+AAKDNFLGKYIYKDTLARNLAA
Sbjct  77   KIEDDGNPRFVVFIRMANVYLWYPLSVISGGTTAKIMIAAKDNFLGKYIYKDTLARNLAA  136

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R ALST+++IELP +++LKT  
Sbjct  137  VIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRAALSTSDVIELPTKDKLKTTF  196

Query  312  DKVKDFFGGAKESFG  268
            DKVKDF   AKESFG
Sbjct  197  DKVKDFXXDAKESFG  211



>ref|NP_001185346.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34685.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=229

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  73   PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  132

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKL EN N+R ALST+++IELP Q++LKTV
Sbjct  133  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKL-ENGNMRAALSTSDVIELPTQDQLKTV  191

Query  315  LDKVKDFFGGAKESFG  268
             DKVKD+FG AKESFG
Sbjct  192  FDKVKDYFGDAKESFG  207



>ref|XP_003601843.1| hypothetical protein MTR_3g086040 [Medicago truncatula]
 gb|AES72094.1| plant/F12A21-30 protein, putative [Medicago truncatula]
 gb|AFK48802.1| unknown [Medicago truncatula]
Length=227

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFV+FIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGK+IYKDTL RNLA
Sbjct  71   PKIEDDGNPKFVVFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKFIYKDTLDRNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVL+++T+FRYGYKLVEN N++ ALST+++I+LP  ++LKTV
Sbjct  131  AVIYRDEKEIQKSAFKQHRVLKSATEFRYGYKLVENGNVKAALSTSDVIQLPTPDKLKTV  190

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG  KESFG
Sbjct  191  ADKVKDFFGDVKESFG  206



>ref|XP_006665147.1| PREDICTED: uncharacterized protein LOC102722271, partial [Oryza 
brachyantha]
Length=194

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLN+VTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  9    PKIEDDGNPRFVIFIRTANVYFWYPLNVVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  68

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DE E+   AK+Q+RVL+   +FRYGYK+VEN NLR+AL+T+N+IELP++EELKTV
Sbjct  69   AVIYKDEDEIIDTAKEQYRVLKTENEFRYGYKVVENANLRSALTTSNVIELPKKEELKTV  128

Query  315  LDKVKDFFG----GAKESFG  268
            +DKVKDFFG    GAKESFG
Sbjct  129  VDKVKDFFGDVTSGAKESFG  148



>ref|XP_010100301.1| hypothetical protein L484_027609 [Morus notabilis]
 gb|EXB82435.1| hypothetical protein L484_027609 [Morus notabilis]
Length=227

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIRMA+V  WYPL+I+TGGTTAKIM+AAKDNFLGKYIYKDTL +NLAA
Sbjct  75   KIEDDGNPRFVIFIRMANVGFWYPLSIITGGTTAKIMLAAKDNFLGKYIYKDTLDKNLAA  134

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
            VIYRDEKE+QK A KQF++LR +T+FRYGYK+VEN NL+ A++T +++ELP Q++L+TVL
Sbjct  135  VIYRDEKEIQKSAFKQFKILRNATEFRYGYKIVENGNLKAAVATNDVVELPTQDKLRTVL  194

Query  312  DKVKDFFGGAKESFG  268
            DKVKDFFG AK+SFG
Sbjct  195  DKVKDFFGDAKDSFG  209



>ref|NP_001047344.1| Os02g0600200 [Oryza sativa Japonica Group]
 dbj|BAD22147.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09258.1| Os02g0600200 [Oryza sativa Japonica Group]
 dbj|BAG90207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=266

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  82   PKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  141

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DE ++   AK+Q+RVL+   +FRYGYK+VEN NLR+AL+T+N+IELP++EELKTV
Sbjct  142  AVIYKDEDDIIDTAKEQYRVLKTDNEFRYGYKVVENGNLRSALTTSNVIELPKKEELKTV  201

Query  315  LDKVKDFFG----GAKESF  271
            +DKVKDFFG    GAKESF
Sbjct  202  VDKVKDFFGDVTSGAKESF  220



>dbj|BAJ85479.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score =   218 bits (556),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 4/139 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
             VIY+DE ++  LAK+QFRVL+  T+FRYGYK+VE  NLR+AL+T+N++ELP++EELK+V
Sbjct  131  TVIYKDEDDIIDLAKEQFRVLKGETEFRYGYKIVEKGNLRSALATSNVLELPKKEELKSV  190

Query  315  LDKVKDFFG----GAKESF  271
            +DKV+DFFG    GAKESF
Sbjct  191  VDKVRDFFGEVTSGAKESF  209



>emb|CDY01837.1| BnaC06g28770D [Brassica napus]
Length=982

 Score =   232 bits (592),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  825  PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  884

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LKTV
Sbjct  885  AVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLKTV  944

Query  315  LDKVKDFFGGAKESFG  268
             DKVKDFFG AKESFG
Sbjct  945  FDKVKDFFGDAKESFG  960



>ref|XP_010235641.1| PREDICTED: uncharacterized protein LOC104583798 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235642.1| PREDICTED: uncharacterized protein LOC104583798 isoform X1 [Brachypodium 
distachyon]
Length=249

 Score =   218 bits (555),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 4/139 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  66   PKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  125

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
             VIY+DE ++   AK+QFRVL++  +FRYGYK+VE  NLR+AL+T+N+IELP++EELKTV
Sbjct  126  TVIYKDEDDIIDTAKEQFRVLKSENEFRYGYKVVEKGNLRSALATSNVIELPKKEELKTV  185

Query  315  LDKVKDFFG----GAKESF  271
            +DKVKDFFG    GAKESF
Sbjct  186  VDKVKDFFGEVTSGAKESF  204



>gb|EEC73537.1| hypothetical protein OsI_07935 [Oryza sativa Indica Group]
 gb|EEE67978.1| hypothetical protein OsJ_25898 [Oryza sativa Japonica Group]
Length=300

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 124/140 (89%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  82   PKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  141

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DE ++   AK+Q+RVL+   +FRYGYK+VEN NLR+AL+T+N+IELP++EELKTV
Sbjct  142  AVIYKDEDDIIDTAKEQYRVLKTDNEFRYGYKVVENGNLRSALTTSNVIELPKKEELKTV  201

Query  315  LDKVKDFFG----GAKESFG  268
            +DKVKDFFG    GAKESF 
Sbjct  202  VDKVKDFFGDVTSGAKESFA  221



>ref|XP_004952998.1| PREDICTED: uncharacterized protein LOC101783266 isoform X1 [Setaria 
italica]
Length=288

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNI+TGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPRFVIFIRTANVYFWYPLNIITGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DE  +   AK+Q+RVL+   +FRYGYK+VEN N+R+AL+T+N+IELP+++ELKTV
Sbjct  131  AVIYKDEDVIIDTAKEQYRVLKTENEFRYGYKVVENGNVRSALTTSNVIELPKKDELKTV  190

Query  315  LDKVKDFFG----GAKESFG  268
            +DKVKDFFG    GAKESF 
Sbjct  191  VDKVKDFFGDVTAGAKESFA  210



>ref|XP_004952999.1| PREDICTED: uncharacterized protein LOC101783266 isoform X2 [Setaria 
italica]
Length=249

 Score =   215 bits (548),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 4/140 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNI+TGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPRFVIFIRTANVYFWYPLNIITGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DE  +   AK+Q+RVL+   +FRYGYK+VEN N+R+AL+T+N+IELP+++ELKTV
Sbjct  131  AVIYKDEDVIIDTAKEQYRVLKTENEFRYGYKVVENGNVRSALTTSNVIELPKKDELKTV  190

Query  315  LDKVKDFFG----GAKESFG  268
            +DKVKDFFG    GAKESF 
Sbjct  191  VDKVKDFFGDVTAGAKESFA  210



>ref|NP_001141155.1| uncharacterized protein LOC100273241 [Zea mays]
 gb|ACF79164.1| unknown [Zea mays]
 gb|ACF85560.1| unknown [Zea mays]
 gb|AFW72183.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=249

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 121/139 (87%), Gaps = 4/139 (3%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNI+TGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPRFVIFIRTANVYFWYPLNIITGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIY+DE  +   AK+Q+RVL+    FRYGYK+VE  N+R+AL+T+N+IELP+++ELKTV
Sbjct  131  AVIYKDEDVIIDTAKEQYRVLKTENQFRYGYKVVEKGNIRSALTTSNVIELPKKDELKTV  190

Query  315  LDKVKDFFG----GAKESF  271
            +DKVKDFFG    GAKESF
Sbjct  191  VDKVKDFFGDVTAGAKESF  209



>emb|CBI27531.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  448
            MA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIY+DT+ARNLAAVIY+DEKE+QK A +
Sbjct  1    MANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYRDTIARNLAAVIYKDEKEIQKTAFR  60

Query  447  QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  268
            Q+RVLR++ +FRYGYKLVENNN+R+ALSTT++IELP Q ELKTVLDKV+DFFG AKESFG
Sbjct  61   QYRVLRSAKEFRYGYKLVENNNVRSALSTTDVIELPTQGELKTVLDKVRDFFGDAKESFG  120



>gb|EMT22924.1| hypothetical protein F775_29812 [Aegilops tauschii]
Length=276

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 126/159 (79%), Gaps = 24/159 (15%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADV-------DL-------------WYPLNIVTGGTTAKIMVA  556
            PK+EDDGNP+FVIFIR A+V       DL             WYPLNIVTGGTTAKIM+A
Sbjct  71   PKIEDDGNPRFVIFIRTANVYSSSIPSDLIVCMYINFLLVYFWYPLNIVTGGTTAKIMLA  130

Query  555  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  376
            AKDNFLGKYIYKDTLARNLA VIY+DE ++  LAK+QFRVL+  T+FRYGYK+VE  NLR
Sbjct  131  AKDNFLGKYIYKDTLARNLATVIYKDEDDIIDLAKEQFRVLKGETEFRYGYKIVEKGNLR  190

Query  375  TALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  271
            +AL+T+N++ELP++EELK+V+DKV+DFFG    GAKESF
Sbjct  191  SALATSNVLELPKKEELKSVVDKVRDFFGEVTSGAKESF  229



>gb|AAG28905.1|AC008113_21 F12A21.16 [Arabidopsis thaliana]
Length=998

 Score =   218 bits (556),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 107/158 (68%), Positives = 124/158 (78%), Gaps = 22/158 (14%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  757  PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  816

Query  495  AVIYR----------------------DEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  382
            AVIYR                      DEKE+QK A KQ RVLR +T+FRYGYKLVEN N
Sbjct  817  AVIYRVNYTSFCLFLCDVISNCFYLQQDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGN  876

Query  381  LRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  268
            +R ALST+++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  877  MRAALSTSDVIELPTQDQLKTVFDKVKDYFGDAKESFG  914



>ref|XP_006648812.1| PREDICTED: uncharacterized protein LOC102699572 [Oryza brachyantha]
Length=193

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 107/121 (88%), Gaps = 4/121 (3%)
 Frame = -3

Query  618  VDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFR  439
            V  WYPLN+VTGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE E+   AK+Q+R
Sbjct  27   VYFWYPLNVVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDEIIDTAKEQYR  86

Query  438  VLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  271
            VL+   +FRYGYK+VEN NLR+AL+T+N+IELP++EELKTV+DKVKDFFG    GAKESF
Sbjct  87   VLKTENEFRYGYKVVENANLRSALTTSNVIELPKKEELKTVVDKVKDFFGDVTSGAKESF  146

Query  270  G  268
            G
Sbjct  147  G  147



>ref|XP_010235643.1| PREDICTED: uncharacterized protein LOC104583798 isoform X2 [Brachypodium 
distachyon]
Length=236

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 17/139 (12%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  66   PKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  125

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
             VIY+DE ++   AK+QFRVL++  +FRYGYK+VE  NLR+AL+T+N+IE          
Sbjct  126  TVIYKDEDDIIDTAKEQFRVLKSENEFRYGYKVVEKGNLRSALATSNVIE----------  175

Query  315  LDKVKDFFG----GAKESF  271
               VKDFFG    GAKESF
Sbjct  176  ---VKDFFGEVTSGAKESF  191



>gb|KDO82053.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=198

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 101/136 (74%), Gaps = 29/136 (21%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AVIYR                             EN NLR ALST+++IELP  ++LKTV
Sbjct  129  AVIYR-----------------------------ENGNLRAALSTSDVIELPTPDKLKTV  159

Query  315  LDKVKDFFGGAKESFG  268
            LDKVKDFFG AKESFG
Sbjct  160  LDKVKDFFGDAKESFG  175



>gb|KDO82056.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
 gb|KDO82057.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=197

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  394
            AVIYRDEKE+QK A KQFRVL+++T+FRYGYKLV
Sbjct  129  AVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLV  162



>gb|ABK23133.1| unknown [Picea sitchensis]
Length=232

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 113/140 (81%), Gaps = 5/140 (4%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK EDD NP+FV+FIR  +V  WYPLNI++GGTTAKIMVA KD  +GK++Y+  L RN+A
Sbjct  76   PKAEDD-NPRFVVFIRSKNVPRWYPLNIISGGTTAKIMVAGKDTPVGKFLYEGALTRNIA  134

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            AV+Y+DEKE++K+A KQ+ VL+A+++ +YGYKL++  N  +AL +++II++P QEELK V
Sbjct  135  AVVYKDEKEIRKIALKQYPVLKAASELQYGYKLIDPKNPNSALYSSDIIKIPPQEELKPV  194

Query  315  LDKVKDFFG----GAKESFG  268
            ++KVKDFFG    G KESFG
Sbjct  195  VEKVKDFFGNAMTGVKESFG  214



>gb|KEH35275.1| plant/F12A21-30 protein, putative [Medicago truncatula]
Length=194

 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFV+FIRMA+V LWYPL+IV+GGTTAKIMVAAKDNFLGK+IYKDTL RNLA
Sbjct  71   PKIEDDGNPKFVVFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNFLGKFIYKDTLDRNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  394
            AVIYRDEKE+QK A KQ RVL+++T+FRYGYKLV
Sbjct  131  AVIYRDEKEIQKSAFKQHRVLKSATEFRYGYKLV  164



>ref|XP_002887139.1| F12A21.16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63398.1| F12A21.16 [Arabidopsis lyrata subsp. lyrata]
Length=985

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 109/145 (75%), Gaps = 14/145 (10%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+A
Sbjct  757  PKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIA  816

Query  495  AVIYRDEK---------ELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIEL  343
            AVIYR             L  + +K+F+  + S+         EN N+R ALST+++IEL
Sbjct  817  AVIYRVNYTSCFLFGLIPLFNMMRKRFKRQQLSSTVS-----CENGNMRAALSTSDVIEL  871

Query  342  PRQEELKTVLDKVKDFFGGAKESFG  268
            P Q++LKTV DKVKD+FG AKESFG
Sbjct  872  PTQDQLKTVFDKVKDYFGDAKESFG  896



>ref|XP_001765741.1| predicted protein [Physcomitrella patens]
 gb|EDQ69332.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            P +EDDGNPKFV+FIR  +V  WYPL++VTGGTTAK+MV A  N  GK +Y+ TL RN+A
Sbjct  54   PAMEDDGNPKFVLFIRTLNVPRWYPLSVVTGGTTAKMMVGAMKNDWGKKLYEGTLTRNIA  113

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
             VIY+DEK++ + A KQ+ VL+++T F+YGYK+++    ++A+ +++++ +P QEEL +V
Sbjct  114  GVIYKDEKKIIQTAIKQYPVLKSATGFQYGYKIMDPEKPQSAMFSSDVVTIPPQEELNSV  173

Query  315  LDKVKDFFGGAKESFG  268
            +DKVK FF    ESFG
Sbjct  174  VDKVKGFFSKVGESFG  189



>gb|KDO82058.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=142

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKYIYKDTLARNLA
Sbjct  69   PKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  128

Query  495  AVIYRDEKELQKL  457
            AVIYR    L +L
Sbjct  129  AVIYRVSSVLLQL  141



>gb|EAY86575.1| hypothetical protein OsI_07955 [Oryza sativa Indica Group]
Length=477

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  82   PKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  141

Query  495  AVIYRDEKELQKLAKKQFR  439
            AVIY+DE ++   AK+Q+R
Sbjct  142  AVIYKDEDDIIDTAKEQYR  160



>gb|AFW72182.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=165

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNP+FVIFIR A+V  WYPLNI+TGGTTAKIM+AAKDNFLGKYIYKDTLARNLA
Sbjct  71   PKIEDDGNPRFVIFIRTANVYFWYPLNIITGGTTAKIMLAAKDNFLGKYIYKDTLARNLA  130

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  394
            AVIY+   + Q+L    F  L  S+    G+ ++
Sbjct  131  AVIYKVIDDQQQL----FFWLHHSSHILNGHPIL  160



>ref|XP_010930034.1| PREDICTED: uncharacterized protein LOC105051352 isoform X3 [Elaeis 
guineensis]
Length=189

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 80/139 (58%), Gaps = 50/139 (36%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            K+EDDGNP+FVIFIR                                             
Sbjct  76   KIEDDGNPRFVIFIRTT-------------------------------------------  92

Query  492  VIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVL  313
               +DEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A+ST ++IELP QEELKTVL
Sbjct  93   ---KDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAAISTNDVIELPTQEELKTVL  149

Query  312  DKVKDFF----GGAKESFG  268
            DKVKDF     GGAKESFG
Sbjct  150  DKVKDFVGNAAGGAKESFG  168



>ref|XP_002983221.1| hypothetical protein SELMODRAFT_422572 [Selaginella moellendorffii]
 gb|EFJ15563.1| hypothetical protein SELMODRAFT_422572 [Selaginella moellendorffii]
Length=184

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            P  EDD NP+FVIFIR  +V LWYPLNIV+GG  AK MV    N  GK IY ++L  N+ 
Sbjct  45   PAAEDD-NPRFVIFIRSKNVPLWYPLNIVSGGNAAKFMVGVTKNEWGKKIYGNSLTNNIG  103

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            A +Y+DE+++     K +  L+ + +F++GYKLV+      AL   ++  +P +EELK +
Sbjct  104  AAVYKDEEKIIASVVKTYPTLKTAKEFQFGYKLVDEEKANEALRPVDVTLIPPKEELKPI  163

Query  315  LDKVKDFFG  289
             +KV DF G
Sbjct  164  TEKVTDFVG  172



>ref|XP_002961342.1| hypothetical protein SELMODRAFT_403146 [Selaginella moellendorffii]
 gb|EFJ38881.1| hypothetical protein SELMODRAFT_403146 [Selaginella moellendorffii]
Length=179

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            P  EDD NP+FVIFIR  +V LWYPLNIV+GG  AK MV    N  GK IY ++L  N+ 
Sbjct  40   PAAEDD-NPRFVIFIRSKNVPLWYPLNIVSGGNAAKFMVGVTKNEWGKKIYGNSLTNNIG  98

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTV  316
            A +Y+DE+++     K +  L+ + +F++GYKLV+      AL   ++  +P +E+LK +
Sbjct  99   AAVYKDEEKIIASVVKTYPTLKTAKEFQFGYKLVDEEKANEALRPVDVTLIPPKEDLKPI  158

Query  315  LDKVKDFFG  289
             +KV DF G
Sbjct  159  TEKVTDFVG  167



>gb|KHN24102.1| Small heat shock protein, chloroplastic, partial [Glycine soja]
Length=320

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 65/104 (63%), Gaps = 34/104 (33%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK+EDDGNPKFVIFIRMA+                               YKDTL RNLA
Sbjct  64   PKIEDDGNPKFVIFIRMAN-------------------------------YKDTLDRNLA  92

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKL---VENNNLRT  373
            AVIYRDEKE+QK A KQ+RVLR++TDFRYGYKL   ++ +NL +
Sbjct  93   AVIYRDEKEVQKSACKQYRVLRSATDFRYGYKLLWEIQTDNLSS  136



>gb|AFB34514.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34515.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34516.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34517.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
Length=85

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK EDD NP+FV+FIR  +V  WYPLNI++GGTTAKIMVA KD  +GK++Y+  L RN+A
Sbjct  26   PKAEDD-NPRFVVFIRTKNVPRWYPLNIISGGTTAKIMVAGKDTPVGKFLYEGALTRNIA  84

Query  495  A  493
            A
Sbjct  85   A  85



>ref|XP_005648734.1| hypothetical protein COCSUDRAFT_53257 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24190.1| hypothetical protein COCSUDRAFT_53257 [Coccomyxa subellipsoidea 
C-169]
Length=213

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 77/129 (60%), Gaps = 2/129 (2%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            P ++ D N +FV+FIR      WYPL++V GG+ A I+V A ++  G+ +Y  TL RN+ 
Sbjct  78   PPVDPD-NAEFVLFIRAVKFPQWYPLSVVKGGSAANIIVRAMESEFGRLLYGKTLIRNIG  136

Query  495  AVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELK-T  319
             V+Y+D ++++ + K+   +++   DF +G+K+ +           N+  +P + EL+ T
Sbjct  137  TVVYQDRRKIENMVKRSLPMMKNFKDFEFGFKIRDKTRPNDWYFAENVTIIPPESELRGT  196

Query  318  VLDKVKDFF  292
            V D+V D++
Sbjct  197  VADQVGDWW  205



>gb|AEW09177.1| hypothetical protein CL4511Contig1_02, partial [Pinus radiata]
 gb|AFG53863.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53864.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53865.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53866.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53867.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53868.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53869.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53870.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53871.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53872.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53873.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53874.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53875.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53876.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53877.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53878.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53879.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
Length=85

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            PK EDD NP+FV+FIR  +V  WYPLNI++GGTTAKIMVA KD  +GK++Y+  L RN+A
Sbjct  26   PKAEDD-NPRFVVFIRTKNVPRWYPLNIISGGTTAKIMVAGKDTPVGKFLYEGALTRNIA  84

Query  495  A  493
            A
Sbjct  85   A  85



>gb|AFB34513.1| hypothetical protein CL4511Contig1_02, partial [Larix decidua]
Length=85

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLA  496
            P  EDD NP+FV+FIR  +V  WYPLNI++GGTTAKIMVA KD  +GK++Y+  L RN+A
Sbjct  26   PPAEDD-NPRFVVFIRSKNVPRWYPLNIISGGTTAKIMVAGKDTPVGKFLYEGALTRNIA  84

Query  495  A  493
            A
Sbjct  85   A  85



>ref|XP_001415572.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93864.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=147

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = -3

Query  663  DDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVI  487
            D  N +FVI +R    +  WYPLN+VTGG+ A  +V   DN + K + + +L++N+   I
Sbjct  13   DPDNEQFVIHVRSKRGIKAWYPLNVVTGGSAANTLVKGLDNDMSKEMAQKSLSQNIGKAI  72

Query  486  YRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN--IIELPRQEELKTVL  313
            Y+D   + K+A+    +L+ + +  YG+ +++  N R+  S  N  +  +P +EE +T  
Sbjct  73   YKDMAAIDKVARS-MPMLKQAKEIEYGFSVLDKENPRSMFSPANDKVWLIPSEEECETPA  131

Query  312  DKVKDFFGGAKESFG  268
            DK ++     K+ FG
Sbjct  132  DKFQEMGDNMKKMFG  146



>ref|XP_011397511.1| Uncharacterized protein YhiN [Auxenochlorella protothecoides]
 gb|KFM24623.1| Uncharacterized protein YhiN [Auxenochlorella protothecoides]
Length=457

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = -3

Query  663  DDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIY  484
            D  N +FV+F+R   +  W PL+I+ GGT A ++V +    LGK +Y +TL RN+A  +Y
Sbjct  325  DPKNEEFVMFVRSKKLMKWVPLSIMKGGTAANMLVKSMQGNLGKKMYTNTLIRNIAQGLY  384

Query  483  RDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELK-TVLDK  307
            +D  E+++  + Q+   + + +F Y +K+ +           ++I +P +E+L+ TV+DK
Sbjct  385  KDRLEVERQLRNQYPFFKETKEFEYAFKIRDKTKPEEWYLPADLIIIPPEEDLEDTVVDK  444

Query  306  VKDFFG  289
             K+FFG
Sbjct  445  AKNFFG  450



>ref|XP_003074445.1| Metalloendopeptidase family-saccharolysin & thimet oligopeptidase 
(ISS) [Ostreococcus tauri]
 emb|CAL50296.1| unnamed product [Ostreococcus tauri]
Length=205

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 83/139 (60%), Gaps = 5/139 (4%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNL  499
            P ++ D N +FVI++R    +  WYPLN+VTGG+ A  +V   DN + + + + +L +N+
Sbjct  67   PPIDPD-NEQFVIYVRSKRGLKAWYPLNVVTGGSAANTLVKGLDNDMSREMAQKSLQQNI  125

Query  498  AAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS--TTNIIELPRQEEL  325
               IY+D + ++K+A+    +L+ + +  YG+ +++  N R+  S  + +++ +P +E+ 
Sbjct  126  GKAIYKDFEAIEKVART-MPMLKQAKEIEYGFAVLDKKNPRSMFSPASGSVMMIPSEEDC  184

Query  324  KTVLDKVKDFFGGAKESFG  268
            +T  DK ++     K+ FG
Sbjct  185  ETPADKFQEMGDNLKKMFG  203



>ref|XP_005852074.1| hypothetical protein CHLNCDRAFT_133084 [Chlorella variabilis]
 gb|EFN59972.1| hypothetical protein CHLNCDRAFT_133084 [Chlorella variabilis]
Length=206

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = -3

Query  663  DDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIY  484
            D  N +FVIF+R   +  W PL++V GGT A ++V   D+   K     TL +N+   +Y
Sbjct  70   DPDNEEFVIFVRSKKLPQWVPLSVVKGGTAANMLVKGLDSDWMKDTTAKTLVQNIGKAVY  129

Query  483  RDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEEL-KTVLDK  307
            +D++++    +K +   + + +F + +K+ E  + +       ++++P + EL KT  + 
Sbjct  130  KDKEQIIASLRKAYPPFKETKEFEFAFKIREKADPKAWYVPKGLMDIPPEAELEKTPAEN  189

Query  306  VKDFFGGAKESFG  268
            VKDFF  A   FG
Sbjct  190  VKDFFSTAFSGFG  202



>ref|XP_002507497.1| hypothetical protein MICPUN_113391 [Micromonas sp. RCC299]
 gb|ACO68755.1| hypothetical protein MICPUN_113391 [Micromonas sp. RCC299]
Length=215

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 73/130 (56%), Gaps = 4/130 (3%)
 Frame = -3

Query  663  DDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVI  487
            D  N +FVI++R       W+PLN+VTGG+TA  +V   D+ L + + K +L  N+   I
Sbjct  72   DPDNEQFVIYVRSKKGFKAWFPLNVVTGGSTANTLVKGLDSNLSRDMAKKSLTNNIGQAI  131

Query  486  YRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT--NIIELPRQEELKTVL  313
            Y+D  +LQ++ ++   +L+A+ +  YG+ +++  N  +  +    ++  +P ++E +   
Sbjct  132  YKDADQLQEMCRR-MPMLKAAKELEYGFMILDKKNPSSMFNPPAESVFVIPPEDETRMPA  190

Query  312  DKVKDFFGGA  283
             K+ + +  A
Sbjct  191  QKMAEGWQSA  200



>ref|XP_003056036.1| hypothetical protein MICPUCDRAFT_70697 [Micromonas pusilla CCMP1545]
 gb|EEH59412.1| hypothetical protein MICPUCDRAFT_70697 [Micromonas pusilla CCMP1545]
Length=214

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 78/145 (54%), Gaps = 16/145 (11%)
 Frame = -3

Query  675  PKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNL  499
            P ++ D N +FVI++R       WYPLN+VTGG+TA  +V   D+ L + +   +L  N+
Sbjct  72   PPIDPD-NEQFVIYVRSKKGFKAWYPLNVVTGGSTANTLVKGLDSDLSRELAVKSLTTNI  130

Query  498  AAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT--NIIELPRQEE-  328
               IY++ ++L+++ ++   +L+ + +  +G+ +++ +N  +    T   +  +P ++E 
Sbjct  131  GQAIYKETEQLEEMCRR-MPMLKNAKELEFGFMVLDKSNPSSMFKPTADKVFVIPEEDET  189

Query  327  ----------LKTVLDKVKDFFGGA  283
                       +    KVKDF GG+
Sbjct  190  RLPAQKMAEGFQNAAGKVKDFLGGS  214



>ref|XP_001695603.1| hypothetical protein CHLREDRAFT_205992 [Chlamydomonas reinhardtii]
 gb|EDP01390.1| predicted protein [Chlamydomonas reinhardtii]
Length=223

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 70/138 (51%), Gaps = 14/138 (10%)
 Frame = -3

Query  663  DDGNPKFVIFIR-----------MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKD  517
            D  N +FVIF R           M    LW PL+IV G   +  +  A  +  G  +Y  
Sbjct  73   DPENAEFVIFFRCLKYKDPQLNAMVGPSLWVPLSIVKGNQVSNFLANAIKSPWGMRLYGR  132

Query  516  TLARNLAAVIYRDEKELQKLAKKQFRVL--RASTDFRYGYKLVENNNLRTALSTTNIIEL  343
            TL   +A+ +Y+D+ +L+K  +K F      AS+DF+Y +K+ +  N +   +  N+   
Sbjct  133  TLIWQMASGLYQDKAKLEKELRKNFPPFANSASSDFQYAFKIRDKANPKDWTAAENLTFF  192

Query  342  PRQEEL-KTVLDKVKDFF  292
            P  E+L +T LD++K FF
Sbjct  193  PSPEDLGETGLDQLKKFF  210



>ref|XP_002184929.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43665.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=206

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 62/131 (47%), Gaps = 5/131 (4%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGT-TAKIMVAAKDNFLGKYIYKDTLARNLA  496
            K   DG P F +F+R    ++WYP     G   +A +  +  D  L   + K  +   +A
Sbjct  78   KPGQDGLPVFNLFVRTKKANMWYPCGSFKGDERSAALAKSYADGGLLAGVSKRQIDGGIA  137

Query  495  AVIYRDEKELQKLAKKQFRVLRAS-TDFRYGYKLVENNNLRTALSTTNIIELPRQEELKT  319
              +YRD+ +L++   + +  LR S  DF +GYKL  +       S   +IE    +E K 
Sbjct  138  GSLYRDQGKLKESVARSYPQLRKSREDFEFGYKLSYDGLSEEQSSEIKVIE---PKETKG  194

Query  318  VLDKVKDFFGG  286
            V D +K+ F G
Sbjct  195  VFDSIKNAFSG  205



>ref|XP_007509245.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19702.1| predicted protein [Bathycoccus prasinos]
Length=171

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 70/133 (53%), Gaps = 20/133 (15%)
 Frame = -3

Query  663  DDGNPKFVIFIRMAD-VDLWYPLNIVTGGTTAKIMVAAKDNFLGK------YIYK-----  520
            D  N +FVI++R    +  W+PLN+VTGG+TA  +V   D+ L K      + Y      
Sbjct  15   DPDNEQFVIYVRSKKGLKTWFPLNVVTGGSTANTLVKGLDSNLSKDVCLSLFYYHFSHYF  74

Query  519  -----DTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL--ST  361
                  +L  N+   +Y+++ +L+++ +K   +L+++ +  YG+ +++  N  +    S 
Sbjct  75   LQMALKSLTNNIGQALYKEQVQLEEMVRK-MPMLKSARELEYGFSVLDKKNPNSMFKPSE  133

Query  360  TNIIELPRQEELK  322
             ++  +P +EE +
Sbjct  134  KDVYVIPPEEETR  146



>ref|XP_005534863.1| hypothetical protein CYME_CMJ126C [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80256.1| hypothetical protein CYME_CMJ126C [Cyanidioschyzon merolae strain 
10D]
Length=224

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (53%), Gaps = 3/99 (3%)
 Frame = -3

Query  672  KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAA  493
            ++ +DG P F I  R     LWYPL  + G   AK++V A     G+  Y DTL + +A 
Sbjct  83   EVPEDGTPVFAILARSPVSGLWYPLGTMRGDGRAKMLVNAMRTSWGRKFYGDTLNKGVAR  142

Query  492  VIYRDE-KELQKLAKKQFRVLRAST--DFRYGYKLVENN  385
             ++ ++ + +   A +++  LR  T  D  YGY+++  +
Sbjct  143  SVFSEQGRRMIHAALRKYSALRKYTADDLEYGYRVIAKD  181



>gb|KIZ07565.1| hypothetical protein MNEG_0380 [Monoraphidium neglectum]
Length=159

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 66/143 (46%), Gaps = 17/143 (12%)
 Frame = -3

Query  663  DDGNPKFVIFIRM--ADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  490
            D  N +FVIFIR        W  +++V GG++A ++V       G+ +Y  TL  N+A  
Sbjct  9    DPENEEFVIFIRATSGSYQQWMNMSVVKGGSSANLLVKGMATEWGRKLYARTLLSNIAGS  68

Query  489  IYRDE----KELQKLAKKQFR-----VLR-----ASTDFRYGYKLVENNNLRTALSTTNI  352
            IY++     K L+   ++Q R     V+       + DF +  K+ +  N +      N+
Sbjct  69   IYKERDAILKGLRDSVRQQIRMGGPKVMEPLLNVPAADFEFAMKIRDKANPKDWSKPDNL  128

Query  351  IELPRQEELKT-VLDKVKDFFGG  286
              LP + E+    LD+ K FF  
Sbjct  129  TILPPESEITAQPLDRFKAFFSA  151



>gb|ADU15868.1| CLCuV responsive protein [Gossypium hirsutum]
Length=77

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  357  NIIELPRQEELKTVLDKVKDFFGGAKESFG  268
              IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  5    GFIELPTQDQLKTVVDKVKDFFGDAKESFG  34



>ref|XP_002953545.1| hypothetical protein VOLCADRAFT_121174 [Volvox carteri f. nagariensis]
 gb|EFJ45518.1| hypothetical protein VOLCADRAFT_121174 [Volvox carteri f. nagariensis]
Length=233

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = -3

Query  663  DDGNPKFVIFIRM---------ADV--DLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKD  517
            D  N + V+F+R+          DV   LW P+N++ G      +V A     G  +Y  
Sbjct  72   DPENAEIVLFVRVLKYKDPTLNMDVGPSLWMPVNLIKGNQVLNFLVEALKTDWGMRLYGR  131

Query  516  TLARNLAAVIYRDEKELQKLAKK---QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIE  346
            TL   +A+ IY+D+ +++K  KK   QF    AS DF Y +K+ + +  +  L   N+  
Sbjct  132  TLIWQIASGIYQDKAKVEKDLKKNVPQF-ANAASKDFEYAFKIRDKSVPKDWLKPENLTI  190

Query  345  LPRQEELK-TVLDKVKDFF  292
             P  E+L  T + ++K FF
Sbjct  191  CPPPEDLAGTGVAQLKAFF  209



>ref|XP_005718910.1| unnamed protein product [Chondrus crispus]
 emb|CDF39005.1| unnamed protein product [Chondrus crispus]
Length=249

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 46/94 (49%), Gaps = 2/94 (2%)
 Frame = -3

Query  669  LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAV  490
            L +DG P F IF+R     LWYP+  V G   +K +V A      K +Y + L + +A  
Sbjct  120  LPEDGTPVFAIFVRTPRTKLWYPMGAVQGDDRSKNLVNALKGGFAKAMYANALDKGIAQT  179

Query  489  IY--RDEKELQKLAKKQFRVLRASTDFRYGYKLV  394
            +Y    +K +Q   +   ++ + +    +GY++ 
Sbjct  180  VYGKGGDKFVQSAVRMYPQLKKYTKQLEFGYRVT  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420