BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034B10

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIC34705.1|  omega-6 fatty acid desaturase                           180   2e-52   Rhus chinensis
gb|AGO32050.1|  microsomal oleate desaturase                            179   6e-52   Xanthoceras sorbifolium [yellow-horn]
ref|XP_004234773.1|  PREDICTED: omega-6 fatty acid desaturase, en...    175   1e-50   Solanum lycopersicum
ref|XP_006349589.1|  PREDICTED: omega-6 fatty acid desaturase, en...    175   2e-50   Solanum tuberosum [potatoes]
emb|CBI16458.3|  unnamed protein product                                175   4e-50   Vitis vinifera
ref|XP_009800247.1|  PREDICTED: omega-6 fatty acid desaturase, en...    174   5e-50   Nicotiana sylvestris
ref|XP_002285640.1|  PREDICTED: omega-6 fatty acid desaturase, en...    173   8e-50   Vitis vinifera
gb|ADX60451.1|  omega-6 fatty acid desaturase                           169   8e-50   Phaseolus vulgaris [French bean]
gb|AAO37754.1|  delta-12 oleate desaturase                              173   1e-49   Punica granatum [granado]
ref|XP_010520035.1|  PREDICTED: omega-6 fatty acid desaturase, en...    172   1e-49   Tarenaya hassleriana [spider flower]
gb|AAX47480.1|  microsomal omega-6-desaturase                           166   1e-49   Caragana korshinskii
emb|CDH92856.1|  omega-6 fatty acid desaturase                          171   2e-49   Sesamum radiatum
gb|ADK47520.1|  microsomal oleic acid desaturase                        172   2e-49   Wrightia tinctoria
ref|XP_009592981.1|  PREDICTED: omega-6 fatty acid desaturase, en...    172   2e-49   Nicotiana tomentosiformis
ref|XP_002279239.1|  PREDICTED: omega-6 fatty acid desaturase, en...    172   3e-49   Vitis vinifera
ref|XP_010520034.1|  PREDICTED: omega-6 fatty acid desaturase, en...    173   3e-49   Tarenaya hassleriana [spider flower]
gb|ACE97863.1|  fatty acid desaturase                                   166   3e-49   Populus tremula [European aspen]
gb|ACE97864.1|  fatty acid desaturase                                   166   3e-49   Populus tremula [European aspen]
emb|CDP10136.1|  unnamed protein product                                173   3e-49   Coffea canephora [robusta coffee]
gb|ACE97856.1|  fatty acid desaturase                                   166   3e-49   Populus tremula [European aspen]
gb|ACE97855.1|  fatty acid desaturase                                   166   3e-49   Populus tremula [European aspen]
gb|ACE97845.1|  fatty acid desaturase                                   166   4e-49   Populus tremula [European aspen]
gb|ACE97841.1|  fatty acid desaturase                                   166   4e-49   Populus tremula [European aspen]
gb|AGZ02022.1|  microsomal omega-6-desaturase                           171   5e-49   Millettia pinnata [karumtree]
ref|XP_010557947.1|  PREDICTED: omega-6 fatty acid desaturase, en...    171   6e-49   Tarenaya hassleriana [spider flower]
gb|AFK34956.1|  unknown                                                 171   6e-49   Lotus japonicus
gb|ACE97860.1|  fatty acid desaturase                                   166   7e-49   Populus tremula [European aspen]
ref|XP_011080227.1|  PREDICTED: omega-6 fatty acid desaturase, en...    171   8e-49   Sesamum indicum [beniseed]
gb|AEI60128.1|  microsomal delta-12 oleate desaturase                   171   9e-49   Vitis labrusca [Concord grape]
gb|ABZ05022.1|  delta-12 fatty acid desaturase                          171   9e-49   Davidia involucrata
gb|ACE97859.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
gb|ACE97842.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
gb|ACE97847.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
ref|XP_004136572.1|  PREDICTED: omega-6 fatty acid desaturase, en...    170   1e-48   Cucumis sativus [cucumbers]
gb|AAS19533.1|  omega-6 fatty acid desaturase                           170   1e-48   Cucurbita pepo
gb|ACE97854.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
gb|ACE97853.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
gb|ACE97868.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
ref|XP_010087393.1|  Omega-6 fatty acid desaturase, endoplasmic r...    170   1e-48   Morus notabilis
ref|XP_008350272.1|  PREDICTED: omega-6 fatty acid desaturase, en...    168   1e-48   
gb|AIZ94608.1|  fatty acid desaturase 4                                 168   1e-48   Perilla frutescens [beefsteak-mint]
ref|XP_011080226.1|  PREDICTED: omega-6 fatty acid desaturase, en...    172   1e-48   Sesamum indicum [beniseed]
gb|ACE97848.1|  fatty acid desaturase                                   165   1e-48   Populus tremula [European aspen]
emb|CAD24671.1|  delta 12-acyl-lipid-desaturase                         170   2e-48   Punica granatum [granado]
ref|XP_008387264.1|  PREDICTED: omega-6 fatty acid desaturase, en...    169   2e-48   
emb|CDP17521.1|  unnamed protein product                                169   2e-48   Coffea canephora [robusta coffee]
gb|ACE97839.1|  fatty acid desaturase                                   164   2e-48   Populus tremula [European aspen]
ref|XP_007014826.1|  Microsomal oleic acid desaturase isoform 1         169   3e-48   
emb|CAN71892.1|  hypothetical protein VITISV_040865                     169   3e-48   Vitis vinifera
ref|XP_007028985.1|  Microsomal oleic acid desaturase                   169   5e-48   
gb|ACE97843.1|  fatty acid desaturase                                   163   5e-48   Populus tremula [European aspen]
ref|XP_007162321.1|  hypothetical protein PHAVU_001G142100g             168   6e-48   Phaseolus vulgaris [French bean]
gb|ABI96919.1|  delta-12 fatty acid desaturase                          168   6e-48   Triadica sebifera [candleberry-tree]
ref|XP_008443062.1|  PREDICTED: omega-6 fatty acid desaturase, en...    170   7e-48   
gb|ADB93805.1|  delta-12-fatty acid desaturase                          168   8e-48   Jatropha curcas
ref|XP_002530704.1|  omega-6 desaturase, endoplasmic reticulum          168   8e-48   
gb|AHG95978.1|  endoplasmic reticulum 18:1 desaturase                   168   9e-48   Malus baccata [shan jing zi]
gb|AIN36675.1|  delta 12 desaturase                                     168   9e-48   Cannabis sativa
gb|ABP65296.1|  omega-6 fatty desaturase                                167   1e-47   Caragana korshinskii
gb|AAY87459.1|  omega-6 fatty acid desaturase                           167   1e-47   Hevea brasiliensis [jebe]
ref|NP_001238358.1|  omega-6 fatty acid desaturase, endoplasmic r...    167   1e-47   
gb|EYU46325.1|  hypothetical protein MIMGU_mgv1a008048mg                167   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_006604385.1|  PREDICTED: omega-6 fatty acid desaturase, en...    167   1e-47   
gb|AEQ28964.1|  omega-6 desaturase                                      167   2e-47   Linum grandiflorum
gb|ACU23285.1|  unknown                                                 167   2e-47   Glycine max [soybeans]
gb|KHN07428.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    167   2e-47   Glycine soja [wild soybean]
dbj|BAD89862.1|  microsomal omega-6 fatty acid desaturase               167   2e-47   Glycine max [soybeans]
gb|AFJ53124.1|  fatty acid desaturase 2-2                               165   2e-47   Linum usitatissimum
ref|XP_011004831.1|  PREDICTED: omega-6 fatty acid desaturase, en...    167   2e-47   Populus euphratica
ref|XP_008380133.1|  PREDICTED: omega-6 fatty acid desaturase, en...    167   2e-47   
gb|AFJ53125.1|  fatty acid desaturase 2-2                               165   2e-47   Linum usitatissimum
gb|AFJ53119.1|  fatty acid desaturase 2-2                               165   3e-47   Linum usitatissimum
gb|AFJ53126.1|  fatty acid desaturase 2-2                               165   3e-47   Linum usitatissimum
gb|AFJ53123.1|  fatty acid desaturase 2-2                               165   3e-47   Linum usitatissimum
gb|AFJ53122.1|  fatty acid desaturase 2-2                               165   3e-47   Linum usitatissimum
gb|AFN53642.1|  omega-6 desaturase                                      169   3e-47   Linum usitatissimum
gb|ABA41034.1|  delta12-fatty acid desaturase                           166   4e-47   Jatropha curcas
gb|AFJ53127.1|  fatty acid desaturase 2-2                               164   4e-47   Linum usitatissimum
gb|AFJ53121.1|  fatty acid desaturase 2-2                               165   4e-47   Linum usitatissimum
ref|XP_004228665.1|  PREDICTED: omega-6 fatty acid desaturase, en...    166   4e-47   Solanum lycopersicum
gb|AFJ53120.1|  fatty acid desaturase 2-2                               165   4e-47   Linum usitatissimum
gb|AFJ53118.1|  fatty acid desaturase 2-2                               165   5e-47   Linum usitatissimum
ref|XP_010257471.1|  PREDICTED: omega-6 fatty acid desaturase, en...    166   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010044976.1|  PREDICTED: omega-6 fatty acid desaturase, en...    166   5e-47   Eucalyptus grandis [rose gum]
ref|XP_004493583.1|  PREDICTED: omega-6 fatty acid desaturase, en...    166   6e-47   Cicer arietinum [garbanzo]
gb|AGJ01133.1|  fatty acid desaturase 2-1                               166   7e-47   Linum usitatissimum
ref|XP_002309307.2|  hypothetical protein POPTR_0006s20640g             167   8e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009369579.1|  PREDICTED: omega-6 fatty acid desaturase, en...    165   9e-47   Pyrus x bretschneideri [bai li]
emb|CAA63432.1|  D12 oleate desaturase                                  165   9e-47   Solanum commersonii
gb|ABP49577.1|  oleate desaturase                                       165   1e-46   Caragana korshinskii
ref|XP_010058087.1|  PREDICTED: omega-6 fatty acid desaturase, en...    165   1e-46   Eucalyptus grandis [rose gum]
gb|ACF49507.1|  omega-6 desaturase                                      165   1e-46   Linum usitatissimum
gb|AEQ28965.1|  omega-6 desaturase                                      165   1e-46   Linum grandiflorum
ref|XP_006445919.1|  hypothetical protein CICLE_v10015614mg             164   2e-46   Citrus clementina [clementine]
gb|AGZ15438.1|  FAD2                                                    165   2e-46   Eucalyptus camaldulensis
ref|XP_006492662.1|  PREDICTED: omega-6 fatty acid desaturase, en...    164   2e-46   Citrus sinensis [apfelsine]
gb|AAQ16653.1|  delta-12 fatty acid desaturase 2                        164   2e-46   Gossypium hirsutum [American cotton]
gb|AEK67593.1|  omega-6 fatty acid desaturase                           164   2e-46   Citrus medica var. sarcodactylis
ref|XP_006492661.1|  PREDICTED: omega-6 fatty acid desaturase, en...    165   2e-46   
gb|AFN53713.1|  omega-6 desaturase                                      169   2e-46   Linum usitatissimum
gb|AEW43691.1|  fatty acid desaturase 2                                 164   2e-46   Jatropha curcas
gb|AIN52150.1|  fatty acid desaturase-2                                 164   2e-46   Camellia oleifera [abura-tsubaki]
gb|KJB46318.1|  hypothetical protein B456_007G362300                    164   2e-46   Gossypium raimondii
gb|ADP07951.1|  microsomal omega-6 desaturase                           164   2e-46   Phaseolus lunatus
gb|KHG25037.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    164   2e-46   Gossypium arboreum [tree cotton]
ref|XP_010058070.1|  PREDICTED: omega-6 fatty acid desaturase, en...    165   2e-46   
gb|AEW43690.1|  fatty acid desaturase 2                                 164   2e-46   Jatropha curcas
ref|XP_006354202.1|  PREDICTED: omega-6 fatty acid desaturase, en...    164   3e-46   Solanum tuberosum [potatoes]
emb|CAN73788.1|  hypothetical protein VITISV_002517                     163   3e-46   Vitis vinifera
ref|XP_009777156.1|  PREDICTED: omega-6 fatty acid desaturase, en...    164   4e-46   Nicotiana sylvestris
ref|XP_002297660.2|  microsomal omega-6 desaturase family protein       164   4e-46   
ref|XP_010105456.1|  Omega-6 fatty acid desaturase, endoplasmic r...    163   4e-46   Morus notabilis
gb|ADZ39687.1|  microsomal delta-12 oleate desaturase                   163   5e-46   Olea europaea subsp. europaea
gb|ACJ84618.1|  unknown                                                 164   5e-46   Medicago truncatula
gb|AAT72296.2|  microsomal omega-6-desaturase                           163   6e-46   Nicotiana tabacum [American tobacco]
ref|XP_009613562.1|  PREDICTED: omega-6 fatty acid desaturase, en...    163   6e-46   Nicotiana tomentosiformis
gb|EPS73825.1|  delta-12 oleate desaturase                              163   6e-46   Genlisea aurea
gb|AAL61826.1|  putative delta12 acid desaturase                        160   6e-46   Vernicia fordii [tung oil tree]
gb|AGH32914.1|  fatty acid desaturase                                   163   6e-46   Camellia chekiangoleosa
gb|AFK31315.1|  fatty acid desaturase                                   163   7e-46   Camellia oleifera [abura-tsubaki]
gb|AGG38092.1|  omega-6 fatty acid desaturase 2 endoplasmic retic...    163   8e-46   Musa AB Group
ref|XP_003625259.1|  Omega-6 fatty acid desaturase, endoplasmic r...    164   9e-46   
ref|XP_009395096.1|  PREDICTED: omega-6 fatty acid desaturase, en...    163   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEZ00841.1|  putative ER-oleate desaturase protein                   158   1e-45   Elaeis guineensis
gb|ABC41578.1|  endoplasmic reticulum 18:1 desaturase                   162   1e-45   Populus tomentosa [Chinese white poplar]
ref|XP_010277281.1|  PREDICTED: omega-6 fatty acid desaturase, en...    162   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009420049.1|  PREDICTED: omega-6 fatty acid desaturase, en...    162   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL37484.1|AF331163_1  delta-12 fatty acid desaturase                162   1e-45   Gossypium hirsutum [American cotton]
gb|AGN95842.1|  fatty acid delta12-desturase FAD2-2                     162   1e-45   Hiptage benghalensis
gb|AAQ08982.1|  delta-12 fatty acid desaturase                          158   2e-45   Olea europaea subsp. europaea
gb|AGN95841.1|  fatty acid delta12-desturase FAD2-1                     162   2e-45   Hiptage benghalensis
gb|ABL86147.1|  delta-12 oleic acid desaturase                          162   2e-45   Vernicia montana
gb|KHN12315.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    162   2e-45   Glycine soja [wild soybean]
ref|XP_009383220.1|  PREDICTED: omega-6 fatty acid desaturase, en...    161   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG38093.1|  omega-6 fatty acid desaturase 2 endoplasmic retic...    162   3e-45   Musa AB Group
gb|AAW63040.1|  microsomal delta-12 oleate desaturase                   161   4e-45   Olea europaea
gb|AAC24586.1|  omega-6 fatty acid desaturase                           160   4e-45   Prunus armeniaca
gb|KJB15034.1|  hypothetical protein B456_002G156600                    161   4e-45   Gossypium raimondii
emb|CAA71199.1|  omega-6 desaturase                                     161   4e-45   Gossypium hirsutum [American cotton]
gb|ABB05230.1|  delta 12 desaturase                                     160   5e-45   Linum usitatissimum
gb|AFJ53078.1|  fatty acid desaturase 2                                 160   5e-45   Linum usitatissimum
gb|AGZ02023.1|  microsomal omega-6-desaturase                           160   5e-45   Millettia pinnata [karumtree]
ref|XP_008392076.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   5e-45   
gb|AEE69020.1|  Fad2                                                    160   5e-45   Vernicia fordii [tung oil tree]
gb|AFX61781.1|  omega-6 fatty acid desaturase endoplasmic reticul...    160   5e-45   Musa AB Group
gb|ACF49508.1|  omega-6 desaturase                                      160   6e-45   Linum usitatissimum
gb|AEE69021.1|  Fad2                                                    160   6e-45   Vernicia fordii [tung oil tree]
gb|AAN87573.1|  delta 12 oleic acid desaturase FAD2                     160   6e-45   Vernicia fordii [tung oil tree]
ref|NP_001047927.1|  Os02g0716500                                       160   7e-45   
ref|XP_006647793.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   7e-45   Oryza brachyantha
ref|XP_009376128.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   8e-45   Pyrus x bretschneideri [bai li]
ref|XP_006492862.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   8e-45   Citrus sinensis [apfelsine]
ref|XP_010265904.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   8e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011037927.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   9e-45   Populus euphratica
ref|XP_008240937.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   1e-44   Prunus mume [ume]
ref|XP_007204396.1|  hypothetical protein PRUPE_ppa007098mg             160   1e-44   Prunus persica
ref|XP_011075145.1|  PREDICTED: omega-6 fatty acid desaturase, en...    160   1e-44   Sesamum indicum [beniseed]
ref|XP_007145683.1|  hypothetical protein PHAVU_007G259500g             160   1e-44   Phaseolus vulgaris [French bean]
gb|ACA14461.1|  oleate desaturase                                       157   1e-44   Caragana korshinskii
ref|XP_009417293.1|  PREDICTED: omega-6 fatty acid desaturase, en...    159   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN35589.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    159   2e-44   Glycine soja [wild soybean]
ref|XP_010091397.1|  Omega-6 fatty acid desaturase, endoplasmic r...    159   2e-44   Morus notabilis
dbj|BAD89863.1|  microsomal omega-6 fatty acid desaturase               158   2e-44   Glycine max [soybeans]
gb|ADP02395.1|  delta-12 oleate desaturase                              158   4e-44   Gossypium hirsutum [American cotton]
emb|CAA65744.1|  omega-6 desaturase                                     158   4e-44   Gossypium hirsutum [American cotton]
ref|XP_009390650.1|  PREDICTED: omega-6 fatty acid desaturase, en...    158   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011037928.1|  PREDICTED: omega-6 fatty acid desaturase, en...    158   4e-44   Populus euphratica
gb|AAW63041.1|  microsomal delta-12 oleate desaturase                   158   5e-44   Olea europaea
dbj|BAC22091.1|  delta-12 desaturase                                    158   6e-44   Spinacia oleracea
gb|ADZ39688.1|  microsomal delta-12 oleate desaturase                   158   6e-44   Olea europaea subsp. europaea
ref|XP_002323284.1|  Omega-6 fatty acid desaturase family protein       158   6e-44   
ref|XP_004497897.1|  PREDICTED: omega-6 fatty acid desaturase, en...    158   7e-44   Cicer arietinum [garbanzo]
ref|XP_010943510.1|  PREDICTED: omega-6 fatty acid desaturase, en...    158   7e-44   Elaeis guineensis
ref|XP_004304366.1|  PREDICTED: omega-6 fatty acid desaturase, en...    157   8e-44   Fragaria vesca subsp. vesca
gb|KHG24863.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    157   9e-44   Gossypium arboreum [tree cotton]
gb|EYU39931.1|  hypothetical protein MIMGU_mgv1a008167mg                157   9e-44   Erythranthe guttata [common monkey flower]
ref|XP_006429873.1|  hypothetical protein CICLE_v10011949mg             157   1e-43   Citrus clementina [clementine]
gb|EYU39930.1|  hypothetical protein MIMGU_mgv1a008167mg                157   1e-43   Erythranthe guttata [common monkey flower]
gb|ACZ06072.1|  microsomal omega-6 fatty acid desaturase                157   1e-43   Arachis hypogaea [goober]
ref|XP_006368553.1|  hypothetical protein POPTR_0001s05000g             156   1e-43   
ref|XP_006850001.1|  hypothetical protein AMTR_s00022p00172860          157   2e-43   Amborella trichopoda
gb|AAS57577.1|  delta12-oleic acid desaturase                           157   2e-43   Euphorbia lagascae
gb|AAL93620.1|  fatty acid desaturase 2                                 157   2e-43   Olea europaea subsp. europaea
ref|XP_011033218.1|  PREDICTED: omega-6 fatty acid desaturase, en...    158   2e-43   Populus euphratica
gb|AIT96964.1|  FAD2 desaturase                                         156   2e-43   Corylus avellana [European hazelnut]
gb|AHV83757.1|  omega-6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
ref|NP_001130234.1|  delta-12 fatty acid desaturaseFAD2                 156   3e-43   Zea mays [maize]
gb|AAL23676.1|  delta-12 fatty acid desaturase                          156   3e-43   Persea americana
gb|AAB84262.1|  omega-6 desaturase                                      156   3e-43   Arachis hypogaea [goober]
gb|AER27513.1|  omega 6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
gb|AAF82293.1|  microsomal oleate desaturase                            156   3e-43   Arachis hypogaea [goober]
gb|AAK67829.1|  delta-12 fatty acid desaturase                          156   3e-43   Arachis hypogaea [goober]
gb|AAY67653.1|  oleate desaturase                                       156   3e-43   Arachis hypogaea [goober]
gb|AAF82295.1|  microsomal oleate desaturase                            156   3e-43   Arachis ipaensis
gb|AEW67305.1|  delta-12 fatty acid desaturase                          156   3e-43   Arachis hypogaea [goober]
gb|AAF82294.1|  microsomal oleate desaturase                            156   3e-43   Arachis duranensis
gb|AER27515.1|  omega 6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
gb|AER27514.1|  omega 6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
ref|NP_001237865.1|  microsomal oleate desaturase FAD2-4                156   3e-43   Glycine max [soybeans]
gb|ADX20841.1|  omega 6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
gb|ADI46403.1|  omega-6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
gb|AAC31698.1|  delta-12 fatty acid desaturase                          156   3e-43   Borago officinalis
gb|AHV83758.1|  omega-6 fatty acid desaturase                           156   3e-43   Arachis hypogaea [goober]
gb|AFX61782.1|  omega-6 fatty acid desaturase endoplasmic reticul...    156   3e-43   Musa AB Group
gb|ACG37433.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    156   4e-43   Zea mays [maize]
gb|AAY53559.1|  oleate desaturase                                       155   4e-43   Arachis hypogaea [goober]
gb|ADM83594.1|  omega 6 fatty acid desaturase                           155   4e-43   Arachis hypogaea [goober]
gb|ACJ66779.1|  omega-6 desaturase                                      155   4e-43   Portulaca oleracea
dbj|BAE93382.1|  delta-12 fatty acid desaturase                         155   4e-43   Zea mays [maize]
ref|XP_010231291.1|  PREDICTED: LOW QUALITY PROTEIN: omega-6 fatt...    155   5e-43   
ref|XP_010672659.1|  PREDICTED: omega-6 fatty acid desaturase, en...    155   5e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010928433.1|  PREDICTED: omega-6 fatty acid desaturase, en...    155   5e-43   Elaeis guineensis
gb|ACL53784.1|  unknown                                                 155   5e-43   Zea mays [maize]
gb|ABV44669.1|  fatty acid desaturase-2                                 155   5e-43   Zea mays [maize]
ref|NP_001149122.1|  omega-6 fatty acid desaturase, endoplasmic r...    155   5e-43   Zea mays [maize]
gb|AIB55752.1|  delta-12 fatty acid desaturase                          155   5e-43   Fragaria x ananassa
gb|AIT96965.1|  FAD2 desaturase                                         155   6e-43   Corylus avellana [European hazelnut]
gb|AAX14399.1|  oleate desaturase                                       155   6e-43   Arachis monticola
gb|KEH41705.1|  microsomal omega-3 fatty acid desaturase                155   1e-42   Medicago truncatula
gb|ADN86005.1|  oleate desaturase                                       153   1e-42   Arachis hypogaea var. hirsuta
ref|XP_004953689.1|  PREDICTED: omega-6 fatty acid desaturase, en...    155   1e-42   Setaria italica
gb|AFK12604.1|  fad2-3                                                  154   1e-42   Helianthus annuus
gb|AFK12603.1|  fad2-3                                                  154   1e-42   Helianthus annuus
gb|AFK12596.1|  fad2-3                                                  154   1e-42   Helianthus annuus
gb|AFK12607.1|  fad2-3                                                  154   1e-42   Helianthus annuus
gb|AFK12600.1|  fad2-3                                                  154   1e-42   Helianthus annuus
gb|AFK12602.1|  fad2-3                                                  154   1e-42   Helianthus annuus
gb|ADM83591.1|  omega 6 fatty acid desaturase                           154   1e-42   Arachis hypogaea [goober]
ref|XP_011037924.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   2e-42   Populus euphratica
ref|XP_011037925.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   2e-42   Populus euphratica
gb|AFK12595.1|  fad2-3                                                  153   2e-42   Helianthus petiolaris
gb|KHG30631.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    154   2e-42   Gossypium arboreum [tree cotton]
gb|AER27516.1|  omega 6 fatty acid desaturase                           154   2e-42   Arachis hypogaea [goober]
ref|XP_004295164.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   2e-42   Fragaria vesca subsp. vesca
ref|XP_003570235.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_008677266.1|  PREDICTED: omega-6 fatty acid desaturase, en...    155   2e-42   
ref|XP_008344778.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   2e-42   
gb|AAL68983.1|AF251844_1  delta-12 oleate desaturase                    154   2e-42   Helianthus annuus
gb|AAL61825.1|  putative delta12 oleic acid desaturase-related fa...    150   2e-42   Vernicia fordii [tung oil tree]
gb|AFW63614.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    155   3e-42   
gb|AIA21668.1|  oleate desaturase                                       153   4e-42   Crambe kralikii
dbj|BAJ86651.1|  predicted protein                                      153   4e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGN95844.1|  fatty acid delta12-desturase FAD2-4                     151   4e-42   Hiptage benghalensis
gb|AIA21669.1|  oleate desaturase                                       153   4e-42   Crambe kralikii
gb|AEK06377.1|  microsomal oleate desaturase FAD2-8                     152   6e-42   Carthamus tinctorius
ref|XP_006407366.1|  hypothetical protein EUTSA_v10020910mg             152   6e-42   Eutrema salsugineum [saltwater cress]
gb|AIA21649.1|  oleate desaturase                                       152   6e-42   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AGS12443.1|  omega-6 fatty acid desaturase                           152   6e-42   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_010673536.1|  PREDICTED: omega-6 fatty acid desaturase, en...    152   6e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|ACA28704.1|  fatty acid desaturase                                   152   7e-42   Sorghum bicolor [broomcorn]
gb|ACR83861.1|  omega-6 fatty acid desaturase                           152   7e-42   Portulaca oleracea
ref|XP_006365824.1|  PREDICTED: omega-6 fatty acid desaturase, en...    149   7e-42   Solanum tuberosum [potatoes]
gb|AIA21646.1|  oleate desaturase                                       152   9e-42   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|KJB83458.1|  hypothetical protein B456_013G248800                    152   9e-42   Gossypium raimondii
gb|AGS12444.1|  omega-6 fatty acid desaturase                           152   1e-41   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|NP_001167925.1|  hypothetical protein                               152   1e-41   Zea mays [maize]
gb|KJB15033.1|  hypothetical protein B456_002G156500                    152   1e-41   Gossypium raimondii
gb|ACA14460.1|  oleate desaturase                                       152   1e-41   Caragana korshinskii
gb|ADX20840.1|  omega 6 fatty acid desaturase                           152   1e-41   Arachis hypogaea [goober]
ref|XP_002299149.1|  microsomal omega-6 desaturase family protein       152   1e-41   
gb|AAC49010.1|  oleate 12-hydroxylase                                   152   1e-41   Ricinus communis
ref|XP_002528127.1|  oleate 12-hydroxylase                              152   1e-41   Ricinus communis
gb|AGC65507.1|  FAD2-10 protein                                         151   2e-41   Carthamus tinctorius
gb|AAF14564.1|AF181726_1  delta-12 fatty acid desaturase                147   2e-41   Brassica oleracea
emb|CDP11063.1|  unnamed protein product                                150   2e-41   Coffea canephora [robusta coffee]
gb|AIA21657.1|  oleate desaturase                                       151   2e-41   Crambe filiformis
ref|XP_002452649.1|  hypothetical protein SORBIDRAFT_04g029900          151   2e-41   Sorghum bicolor [broomcorn]
gb|ABC00770.1|  delta-12 fatty acid desaturase type 02                  151   2e-41   Crepis alpina
ref|XP_008799208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    151   2e-41   Phoenix dactylifera
gb|AGC65498.1|  FAD2-1 protein                                          151   3e-41   Carthamus tinctorius
gb|ADK94440.1|  delta-12 fatty acid desaturase                          151   3e-41   Carthamus tinctorius
gb|AFK12575.1|  fad2-2                                                  150   3e-41   Helianthus annuus
gb|AAN87574.1|  delta 12 fatty acid conjugase FADX                      151   3e-41   Vernicia fordii [tung oil tree]
gb|AIA21652.1|  oleate desaturase                                       150   3e-41   Crambe filiformis
gb|AIA21660.1|  oleate desaturase                                       150   3e-41   Crambe glabrata
gb|AIA21661.1|  oleate desaturase                                       150   3e-41   Crambe glabrata
gb|AFK12573.1|  fad2-2                                                  149   3e-41   Helianthus argophyllus
gb|AGS12442.1|  omega-6 fatty acid desaturase                           150   3e-41   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AFK12589.1|  fad2-2                                                  149   3e-41   Helianthus annuus
gb|AFK12574.1|  fad2-2                                                  149   3e-41   
gb|AFK12577.1|  fad2-2                                                  149   4e-41   
gb|ABS86964.2|  delta-12 fatty acid desaturase                          150   4e-41   
gb|AFK12581.1|  fad2-2                                                  149   4e-41   
gb|AFK12587.1|  fad2-2                                                  149   4e-41   
gb|ACD39348.1|  oleate 12-hydroxylase                                   150   4e-41   
gb|AAV52834.1|  delta-12 fatty acid desaturase                          150   4e-41   
emb|CAM96527.1|  putative microsomal omega-6 fatty acid desaturase      143   5e-41   
ref|XP_008813208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    150   5e-41   
gb|AIE48273.1|  omega-6 fatty acid desaturase                           150   7e-41   
ref|XP_006365804.1|  PREDICTED: omega-6 fatty acid desaturase, en...    149   8e-41   
gb|AFK12549.1|  fad2-1                                                  148   1e-40   
gb|AFK12578.1|  fad2-2                                                  148   1e-40   
gb|AFK12580.1|  fad2-2                                                  148   1e-40   
gb|AAB80696.1|  omega-6 fatty acid desaturase                           149   1e-40   
gb|AAL68982.1|AF251843_1  delta-12 oleate desaturase                    149   2e-40   
ref|XP_006366157.1|  PREDICTED: omega-6 fatty acid desaturase, en...    148   2e-40   
gb|AAF04093.1|AF188263_1  delta-12 oleate desaturase                    148   2e-40   
gb|AAF04094.1|AF188264_1  delta-12 oleate desaturase                    148   2e-40   
gb|AIA21647.1|  oleate desaturase                                       148   3e-40   
gb|AIA21650.1|  oleate desaturase                                       148   3e-40   
gb|AFK12545.1|  fad2-1                                                  147   3e-40   
gb|AAD19742.1|  delta-12 desaturase                                     148   4e-40   
gb|AFK12546.1|  fad2-1                                                  147   4e-40   
ref|XP_009375092.1|  PREDICTED: omega-6 fatty acid desaturase, en...    148   4e-40   
ref|XP_006365801.1|  PREDICTED: omega-6 fatty acid desaturase, en...    147   4e-40   
gb|AFK12550.1|  fad2-1                                                  147   5e-40   
gb|AFK12551.1|  fad2-1                                                  147   5e-40   
gb|AFK12547.1|  fad2-1                                                  147   5e-40   
gb|AFK12548.1|  fad2-1                                                  147   5e-40   
gb|AFK12544.1|  fad2-1                                                  147   5e-40   
gb|AFK12543.1|  fad2-1                                                  147   6e-40   
gb|AFK12542.1|  fad2-1                                                  146   7e-40   
gb|AAL68981.1|AF251842_1  delta-12 oleate desaturase                    147   7e-40   
gb|ADM48789.1|  microsomal oleate desaturase                            147   7e-40   
ref|XP_006365798.1|  PREDICTED: omega-6 fatty acid desaturase, en...    147   8e-40   
ref|XP_003555879.1|  PREDICTED: omega-6 fatty acid desaturase, en...    147   1e-39   
gb|ACU23718.1|  unknown                                                 147   1e-39   
ref|XP_006605885.1|  PREDICTED: omega-6 fatty acid desaturase, en...    146   1e-39   
ref|XP_004497140.1|  PREDICTED: omega-6 fatty acid desaturase, en...    146   1e-39   
gb|ABF84062.1|  microsomal oleate desaturase FAD2-1B                    147   1e-39   
gb|KHN11459.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    146   1e-39   
gb|ACH43025.1|  omega-6 fatty acid desaturase                           147   1e-39   
gb|AFK12541.1|  fad2-1                                                  145   1e-39   
ref|XP_006297892.1|  hypothetical protein CARUB_v10013933mg             146   1e-39   
sp|Q39287.1|FAD6E_BRAJU  RecName: Full=Omega-6 fatty acid desatur...    146   2e-39   
gb|AFC41106.1|  FAD2-1                                                  146   2e-39   
gb|AHI85708.1|  stress-induced protein 3                                143   2e-39   
gb|AAS72902.1|  trans-delta12 oleic acid desaturase                     145   2e-39   
gb|EMT22276.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    146   3e-39   
gb|AAX29989.1|  microsomal omega-6-desaturase                           145   3e-39   
gb|AAC99622.1|  delta-12 desaturase                                     144   3e-39   
ref|NP_001238342.1|  omega-6 fatty acid desaturase, endoplasmic r...    145   3e-39   
gb|KHN37429.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    145   3e-39   
gb|ABK24364.1|  unknown                                                 145   3e-39   
gb|AGN95846.1|  fatty acid delta12-hydroxylase FAH12-2                  145   3e-39   
gb|AER10477.1|  fatty acid desaturase 2                                 144   3e-39   
gb|AER10476.1|  oleate desaturase                                       144   4e-39   
gb|AIA21665.1|  oleate desaturase                                       145   4e-39   
gb|AIA21667.1|  oleate desaturase                                       145   4e-39   
ref|XP_007142866.1|  hypothetical protein PHAVU_007G0234001g            144   4e-39   
gb|ACP39505.1|  delta-12 oleate desaturase                              145   5e-39   
gb|ACP39504.1|  delta-12 oleate desaturase                              145   6e-39   
gb|ACP39502.1|  delta-12 oleate desaturase                              144   6e-39   
ref|XP_010486902.1|  PREDICTED: omega-6 fatty acid desaturase, en...    144   8e-39   
ref|NP_001291954.1|  omega-6 fatty acid desaturase, endoplasmic r...    144   8e-39   
emb|CAD30827.1|  fatty acid desaturase 2                                144   8e-39   
gb|AIA21648.1|  oleate desaturase                                       144   9e-39   
gb|ACN53522.1|  fatty acid desaturase 2                                 144   9e-39   
ref|XP_009146642.1|  PREDICTED: omega-6 fatty acid desaturase, en...    144   9e-39   
gb|ABG76201.1|  delta 12 desaturase                                     144   9e-39   
emb|CDY01103.1|  BnaC05g40970D                                          145   1e-38   
gb|AAS92240.1|  delta-12 oleate desaturase                              144   1e-38   
gb|ADN10829.1|  fatty acid desaturase                                   144   1e-38   
ref|XP_002884883.1|  hypothetical protein ARALYDRAFT_478568             144   1e-38   
gb|EMT19391.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    144   1e-38   
gb|AAM61113.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    144   1e-38   
ref|NP_187819.1|  omega-6 fatty acid desaturase                         144   1e-38   
gb|ADJ58018.1|  fatty acid desaturase 2                                 144   1e-38   
emb|CDY08454.1|  BnaA05g26900D                                          145   1e-38   
gb|ADN10832.1|  fatty acid desaturase                                   144   1e-38   
gb|ADN10825.1|  fatty acid desaturase                                   144   1e-38   
gb|ADN10835.1|  fatty acid desaturase                                   144   1e-38   
gb|AFQ60942.1|  microsomal oleate desaturase                            144   2e-38   
gb|ADN10834.1|  fatty acid desaturase                                   143   2e-38   
gb|AEJ87847.1|  omega-6-desaturase                                      143   2e-38   
gb|AHY24226.1|  delta-12 fatty acid desaturase                          143   2e-38   
ref|XP_008351545.1|  PREDICTED: LOW QUALITY PROTEIN: omega-6 fatt...    140   2e-38   
gb|AAC32756.1|  putative oleate 12-desaturase                           138   2e-38   
gb|AIA21654.1|  oleate desaturase                                       143   2e-38   
emb|CAA76157.1|  delta 12 fatty acid desaturase                         142   3e-38   
gb|AAC32757.1|  putative oleate 12-desaturase                           137   3e-38   
ref|XP_006365825.1|  PREDICTED: omega-6 fatty acid desaturase, en...    142   3e-38   
emb|CAI48074.1|  omega-6 fatty acid desaturase                          141   3e-38   
gb|AIA21658.1|  oleate desaturase                                       142   4e-38   
gb|ACN53524.1|  fatty acid desaturase 2                                 142   4e-38   
ref|XP_006346614.1|  PREDICTED: omega-6 fatty acid desaturase, en...    142   4e-38   
gb|AAT44123.1|  microsomal omega-6-desaturase                           142   4e-38   
gb|AAF78778.1|  delta-12 oleate desaturase                              142   4e-38   
emb|CDP17522.1|  unnamed protein product                                142   4e-38   
gb|AGN95843.1|  fatty acid delta12-desturase FAD2-3                     142   5e-38   
gb|AIA21659.1|  oleate desaturase                                       142   5e-38   
gb|AFC41107.1|  FAD2-2                                                  142   5e-38   
gb|ADU18249.1|  microsomal oleate desaturase                            142   7e-38   
gb|ACP39506.1|  delta-12 oleate desaturase                              142   7e-38   
ref|XP_010464962.1|  PREDICTED: omega-6 fatty acid desaturase, en...    142   7e-38   
gb|AAO37752.1|  delta-12 oleate desaturase                              141   7e-38   
gb|AIA21651.1|  oleate desaturase                                       142   7e-38   
gb|AFJ19032.1|  fatty acid desaturase BnaC.FAD2.b                       142   7e-38   
gb|AIA21656.1|  oleate desaturase                                       142   7e-38   
gb|ABV21586.1|  fatty acid desaturase                                   142   8e-38   
gb|EMS60696.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    141   8e-38   
gb|AFP21683.1|  FAD2                                                    141   8e-38   
gb|AIA21655.1|  oleate desaturase                                       141   9e-38   
gb|AFK12582.1|  fad2-2                                                  140   9e-38   
gb|AFK12579.1|  fad2-2                                                  140   9e-38   
gb|AAK26633.1|AF343065_1  delta-12 fatty acid desaturase FAD2           141   1e-37   
ref|XP_006346654.1|  PREDICTED: omega-6 fatty acid desaturase, en...    141   1e-37   
gb|ADK70952.1|  fatty acid desaturase 2-1                               141   1e-37   
gb|ABR27357.1|  fatty acid desaturase 2                                 141   1e-37   
gb|AAT02411.1|  delta-12 oleate desaturase                              141   1e-37   
ref|XP_008243688.1|  PREDICTED: omega-6 fatty acid desaturase, en...    138   2e-37   
gb|AGX28127.1|  omega-6 fatty acid desaturase                           141   2e-37   
gb|AIA21666.1|  oleate desaturase                                       141   2e-37   
gb|ACR15954.1|  fatty acid desaturase 2                                 140   2e-37   
ref|XP_004252384.1|  PREDICTED: omega-6 fatty acid desaturase, en...    140   3e-37   
gb|AFK12576.1|  fad2-2                                                  139   5e-37   
gb|AGX28132.1|  omega-6 fatty acid desaturase FAD2-2A                   139   8e-37   
gb|ADL09404.1|  fatty acid desaturase                                   139   9e-37   
emb|CAI48076.2|  omega-6 desaturase                                     137   9e-37   
ref|XP_009631509.1|  PREDICTED: omega-6 fatty acid desaturase, en...    139   9e-37   
gb|AGX28133.1|  omega-6 fatty acid desaturase FAD2-2B                   138   2e-36   
gb|ACF17571.1|  mutant bifunctional oleate 12-hydroxylase:desaturase    137   2e-36   
gb|ACQ42234.1|  bifunctional oleate 12-hydroxylase:desaturase           138   2e-36   
gb|AAC32755.1|  bifunctional oleate 12-hydroxylase:desaturase           138   2e-36   
gb|AGT36606.1|  oleate 12-hydroxylase/desaturase                        138   2e-36   
gb|AIA21653.1|  oleate desaturase                                       137   2e-36   
ref|XP_006346615.1|  PREDICTED: omega-6 fatty acid desaturase, en...    137   4e-36   
ref|XP_006365823.1|  PREDICTED: omega-6 fatty acid desaturase, en...    137   5e-36   
gb|EMT15024.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    136   7e-36   
gb|AGT36605.1|  oleate 12-hydroxylase/desaturase                        136   1e-35   
ref|NP_001141122.1|  uncharacterized protein LOC100273207               135   1e-35   
ref|XP_006365802.1|  PREDICTED: omega-6 fatty acid desaturase, en...    135   1e-35   
gb|AGN95845.1|  fatty acid delta12-hydroxylase FAH12-1                  135   2e-35   
gb|AIA58645.1|  omega-6 desaturase                                      130   2e-35   
ref|XP_006365800.1|  PREDICTED: omega-6 fatty acid desaturase, en...    135   2e-35   
ref|XP_010314673.1|  PREDICTED: omega-6 fatty acid desaturase, en...    135   3e-35   
ref|XP_004252862.1|  PREDICTED: omega-6 fatty acid desaturase, en...    134   3e-35   
gb|ABF70313.1|  delta-12 desaturase                                     132   4e-35   
gb|ABF70311.1|  delta-12 desaturase                                     131   6e-35   
gb|ABF70319.1|  delta-12 desaturase                                     131   7e-35   
gb|ABF70320.1|  delta-12 desaturase                                     131   7e-35   
gb|ABF70329.1|  delta-12 desaturase                                     131   7e-35   
gb|AFN53643.1|  omega-6 desaturase                                      133   7e-35   
ref|XP_003637225.1|  Omega-6 fatty acid desaturase                      133   8e-35   
gb|ABF70303.1|  delta-12 desaturase                                     131   9e-35   
ref|XP_004252861.2|  PREDICTED: omega-6 fatty acid desaturase, en...    135   9e-35   
gb|ABF70318.1|  delta-12 desaturase                                     131   9e-35   
gb|ABF70317.1|  delta-12 desaturase                                     131   1e-34   
gb|EMT22277.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    134   1e-34   
ref|XP_010314672.1|  PREDICTED: omega-6 fatty acid desaturase, en...    135   1e-34   
dbj|BAK04289.1|  predicted protein                                      132   2e-34   
gb|EMS45906.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    133   2e-34   
gb|ABF70324.1|  delta-12 desaturase                                     129   3e-34   
gb|ABF70315.1|  delta-12 desaturase                                     128   1e-33   
gb|ABF70302.1|  delta-12 desaturase                                     127   2e-33   
gb|AAL37475.1|AF329635_1  delta-12 fatty acid desaturase                125   3e-33   
gb|ABF70289.1|  delta-12 desaturase                                     127   3e-33   
gb|ABF70307.1|  delta-12 desaturase                                     127   3e-33   
gb|ABF70290.1|  delta-12 desaturase                                     127   3e-33   
gb|ABQ01458.1|  oleate 12-hydroxylase                                   129   5e-33   
gb|AAO37751.1|  fatty acid conjugase                                    129   6e-33   
gb|AAO38036.1|  delta12-fatty acid acetylenase                          127   7e-33   
gb|ABF70328.1|  delta-12 desaturase                                     125   9e-33   
gb|AFN53645.1|  omega-6 desaturase                                      128   1e-32   
gb|ABF70291.1|  delta-12 desaturase                                     125   1e-32   
gb|ABF70288.1|  delta-12 desaturase                                     125   2e-32   
gb|AFN53648.1|  omega-6 desaturase                                      126   3e-32   
gb|ABF70292.1|  delta-12 desaturase                                     124   4e-32   
gb|ABF70327.1|  delta-12 desaturase                                     124   4e-32   
gb|AAF05915.1|  delta-12 oleic acid desaturase-like protein             126   4e-32   
gb|ABF70306.1|  delta-12 desaturase                                     124   4e-32   
gb|ABF70296.1|  delta-12 desaturase                                     123   7e-32   
gb|ABF70314.1|  delta-12 desaturase                                     123   8e-32   
gb|ABF70298.1|  delta-12 desaturase                                     123   1e-31   
gb|ABF70287.1|  delta-12 desaturase                                     123   1e-31   
gb|ABF70295.1|  delta-12 desaturase                                     123   1e-31   
gb|ABF70293.1|  delta-12 desaturase                                     123   1e-31   
ref|XP_009594208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    124   2e-31   
gb|AAB80697.1|  fungal elicitor-induced protein                         124   3e-31   
gb|ABF70309.1|  delta-12 desaturase                                     122   3e-31   
gb|KJB83457.1|  hypothetical protein B456_013G248700                    122   4e-31   
ref|XP_009781384.1|  PREDICTED: omega-6 fatty acid desaturase, en...    123   6e-31   
gb|ABF70322.1|  delta-12 desaturase                                     120   8e-31   
gb|ABF70305.1|  delta-12 desaturase                                     120   9e-31   
gb|AAF05916.1|AF182521_1  delta-12 oleic acid desaturase-like pro...    123   9e-31   
gb|AAK30206.1|AF349965_1  fatty acid desaturase/hydroxylase             122   1e-30   
gb|AGC65505.1|  FAD2-8 protein                                          122   1e-30   
gb|ABF70323.1|  delta-12 desaturase                                     120   1e-30   
gb|AAG23924.1|AF239828_1  ELI7.2                                        122   2e-30   
gb|AGC65506.1|  FAD2-9 protein                                          122   2e-30   
gb|AGX28130.1|  omega-6 fatty acid desaturase FAD2-1A                   121   2e-30   
gb|AGX28129.1|  delta12-FADS-like FADY                                  121   3e-30   
gb|ABC00771.1|  delta-12 fatty acid desaturase type 03                  121   3e-30   
gb|AGC65508.1|  FAD2-11 protein                                         121   3e-30   
gb|EEE67046.1|  hypothetical protein OsJ_23988                          120   3e-30   
gb|AAG23929.1|AF239833_1  ELI7.8                                        121   3e-30   
gb|AAO38031.1|  delta12-fatty acid acetylenase                          121   4e-30   
gb|ACH88346.1|  omega-6 fatty acid desaturase                           117   4e-30   
ref|NP_001059466.1|  Os07g0416900                                       121   4e-30   
gb|AAO38035.1|  delta12-fatty acid acetylenase                          120   4e-30   
gb|AAO38032.1|  delta12-fatty acid acetylenase                          120   6e-30   
gb|AAO38037.1|  delta12-fatty acid acetylenase                          119   6e-30   
gb|ABC59684.1|  delta-12 fatty acid acetylenase                         120   6e-30   
emb|CAB64256.1|  (8,11)-linoleoyl desaturase                            120   7e-30   
ref|XP_008449949.1|  PREDICTED: omega-6 fatty acid desaturase, en...    120   7e-30   
gb|AGX28131.1|  omega-6 fatty acid desaturase FAD2-1B                   120   8e-30   
gb|AAG23930.1|AF239834_1  ELI7.9                                        119   1e-29   
gb|AGX28137.1|  delta12-FADS-like FADY-A                                119   1e-29   
ref|XP_001757907.1|  predicted protein                                  119   1e-29   
gb|ABF70326.1|  delta-12 desaturase                                     117   2e-29   



>gb|AIC34705.1| omega-6 fatty acid desaturase [Rhus chinensis]
 gb|AIC34706.1| omega-6 fatty acid desaturase [Rhus chinensis]
Length=383

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+QLTLGWPLYL FNVSGRPY RFACHFDP+GPIYSDRERIQI+ISD GIF A YVLY
Sbjct  181  TLLVQLTLGWPLYLTFNVSGRPYDRFACHFDPHGPIYSDRERIQIYISDAGIFTAIYVLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A AKGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RVAMAKGLAWLVCIYGVPLLIVNGFLVLITYLQHTHP  277



>gb|AGO32050.1| microsomal oleate desaturase [Xanthoceras sorbifolium]
Length=383

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACHFDPYGPIYSDRER+QIF+SD GIFA TYVLY
Sbjct  181  TLVITLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSDRERLQIFVSDVGIFATTYVLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             +A AKGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  241  NIAIAKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHP  277



>ref|XP_004234773.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
 ref|XP_010317872.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
Length=384

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L++QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF+SD GIFA  YVLY 
Sbjct  182  LVVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIFVSDAGIFAVLYVLYT  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP
Sbjct  242  LVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHP  277



>ref|XP_006349589.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Solanum tuberosum]
Length=384

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L++QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF+SD GIFA  YVLY 
Sbjct  182  LVVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIFVSDAGIFAVLYVLYT  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP
Sbjct  242  LVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHP  277



>emb|CBI16458.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  312  TXRAEHFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIF  133
            T   E  TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD GIF
Sbjct  185  TGSLEPLTLVITLTLGWPLYLAFNVSGRPYNRFACHYDPYGPIYSDRERLQIYISDAGIF  244

Query  132  AATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             A+YVLY+L  AKGLAWVVC+YG+PLLIVN FLVLITYLQHTHP
Sbjct  245  TASYVLYRLILAKGLAWVVCMYGIPLLIVNAFLVLITYLQHTHP  288



>ref|XP_009800247.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana sylvestris]
Length=384

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            LL+QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF+SD GIFA  + LY 
Sbjct  182  LLVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIFVSDAGIFAVLFGLYH  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP
Sbjct  242  LAAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHP  277



>ref|XP_002285640.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Vitis vinifera]
 emb|CAN79670.1| hypothetical protein VITISV_018075 [Vitis vinifera]
 gb|AEI60129.1| microsomal delta-12 oleate desaturase [Vitis labrusca]
Length=376

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD GIF A+YVLY
Sbjct  174  TLVITLTLGWPLYLAFNVSGRPYNRFACHYDPYGPIYSDRERLQIYISDAGIFTASYVLY  233

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKGLAWVVC+YG+PLLIVN FLVLITYLQHTHP
Sbjct  234  RLILAKGLAWVVCMYGIPLLIVNAFLVLITYLQHTHP  270



>gb|ADX60451.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
Length=227

 Score =   169 bits (428),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QI+ISD G+ A  Y L
Sbjct  24   LTLVITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYTDRERMQIYISDAGVLAVCYGL  83

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            + LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  84   FHLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  121



>gb|AAO37754.1| delta-12 oleate desaturase [Punica granatum]
Length=387

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL++ LTLGWPLYL  NVSGRPY RFACHFDPYGPIY+DRER+QI+ISD GI AATY L
Sbjct  184  MTLIVTLTLGWPLYLALNVSGRPYDRFACHFDPYGPIYTDRERLQIYISDVGIMAATYTL  243

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            YK+AAA+GLAW+VCVYGVPLLIVN FLV ITYLQHTHP
Sbjct  244  YKIAAARGLAWLVCVYGVPLLIVNAFLVTITYLQHTHP  281



>ref|XP_010520035.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010520036.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X2 [Tarenaya hassleriana]
Length=383

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL +QL LGWPLYLMFNVSGRPY RFACHFDPYGPIY+DRER+QI++SD GI A  Y LY
Sbjct  181  TLTVQLVLGWPLYLMFNVSGRPYDRFACHFDPYGPIYNDRERLQIYVSDAGILAVCYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LAAAKG+AW++CVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  RLAAAKGMAWLMCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|AAX47480.1| microsomal omega-6-desaturase [Caragana korshinskii]
Length=151

 Score =   166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL  NVSGRPY RFACHFDPYGPIYSDRER+QI++SD GI A  Y LY
Sbjct  40   TITITLTLGWPLYLALNVSGRPYERFACHFDPYGPIYSDRERLQIYVSDAGILAICYGLY  99

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L  AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  100  HLVMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  136



>emb|CDH92856.1| omega-6 fatty acid desaturase, partial [Sesamum radiatum]
Length=311

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL++ LTLGWPLYL+FNVSGRPY RFACHFDPYGPIY+DRER+QIFISD GI AA  VLY
Sbjct  181  TLVVTLTLGWPLYLLFNVSGRPYNRFACHFDPYGPIYNDRERLQIFISDAGIIAAVCVLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  241  RVALVKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHP  277



>gb|ADK47520.1| microsomal oleic acid desaturase [Wrightia tinctoria]
Length=383

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+ QLTLGWPLYLMFNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+FA  Y LY
Sbjct  181  TLVFQLTLGWPLYLMFNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVFAVAYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP
Sbjct  241  LLVAAKGLAWVFCVYGGPLLVVNGFLVLITYLQHTHP  277



>ref|XP_009592981.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
 ref|XP_009592982.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
Length=384

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            LL+QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF+SD GIFA  + LY 
Sbjct  182  LLVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIFVSDAGIFAVLFGLYH  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP
Sbjct  242  LVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHP  277



>ref|XP_002279239.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Vitis vinifera]
Length=382

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLTLGWPLYLMFNVSGR Y RFACHFDP+GPIYSDRER+QI+ISD G+ A TY LY
Sbjct  181  TLTIQLTLGWPLYLMFNVSGRRYSRFACHFDPHGPIYSDRERLQIYISDAGVLAITYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA +KGL WV+CVYG PLLIVNGFLVLITYLQHTHP
Sbjct  241  RLAVSKGLTWVLCVYGCPLLIVNGFLVLITYLQHTHP  277



>ref|XP_010520034.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X1 [Tarenaya hassleriana]
Length=437

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL +QL LGWPLYLMFNVSGRPY RFACHFDPYGPIY+DRER+QI++SD GI A  Y LY
Sbjct  235  TLTVQLVLGWPLYLMFNVSGRPYDRFACHFDPYGPIYNDRERLQIYVSDAGILAVCYGLY  294

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LAAAKG+AW++CVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  295  RLAAAKGMAWLMCVYGVPLLVVNGFLVLITFLQHTHP  331



>gb|ACE97863.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97864.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GLAWV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLAWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>emb|CDP10136.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL +QLTLGWPLYLMFNVSGRPY RFACH+DPYGPIY+DRER+QI++SD G+ +  Y L
Sbjct  255  LTLAVQLTLGWPLYLMFNVSGRPYDRFACHYDPYGPIYNDRERLQIYLSDVGVLSVFYGL  314

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP
Sbjct  315  YRLVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHP  352



>gb|ACE97856.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97855.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97845.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97846.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97867.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (421),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QIFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYNDRERVQIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97841.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97857.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (420),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QIFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVQIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|AGZ02022.1| microsomal omega-6-desaturase [Millettia pinnata]
Length=385

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L++ LTLGWPLYL FNVSGRPY RFA HFDPYGPIYSDRER+QI+ISD G+FA TY+LY
Sbjct  181  SLVVTLTLGWPLYLAFNVSGRPYDRFASHFDPYGPIYSDRERLQIYISDVGLFAVTYLLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            K+A AKG AW++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  KIALAKGFAWLLCVYGVPLLIVNGFLVLITYLQHTHP  277



>ref|XP_010557947.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Tarenaya hassleriana]
Length=383

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQL LGWPLYLMFNVSGRPY RFACHFDP GPIYSDRER+QI++SD GI A  Y LY
Sbjct  181  TLTIQLVLGWPLYLMFNVSGRPYERFACHFDPNGPIYSDRERLQIYVSDAGILAVCYALY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +++AAKGLAW++C YGVPLL+VNGFLVLITYLQHTHP
Sbjct  241  RISAAKGLAWMLCYYGVPLLVVNGFLVLITYLQHTHP  277



>gb|AFK34956.1| unknown [Lotus japonicus]
Length=384

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL FNVSGRPY RFACHFDPYGPIYSDRER+QI+ISD G+ A  + LY
Sbjct  181  TITITLTLGWPLYLTFNVSGRPYERFACHFDPYGPIYSDRERLQIYISDVGVLAVCFGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLITYLQHTHP
Sbjct  241  HLAVAKGLAWVVCVYGVPLLVVNGFLVLITYLQHTHP  277



>gb|ACE97860.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   166 bits (419),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++I+ISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIYISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GLAWV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVARGLAWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>ref|XP_011080227.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Sesamum indicum]
 gb|AAF80560.1|AF192486_1 omega-6 fatty acid desaturase [Sesamum indicum]
 gb|AAX11454.1| microsomal oleic acid desaturase [Sesamum indicum]
Length=383

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL++ LTLGWPLYL+FNVSGRPY RFACHFDPYGPIY+DRER+QIFISD GI AA  VLY
Sbjct  181  TLVVTLTLGWPLYLLFNVSGRPYNRFACHFDPYGPIYNDRERLQIFISDAGIIAAVCVLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  241  RVALVKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHP  277



>gb|AEI60128.1| microsomal delta-12 oleate desaturase [Vitis labrusca]
Length=382

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLTLGWPLYLMFNVSGR Y RFACH+DP+GPIYSDRER+QI+ISD G+ A TY LY
Sbjct  181  TLTIQLTLGWPLYLMFNVSGRRYSRFACHYDPHGPIYSDRERLQIYISDAGVLAITYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA +KGL WV+CVYG PLLIVNGFLVLITYLQHTHP
Sbjct  241  RLAVSKGLTWVLCVYGCPLLIVNGFLVLITYLQHTHP  277



>gb|ABZ05022.1| delta-12 fatty acid desaturase [Davidia involucrata]
Length=382

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACH++PYGPIY+DRER+QI++SD G+ AATY+LY
Sbjct  180  TLVITLTLGWPLYLAFNVSGRPYDRFACHYNPYGPIYNDRERLQIYLSDAGVIAATYLLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A AKGLAW++C YGVPLLIVNGFLVLITYLQHTHP
Sbjct  240  RVAMAKGLAWLICTYGVPLLIVNGFLVLITYLQHTHP  276



>gb|ACE97859.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++I+ISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIYISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97842.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97858.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97871.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97875.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97847.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A T+ LY
Sbjct  57   TITITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYNDRERVEIFISDAGVLAVTHGLY  116

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA A+GLAWV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  117  RLAVAEGLAWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>ref|XP_004136572.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cucumis sativus]
 gb|KGN59307.1| hypothetical protein Csa_3G808360 [Cucumis sativus]
Length=382

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL IQL LGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QIFISD G+   TY L
Sbjct  180  LTLTIQLVLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERLQIFISDAGLLTVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            Y+L  AKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH
Sbjct  240  YRLVLAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  276



>gb|AAS19533.1| omega-6 fatty acid desaturase [Cucurbita pepo]
Length=383

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I L LGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QIFISD G+ A +Y LY
Sbjct  181  TLTITLVLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERLQIFISDAGLLAVSYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RLVLAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  277



>gb|ACE97854.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97861.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97862.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97866.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97869.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97870.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97872.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97873.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97874.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97876.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97853.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97865.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>gb|ACE97868.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>ref|XP_010087393.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXB29003.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=384

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QIF+SD GIF  T+VLY+LAAAKGL
Sbjct  190  GWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIFVSDAGIFVTTFVLYQLAAAKGL  249

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW+VCVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  250  AWIVCVYGVPLLIVNGFLVLITYLQHTHP  278



>ref|XP_008350272.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=318

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF+SD G+ A  Y LY
Sbjct  148  TLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIFVSDAGVLAVFYGLY  207

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+C YG PL++VNGFLVLITYLQHTHP
Sbjct  208  RLAVAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHP  244



>gb|AIZ94608.1| fatty acid desaturase 4, partial [Perilla frutescens]
Length=294

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL++Q TLGWPLYLMFNVSGRPY RFACHFDP  PIYSDRER QIF+SD GI A  Y L
Sbjct  91   LTLIVQFTLGWPLYLMFNVSGRPYDRFACHFDPKSPIYSDRERAQIFLSDVGILAMLYGL  150

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            Y+L  AKGLAWV+CVYGVPLL+VNGFLVLITYLQHTH
Sbjct  151  YRLTVAKGLAWVLCVYGVPLLVVNGFLVLITYLQHTH  187



>ref|XP_011080226.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Sesamum indicum]
Length=465

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL++ LTLGWPLYL+FNVSGRPY RFACHFDPYGPIY+DRER+QIFISD GI AA  VLY
Sbjct  263  TLVVTLTLGWPLYLLFNVSGRPYNRFACHFDPYGPIYNDRERLQIFISDAGIIAAVCVLY  322

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  323  RVALVKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHP  359



>gb|ACE97848.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97851.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97852.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY LY
Sbjct  57   TITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGLY  116

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  117  RLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>emb|CAD24671.1| delta 12-acyl-lipid-desaturase [Punica granatum]
Length=387

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL++ LTLGWPLYL  NVSG PY RFACHFDPYGPIY+DRER+QI+ISD GI AATY L
Sbjct  184  MTLIVTLTLGWPLYLALNVSGWPYDRFACHFDPYGPIYTDRERLQIYISDVGIMAATYTL  243

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            YK+AAA+GLAW+VCVYGVPLLIVN FLV ITYLQHTHP
Sbjct  244  YKIAAARGLAWLVCVYGVPLLIVNAFLVTITYLQHTHP  281



>ref|XP_008387264.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=338

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF+SD G+ A  Y L
Sbjct  167  LTLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIFVSDAGVLAVFYGL  226

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGLAWV+C YG PL++VNGFLVLITYLQHTHP
Sbjct  227  YRLAVAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHP  264



>emb|CDP17521.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I LTLGWPLYL FN SGRPY RFACH+DPYGPIY+DRER+QI+ISD G+ A +Y+LY
Sbjct  181  TLTITLTLGWPLYLAFNASGRPYDRFACHYDPYGPIYNDRERLQIYISDVGVIATSYLLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A AKGLAW++C+YGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RVAMAKGLAWLICIYGVPLLIVNGFLVLITYLQHTHP  277



>gb|ACE97839.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97840.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97844.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97850.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++I+ISD G+ A TY L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIYISDAGVLAVTYGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVARGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>ref|XP_007014826.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 ref|XP_007014827.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 ref|XP_007014828.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 gb|EOY32445.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 gb|EOY32446.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 gb|EOY32447.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
Length=377

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGR Y RFACHFDP+GPIYS+R+R+QI+ISD GI AATYVLY
Sbjct  175  SLAITLTLGWPLYLAFNVSGRNYDRFACHFDPHGPIYSNRDRLQIYISDAGILAATYVLY  234

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             +AA KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP
Sbjct  235  NIAATKGLAWLVCIYGVPLLIVNGFLVLITYLQHTHP  271



>emb|CAN71892.1| hypothetical protein VITISV_040865 [Vitis vinifera]
Length=382

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLTLGWPLYLMFNVSGR Y RFACH DP+GPIYSDRER+QI+ISD G+ A TY LY
Sbjct  181  TLTIQLTLGWPLYLMFNVSGRRYSRFACHXDPHGPIYSDRERLQIYISDAGVLAITYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA +KGL WV+CVYG PLLIVNGFLVLITYLQHTHP
Sbjct  241  RLAVSKGLTWVLCVYGCPLLIVNGFLVLITYLQHTHP  277



>ref|XP_007028985.1| Microsomal oleic acid desaturase [Theobroma cacao]
 gb|EOY09487.1| Microsomal oleic acid desaturase [Theobroma cacao]
Length=383

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLT+GWPLYL FNVSGRPY RFACH+DPYGPIY+ RER+QI+ISD G+ A TY LY
Sbjct  181  TLTIQLTIGWPLYLAFNVSGRPYERFACHYDPYGPIYNYRERLQIYISDAGVLAITYCLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVCVYGVPLL+VN FLV+ITYLQHTHP
Sbjct  241  RLALAKGLAWVVCVYGVPLLVVNAFLVMITYLQHTHP  277



>gb|ACE97843.1| fatty acid desaturase, partial [Populus tremula]
 gb|ACE97849.1| fatty acid desaturase, partial [Populus tremula]
Length=197

 Score =   163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A T+ L
Sbjct  56   LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTHGL  115

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  116  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  153



>ref|XP_007162321.1| hypothetical protein PHAVU_001G142100g [Phaseolus vulgaris]
 gb|ADO17551.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
 gb|AGV54471.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
 gb|ESW34315.1| hypothetical protein PHAVU_001G142100g [Phaseolus vulgaris]
Length=383

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QI+ISD G+ A  Y L+
Sbjct  181  TLVITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYTDRERMQIYISDAGVLAVCYGLF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  HLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|ABI96919.1| delta-12 fatty acid desaturase [Triadica sebifera]
Length=381

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER +I+ISD G+ A TY LY
Sbjct  181  TLVITLTLGWPLYLAFNVSGRSYDRFACHYDPYGPIYTDRERTEIYISDAGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LAAAKGLAWV+C+YGVPLL+VN FLV+ITYLQHTHP
Sbjct  241  RLAAAKGLAWVICIYGVPLLVVNAFLVMITYLQHTHP  277



>ref|XP_008443062.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Cucumis melo]
Length=492

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL IQL LGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QIFISD G+ A  Y L
Sbjct  290  LTLTIQLVLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIFISDAGLLAVAYGL  349

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            Y+L  AKG AWVVCVYGVPLLIVNGFLVLITYLQHTH
Sbjct  350  YRLVLAKGFAWVVCVYGVPLLIVNGFLVLITYLQHTH  386



>gb|ADB93805.1| delta-12-fatty acid desaturase [Jatropha curcas]
Length=383

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
            FTL I L LGWPLYL FNVSGR Y RFACHFDPYGPIY+DRER +IFISD G+ AATY L
Sbjct  180  FTLTITLALGWPLYLAFNVSGRHYDRFACHFDPYGPIYNDRERTEIFISDAGVLAATYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKG AWV+CVYGVPLL+VN FLV+ITYLQHTHP
Sbjct  240  YRLALAKGFAWVICVYGVPLLVVNAFLVMITYLQHTHP  277



>ref|XP_002530704.1| omega-6 desaturase, endoplasmic reticulum [Ricinus communis]
 gb|ABK59093.1| oleate desaturase [Ricinus communis]
 gb|EEF31658.1| omega-6 desaturase, endoplasmic reticulum [Ricinus communis]
Length=383

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ + LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRERI+IFISD G+ A T+ LY
Sbjct  181  TIAVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERIEIFISDAGVLAVTFGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVCVYGVPLL+VN FLVLIT+LQHTHP
Sbjct  241  QLAIAKGLAWVVCVYGVPLLVVNSFLVLITFLQHTHP  277



>gb|AHG95978.1| endoplasmic reticulum 18:1 desaturase [Malus baccata]
Length=382

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF+SD G+ A  Y LY
Sbjct  181  TLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIFVSDAGVLAVVYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+C YG PL++VNGFLVLITYLQHTHP
Sbjct  241  RLAVAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHP  277



>gb|AIN36675.1| delta 12 desaturase [Cannabis sativa]
Length=387

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L + LTLGWPLYL FNVSGRPY RFACH+DPYGPIYS+RER+QIFISD GIF AT+ LY
Sbjct  184  SLFVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSNRERLQIFISDIGIFIATFALY  243

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L +AKGL WVV VYGVPLLIVNGFLVLITYLQHTHP
Sbjct  244  HLVSAKGLGWVVLVYGVPLLIVNGFLVLITYLQHTHP  280



>gb|ABP65296.1| omega-6 fatty desaturase [Caragana korshinskii]
Length=350

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL  NVSGRPY RFACHFDPYGPIYSDRER+QI++SD GI A  Y LY
Sbjct  135  TITITLTLGWPLYLALNVSGRPYERFACHFDPYGPIYSDRERLQIYVSDAGILAICYGLY  194

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L  AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  195  HLVMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  231



>gb|AAY87459.1| omega-6 fatty acid desaturase [Hevea brasiliensis]
Length=383

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I ISD G+ A TY L
Sbjct  180  LTLIITLTLGWPLYLAFNVSGRPYNRFACHYDPYGPIYTDRERTEICISDAGVLAVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y LA AKGLAWVVCVYGVPLL+VN FLV+ITYLQHTHP
Sbjct  240  YSLAVAKGLAWVVCVYGVPLLVVNAFLVMITYLQHTHP  277



>ref|NP_001238358.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine max]
 sp|P48631.1|FD6E2_SOYBN RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Glycine max]
 gb|AAB00860.1| microsomal omega-6 desaturase [Glycine max]
Length=383

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL + LTLGWPLYL  NVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+ A  Y L
Sbjct  180  LTLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVVYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  240  FRLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|EYU46325.1| hypothetical protein MIMGU_mgv1a008048mg [Erythranthe guttata]
Length=386

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDPYGPIY++RER+QIF+SD G+ A   +LY
Sbjct  184  TLFVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYNNRERLQIFVSDVGVLAVLCLLY  243

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            K+A AKGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  244  KVAMAKGLAWIVCVYGVPLLIVNGFLVLITFLQHTHP  280



>ref|XP_006604385.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Glycine max]
 gb|KHN26385.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=383

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+ A  Y L+
Sbjct  181  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVCYGLF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  CLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|AEQ28964.1| omega-6 desaturase [Linum grandiflorum]
Length=385

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I++SD GIF  +Y+LY
Sbjct  183  TLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIYLSDAGIFTVSYILY  242

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L   KGLAWVVC+YGVPLLIVNGFLVLIT+LQHTHP
Sbjct  243  RLVLTKGLAWVVCIYGVPLLIVNGFLVLITFLQHTHP  279



>gb|ACU23285.1| unknown [Glycine max]
Length=383

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+ A  Y L+
Sbjct  181  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVCYGLF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  CLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|KHN07428.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=383

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL  NVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+ A  Y L+
Sbjct  181  TLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVCYGLF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  RLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>dbj|BAD89862.1| microsomal omega-6 fatty acid desaturase [Glycine max]
Length=383

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL  NVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+ A  Y L+
Sbjct  181  TLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVCYGLF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  RLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|AFJ53124.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=303

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  145  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  204

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  205  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  241



>ref|XP_011004831.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Populus euphratica]
Length=387

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD GI A TY L
Sbjct  180  LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGILAVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  240  YRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  277



>ref|XP_008380133.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Malus domestica]
 ref|XP_008380134.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Malus domestica]
Length=382

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF+SD G+ A  Y LY
Sbjct  181  TLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIFVSDAGVLAVFYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+C YG PL++VNGFLVLITYLQHTHP
Sbjct  241  RLAVAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHP  277



>gb|AFJ53125.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=308

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  146  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  205

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  206  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  242



>gb|AFJ53119.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=310

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  148  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  207

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  208  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  244



>gb|AFJ53126.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=310

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  145  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  204

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  205  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  241



>gb|AFJ53123.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=317

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  156  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  215

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  216  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  252



>gb|AFJ53122.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=314

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  154  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  213

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  214  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  250



>gb|AFN53642.1| omega-6 desaturase [Linum usitatissimum]
Length=508

 Score =   169 bits (427),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ L
Sbjct  173  LTLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFAL  232

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            YKLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  233  YKLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  270



>gb|ABA41034.1| delta12-fatty acid desaturase [Jatropha curcas]
 gb|KDP24621.1| hypothetical protein JCGZ_25537 [Jatropha curcas]
Length=383

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
            FTL I L LGWPLYL FNVSGR Y RFACHFDPYGPIY+DRER +IFISD G+ A TY L
Sbjct  180  FTLTITLALGWPLYLAFNVSGRHYDRFACHFDPYGPIYNDRERTEIFISDAGVLAVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKG AWV+CVYGVPLL+VN FLV+ITYLQHTHP
Sbjct  240  YRLALAKGFAWVICVYGVPLLVVNAFLVMITYLQHTHP  277



>gb|AFJ53127.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=315

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  145  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  204

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  205  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  241



>gb|AFJ53121.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=332

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  166  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  225

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  226  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  262



>ref|XP_004228665.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
 ref|XP_004228667.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
Length=383

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIY++RER+QIF+SD G+  A Y+LY
Sbjct  181  TLTVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIFLSDAGVLGACYLLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VC+YGVPLL+VNGFLVLITYLQHTHP
Sbjct  241  RVALVKGLAWLVCIYGVPLLVVNGFLVLITYLQHTHP  277



>gb|AFJ53120.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=327

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  151  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  210

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  211  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  247



>gb|AFJ53118.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=339

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  170  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  229

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  230  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  266



>ref|XP_010257471.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Nelumbo nucifera]
Length=382

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYS+RERIQI+ISD GI A TY L+
Sbjct  180  TLAITLTLGWPLYLTFNVSGRHYDRFACHYDPYGPIYSNRERIQIYISDAGILAVTYGLF  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            +L AAKGLAWVVCVYGVPLLIVN FLVLITYLQHTH
Sbjct  240  RLVAAKGLAWVVCVYGVPLLIVNAFLVLITYLQHTH  275



>ref|XP_010044976.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Eucalyptus grandis]
 gb|KCW87115.1| hypothetical protein EUGRSUZ_B03641 [Eucalyptus grandis]
Length=380

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             +L + LTLGWPLYL FNVSGRPY RF CH+DPYGPIYSDRER+QIF+SD GI AATY L
Sbjct  177  LSLAVTLTLGWPLYLAFNVSGRPYDRFTCHYDPYGPIYSDRERLQIFVSDAGIMAATYGL  236

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            Y++AAAKGLAW+VC+YGVPLLIVN FLV IT+LQHTH
Sbjct  237  YRVAAAKGLAWLVCMYGVPLLIVNAFLVTITFLQHTH  273



>ref|XP_004493583.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cicer arietinum]
Length=384

 Score =   166 bits (419),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL  NVSGRPY RFACHF+PYGPIYSDRER+QI++SD GI A  Y L
Sbjct  181  LTITITLTLGWPLYLALNVSGRPYDRFACHFNPYGPIYSDRERLQIYVSDAGILAVCYGL  240

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  YLLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  278



>gb|AGJ01133.1| fatty acid desaturase 2-1 [Linum usitatissimum]
Length=382

 Score =   166 bits (419),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF+SD GI A ++ LY
Sbjct  180  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFLSDAGILAVSFALY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  240  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  276



>ref|XP_002309307.2| hypothetical protein POPTR_0006s20640g [Populus trichocarpa]
 gb|EEE92830.2| hypothetical protein POPTR_0006s20640g [Populus trichocarpa]
Length=462

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IFISD GI A TY L
Sbjct  254  LTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGILAVTYGL  313

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  314  YRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  351



>ref|XP_009369579.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Pyrus x bretschneideri]
 ref|XP_009369586.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Pyrus x bretschneideri]
Length=382

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF+SD G+ A    LY
Sbjct  181  TLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIFVSDAGVLAVFCGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LAAAKGLAWV+C YG PL++VNGFLVLITYLQHTHP
Sbjct  241  RLAAAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHP  277



>emb|CAA63432.1| D12 oleate desaturase [Solanum commersonii]
Length=383

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             +L I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY++RER+QIFISD G+    Y+L
Sbjct  180  LSLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIFISDAGVLGVCYLL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y++A  KGLAW+VCVYGVPLL+VNGFLVLITYLQHTHP
Sbjct  240  YRIALVKGLAWLVCVYGVPLLVVNGFLVLITYLQHTHP  277



>gb|ABP49577.1| oleate desaturase [Caragana korshinskii]
Length=383

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + I LTLGWPLYL  NVSGRPY RFACHFDPYGPIYSDRER+QI++SD GI A  Y LY 
Sbjct  182  ITITLTLGWPLYLALNVSGRPYERFACHFDPYGPIYSDRERLQIYVSDAGILAVCYGLYH  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L  AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  242  LVMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>ref|XP_010058087.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X2 [Eucalyptus grandis]
 gb|KCW90306.1| hypothetical protein EUGRSUZ_A02449 [Eucalyptus grandis]
Length=383

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYLMFNVSGRPY RFA H+DPYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  181  TLTVTLTLGWPLYLMFNVSGRPYDRFASHYDPYGPIYTDRERLQIYISDAGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             LAAAKGLAWV+CVYG PLL+VN FLVLITYLQHTH
Sbjct  241  HLAAAKGLAWVMCVYGGPLLVVNAFLVLITYLQHTH  276



>gb|ACF49507.1| omega-6 desaturase [Linum usitatissimum]
Length=382

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  180  TLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  240  KLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  276



>gb|AEQ28965.1| omega-6 desaturase [Linum grandiflorum]
Length=383

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -2

Query  306  RAEHFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAA  127
            R    T L+ LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A 
Sbjct  176  RPSPHTWLVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAV  235

Query  126  TYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++ LYKLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  236  SFALYKLAIAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>ref|XP_006445919.1| hypothetical protein CICLE_v10015614mg [Citrus clementina]
 gb|ESR59159.1| hypothetical protein CICLE_v10015614mg [Citrus clementina]
Length=379

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+ISD GIFAATYVLY++A AKGL
Sbjct  185  GWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYISDAGIFAATYVLYRVAMAKGL  244

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  245  AWLICVYGVPLLIVNGFLVLITYLQHTHP  273



>gb|AGZ15438.1| FAD2 [Eucalyptus camaldulensis]
Length=389

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYLMFNVSGRPY RFA H+DPYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  181  TLTVTLTLGWPLYLMFNVSGRPYDRFASHYDPYGPIYTDRERLQIYISDAGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             LAAAKGLAWV+CVYG PLL+VN FLVLITYLQHTH
Sbjct  241  HLAAAKGLAWVLCVYGGPLLVVNAFLVLITYLQHTH  276



>ref|XP_006492662.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Citrus sinensis]
 ref|XP_006492663.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X3 [Citrus sinensis]
 gb|KDO56437.1| hypothetical protein CISIN_1g040843mg [Citrus sinensis]
Length=379

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+ISD GIFAATYVLY++A AKGL
Sbjct  185  GWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYISDAGIFAATYVLYRVAMAKGL  244

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  245  AWLICVYGVPLLIVNGFLVLITYLQHTHP  273



>gb|AAQ16653.1| delta-12 fatty acid desaturase 2 [Gossypium hirsutum]
 gb|AAQ16654.1| delta-12 fatty acid desaturase 2 [Gossypium hirsutum]
Length=384

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ IQLTLGWPLYL FNV+GRPY  FACH++PYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  181  TITIQLTLGWPLYLAFNVAGRPYEGFACHYNPYGPIYNDRERLQIYISDVGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  241  RLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>gb|AEK67593.1| omega-6 fatty acid desaturase [Citrus medica var. sarcodactylis]
Length=383

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+ISD GIFAATYVLY++A AKGL
Sbjct  189  GWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYISDAGIFAATYVLYRVAMAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  249  AWLICVYGVPLLIVNGFLVLITYLQHTHP  277



>ref|XP_006492661.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Citrus sinensis]
Length=391

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+ISD GIFAATYVLY++A AKGL
Sbjct  197  GWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYISDAGIFAATYVLYRVAMAKGL  256

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  257  AWLICVYGVPLLIVNGFLVLITYLQHTHP  285



>gb|AFN53713.1| omega-6 desaturase [Linum usitatissimum]
Length=769

 Score =   169 bits (427),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I++SD GIF   Y+LY
Sbjct  170  TLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIYLSDAGIFTVCYILY  229

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP
Sbjct  230  RLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHP  266



>gb|AEW43691.1| fatty acid desaturase 2 [Jatropha curcas]
 gb|KDP44415.1| hypothetical protein JCGZ_19430 [Jatropha curcas]
Length=387

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L   LT+GWPLYL FNVSGRPY RFACHFDP GPIYSDRER+QI+ISD GIFAATYVLY+
Sbjct  186  LAATLTVGWPLYLAFNVSGRPYNRFACHFDPSGPIYSDRERLQIYISDIGIFAATYVLYQ  245

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +A AKGLAW++ +YG+PLLIVN FLV ITYLQHTHP
Sbjct  246  IAMAKGLAWLISIYGIPLLIVNAFLVTITYLQHTHP  281



>gb|AIN52150.1| fatty acid desaturase-2 [Camellia oleifera]
Length=382

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWP YL FNVSGRPY RFACH+DPYGPIY++RER+QI+ISD GI   +YVL 
Sbjct  180  TLVITLTLGWPSYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIYISDVGIITNSYVLC  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  240  RLAFAKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHP  276



>gb|KJB46318.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46319.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46320.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46321.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
Length=384

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ IQLTLGWPLYL FNV+GRPY  FACH++PYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  181  TITIQLTLGWPLYLAFNVAGRPYEGFACHYNPYGPIYNDRERLQIYISDVGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  241  RLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>gb|ADP07951.1| microsomal omega-6 desaturase [Phaseolus lunatus]
Length=352

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL++ LT GWP+YL FNVSGRPY RFACH+DPYGPIY+D ERIQI+ISD G+ A +Y L+
Sbjct  150  TLVVTLTPGWPMYLAFNVSGRPYDRFACHYDPYGPIYTDSERIQIYISDAGVLAVSYGLF  209

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  210  HLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  246



>gb|KHG25037.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Gossypium arboreum]
Length=392

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ IQLTLGWPLYL FNV+GRPY  FACH++PYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  189  TVTIQLTLGWPLYLAFNVAGRPYEGFACHYNPYGPIYNDRERLQIYISDVGVLAVTYGLY  248

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  249  RLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHP  285



>ref|XP_010058070.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Eucalyptus grandis]
 ref|XP_010058078.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Eucalyptus grandis]
Length=413

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYLMFNVSGRPY RFA H+DPYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  211  TLTVTLTLGWPLYLMFNVSGRPYDRFASHYDPYGPIYTDRERLQIYISDAGVLAVTYGLY  270

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             LAAAKGLAWV+CVYG PLL+VN FLVLITYLQHTH
Sbjct  271  HLAAAKGLAWVMCVYGGPLLVVNAFLVLITYLQHTH  306



>gb|AEW43690.1| fatty acid desaturase 2 [Jatropha curcas]
Length=383

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
            FTL I L LGWPLYL FNVSGR Y RFACHFDPYGPIY+DRER +IFISD G+ A TY L
Sbjct  180  FTLTITLALGWPLYLAFNVSGRHYDRFACHFDPYGPIYNDRERTEIFISDAGVLAVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA AKG AWV+CVYGVPLL+V+ FLV+ITYLQHTHP
Sbjct  240  YRLALAKGFAWVICVYGVPLLVVSAFLVMITYLQHTHP  277



>ref|XP_006354202.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum tuberosum]
Length=383

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             +L I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY++RER+QIF+SD G+    Y+L
Sbjct  180  LSLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIFVSDAGVLGVCYLL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y++A  KGLAW+VC+YGVPLL+VNGFLVLITYLQHTHP
Sbjct  240  YRVALVKGLAWLVCIYGVPLLVVNGFLVLITYLQHTHP  277



>emb|CAN73788.1| hypothetical protein VITISV_002517 [Vitis vinifera]
Length=366

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD GIF A+YVLY+L  AKGL
Sbjct  182  GWPLYLAFNVSGRPYNRFACHYDPYGPIYSDRERLQIYISDAGIFTASYVLYRLILAKGL  241

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWVVC+YG+PLLIVN FLVLITYLQHTHP
Sbjct  242  AWVVCMYGIPLLIVNAFLVLITYLQHTHP  270



>ref|XP_009777156.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana sylvestris]
Length=383

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER+QIF+SD G+  A Y+LY
Sbjct  181  SLTITLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYNDRERLQIFLSDAGVLGAGYLLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RIALVKGLAWLVCMYGVPLLIVNGFLVLITYLQHTHP  277



>ref|XP_002297660.2| microsomal omega-6 desaturase family protein [Populus trichocarpa]
 gb|EEE82465.2| microsomal omega-6 desaturase family protein [Populus trichocarpa]
Length=382

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L++ L LGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD GIFAAT+VLY
Sbjct  180  SLVVTLLLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDLGIFAATFVLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             +A ++GLA+++C+YGVPLLI NGFLV ITYLQHTHP
Sbjct  240  SIAVSRGLAFLICIYGVPLLIANGFLVTITYLQHTHP  276



>ref|XP_010105456.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXC04784.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=381

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL+FNVSGRPY RFACHFDPYGPIYSDRER+QI+ISDTGI A  Y LY+L   KGL
Sbjct  189  GWPLYLLFNVSGRPYDRFACHFDPYGPIYSDRERLQIYISDTGILAVCYGLYRLTMVKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  249  AWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|ADZ39687.1| microsomal delta-12 oleate desaturase [Olea europaea subsp. europaea]
Length=381

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACH+DP+GPIY+DRER+QI+ISD  + A +Y+LY
Sbjct  181  TLVITLTLGWPLYLAFNVSGRPYDRFACHYDPHGPIYNDRERLQIYISDVCVIATSYILY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A A+GL W+ CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RVALAQGLVWLTCVYGVPLLIVNGFLVLITYLQHTHP  277



>gb|ACJ84618.1| unknown [Medicago truncatula]
 gb|AFK49601.1| unknown [Medicago truncatula]
Length=411

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL  NVSGRPY RFACHF+P+GPIYSDRER+QI++SD GI A  + LY
Sbjct  203  TITITLTLGWPLYLALNVSGRPYDRFACHFNPHGPIYSDRERLQIYVSDAGILAVCFGLY  262

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  263  HLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  299



>gb|AAT72296.2| microsomal omega-6-desaturase [Nicotiana tabacum]
Length=383

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L + LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER+QIF+SD G+  A Y+LY
Sbjct  181  SLTVTLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYNDRERLQIFLSDAGVLGAGYLLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RIALVKGLAWLVCMYGVPLLIVNGFLVLITYLQHTHP  277



>ref|XP_009613562.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
Length=383

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L + LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER+QIF+SD G+  A Y+LY
Sbjct  181  SLTVTLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYNDRERLQIFLSDAGVLGAGYLLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RIALVKGLAWLVCMYGVPLLIVNGFLVLITYLQHTHP  277



>gb|EPS73825.1| delta-12 oleate desaturase, partial [Genlisea aurea]
Length=385

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L++QLT+GWPLYL FNVSGRPY RFACHFDPYGPIY+DRER+QIF+SD GI AA ++LY 
Sbjct  186  LVVQLTIGWPLYLAFNVSGRPYDRFACHFDPYGPIYNDRERLQIFVSDAGISAALFLLYH  245

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             A A+G AW++CVYGVPLL+VN FLV ITYLQHTHP
Sbjct  246  AARARGTAWLLCVYGVPLLVVNAFLVTITYLQHTHP  281



>gb|AAL61826.1| putative delta12 acid desaturase [Vernicia fordii]
Length=255

 Score =   160 bits (404),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+ISD G+ A T+ LY+LAAAKGL
Sbjct  152  GWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIYISDAGVLAVTFGLYRLAAAKGL  211

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  212  AWVICVYGVPLLIVNAFLVMITYLQHTHP  240



>gb|AGH32914.1| fatty acid desaturase [Camellia chekiangoleosa]
Length=383

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T++I LTLGWPLYLMFNVSGR Y RFACH+DPYGPIYSDRER+QI++SD G+   +YVL
Sbjct  180  LTVIITLTLGWPLYLMFNVSGRHYDRFACHYDPYGPIYSDRERLQIYLSDAGVLGVSYVL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+ A  KGLAWV+C+YG PLLIVNGFLVLIT+LQHTHP
Sbjct  240  YRFALVKGLAWVLCLYGGPLLIVNGFLVLITWLQHTHP  277



>gb|AFK31315.1| fatty acid desaturase [Camellia oleifera]
Length=383

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T++I LTLGWPLYLMFNVSGR Y RFACH+DPYGPIYSDRER+QI++SD G+   +YVL
Sbjct  180  LTVVITLTLGWPLYLMFNVSGRHYDRFACHYDPYGPIYSDRERLQIYLSDAGVLGVSYVL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+ A  KGLAWV+C+YG PLLIVNGFLVLIT+LQHTHP
Sbjct  240  YRFALVKGLAWVLCLYGGPLLIVNGFLVLITWLQHTHP  277



>gb|AGG38092.1| omega-6 fatty acid desaturase 2 endoplasmic reticulum isozyme 
2c [Musa AB Group]
Length=394

 Score =   163 bits (412),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL + LTLGWPLYL FNVSGR YPRFACH+DPYGPIYSDRER QIFISD G+ AA Y L
Sbjct  191  LTLAVTLTLGWPLYLAFNVSGRAYPRFACHYDPYGPIYSDRERAQIFISDAGLMAAVYAL  250

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y++AA+ G  WVV VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  251  YRIAASYGFWWVVRVYGVPLLIVNGWLVLITYLQHTHP  288



>ref|XP_003625259.1| Omega-6 fatty acid desaturase, endoplasmic reticulum [Medicago 
truncatula]
 gb|AES81477.1| microsomal omega-3 fatty acid desaturase [Medicago truncatula]
Length=434

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL  NVSGRPY RFACHF+P+GPIYSDRER+QI++SD GI A  + LY
Sbjct  232  TITITLTLGWPLYLALNVSGRPYDRFACHFNPHGPIYSDRERLQIYVSDAGILAVCFGLY  291

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  292  HLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  328



>ref|XP_009395096.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=392

 Score =   163 bits (412),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL + LTLGWPLYL FNVSGR YPRFACH+DPYGPIYSDRER QIFISD G+ AA Y L
Sbjct  189  LTLAVTLTLGWPLYLAFNVSGRAYPRFACHYDPYGPIYSDRERAQIFISDAGLMAAVYAL  248

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y++AA+ G  WVV VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  249  YRIAASYGFWWVVRVYGVPLLIVNGWLVLITYLQHTHP  286



>gb|AEZ00841.1| putative ER-oleate desaturase protein, partial [Elaeis guineensis]
Length=205

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+++ LTLGWPLYL FNVSGRPYPR ACH+DPY PIYSDRER QIFISDTG+ AA++ L
Sbjct  71   LTMVVTLTLGWPLYLAFNVSGRPYPRLACHYDPYSPIYSDRERAQIFISDTGVLAASFAL  130

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            Y+L  A G  WVV VYGVPLLIVNG+LV ITYLQHTH
Sbjct  131  YRLVGAFGFWWVVRVYGVPLLIVNGWLVTITYLQHTH  167



>gb|ABC41578.1| endoplasmic reticulum 18:1 desaturase [Populus tomentosa]
Length=388

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+ I LTLGWPLYL  NVSGRPY RFACH+DPYGPIY+DRER++IFISD G+ A TY L
Sbjct  180  LTITITLTLGWPLYLAVNVSGRPYDRFACHYDPYGPIYNDRERVEIFISDAGVLAVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP
Sbjct  240  YRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHP  277



>ref|XP_010277281.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
 ref|XP_010277282.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
Length=382

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYSDRERIQI+ISD G+ A TY L+
Sbjct  180  SLAITLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYSDRERIQIYISDAGVLAVTYGLF  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L A KGL+WV+C+YGVPLLIVNGFLV ITYLQHTHP
Sbjct  240  CLVAMKGLSWVICIYGVPLLIVNGFLVTITYLQHTHP  276



>ref|XP_009420049.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=376

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPYPRFACHFDPYGPIY+DRER QIFISD G+ A +Y LY
Sbjct  174  TLAVTLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIYTDRERAQIFISDAGLMATSYALY  233

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            + AA+ G  W+  VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  234  RFAASYGFWWLARVYGVPLLIVNGWLVLITYLQHTHP  270



>gb|AAL37484.1|AF331163_1 delta-12 fatty acid desaturase [Gossypium hirsutum]
Length=384

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ IQLTLGWPLYL FNV+GRPY   ACH++PYGPIY+DRER+QI+ISD G+ A TY LY
Sbjct  181  TVTIQLTLGWPLYLAFNVAGRPYEGLACHYNPYGPIYNDRERLQIYISDVGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  241  RLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>gb|AGN95842.1| fatty acid delta12-desturase FAD2-2 [Hiptage benghalensis]
Length=383

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACH+DPY PIY+ RER+QI+ISD G+ A TY LY
Sbjct  181  TLIITLTLGWPLYLAFNVSGRPYDRFACHYDPYSPIYTYRERLQIYISDVGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+CVYG PLL+VN FLV+ITYLQHTHP
Sbjct  241  RLAVAKGLAWVLCVYGGPLLVVNAFLVMITYLQHTHP  277



>gb|AAQ08982.1| delta-12 fatty acid desaturase [Olea europaea subsp. europaea]
Length=233

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL FNVSGRPY RFACH+DP+GPIY+DRER+QI+ISD  + A +Y+LY
Sbjct  134  TLVITLTLGWPLYLAFNVSGRPYDRFACHYDPHGPIYNDRERLQIYISDVCVIATSYILY  193

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHT  7
            ++A A+GL W+ CVYGVPLLIVNGFLVLITYLQHT
Sbjct  194  RVALAQGLVWLTCVYGVPLLIVNGFLVLITYLQHT  228



>gb|AGN95841.1| fatty acid delta12-desturase FAD2-1 [Hiptage benghalensis]
Length=383

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL+I LTLGWPLYL FNVSGRPY RFACH+DPY P+Y+DRER QI+ISD G+ A TY L
Sbjct  180  MTLIITLTLGWPLYLAFNVSGRPYDRFACHYDPYSPMYTDRERRQIYISDVGVLAVTYGL  239

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y+LA A+GLAWV+CVYG PLL+VN FLV ITYLQHTHP
Sbjct  240  YRLAVAEGLAWVICVYGGPLLVVNAFLVTITYLQHTHP  277



>gb|ABL86147.1| delta-12 oleic acid desaturase [Vernicia montana]
Length=383

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +IFISD G+ A T+ LY+LAAAKGL
Sbjct  189  GWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIFISDAGVLAVTFGLYRLAAAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  249  AWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>gb|KHN12315.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=386

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYS+RER+QI++SD GI A  + L
Sbjct  183  LTLAITLTLGWPLYLAFNVSGRSYERFACHYDPYGPIYSNRERLQIYVSDAGILAVCFGL  242

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            YK   AKGL WVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  243  YKAVLAKGLVWVVCVYGVPLLVVNGFLVLITFLQHTHP  280



>ref|XP_009383220.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=375

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL I LTLGWPLYL FNVSGRPYPRFACHFDPYGPI+SDRER Q+ ISD G+ A +YVL
Sbjct  172  LTLAITLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIFSDRERSQVVISDAGLMAVSYVL  231

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            Y++AA  G  W+V VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  232  YRIAAGYGFWWLVRVYGVPLLIVNGWLVLITYLQHTHP  269



>gb|AGG38093.1| omega-6 fatty acid desaturase 2 endoplasmic reticulum isozyme 
2d [Musa AB Group]
Length=413

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPYPRFACHFDPYGPIY+DRER QIFISD G+ A +Y LY
Sbjct  174  TLSVTLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIYTDRERTQIFISDAGLMATSYALY  233

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            + AA+ G  W+  VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  234  RFAASYGFWWLARVYGVPLLIVNGWLVLITYLQHTHP  270



>gb|AAW63040.1| microsomal delta-12 oleate desaturase [Olea europaea]
Length=381

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I LTLGWPLYL  NVSGRPY RFACH+DP+GPIY+DRER+QI+ISD  + A +Y+LY
Sbjct  181  TLVITLTLGWPLYLALNVSGRPYDRFACHYDPHGPIYNDRERLQIYISDVCVIATSYILY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A A+GL W+ CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  241  RVALAQGLVWLTCVYGVPLLIVNGFLVLITYLQHTHP  277



>gb|AAC24586.1| omega-6 fatty acid desaturase [Prunus armeniaca]
Length=346

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLTLGWPLYL FNVSGR Y  FACH+ PYGPI+SDRER+QIF+SD G+ A  Y LY
Sbjct  145  TLTIQLTLGWPLYLAFNVSGRHYEGFACHYHPYGPIFSDRERLQIFLSDAGVLAVVYGLY  204

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVC YG PL++VNGFLVLITYLQHTHP
Sbjct  205  RLAVAKGLAWVVCYYGGPLMVVNGFLVLITYLQHTHP  241



>gb|KJB15034.1| hypothetical protein B456_002G156600 [Gossypium raimondii]
Length=377

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            ++ IQLTLGWPLYL FNV+GRPY RFACH+DPYGPI+SDRER+QI+ISD G+ A  Y LY
Sbjct  175  SITIQLTLGWPLYLAFNVAGRPYDRFACHYDPYGPIFSDRERLQIYISDAGVLAVAYALY  234

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP
Sbjct  235  RLVLAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHP  271



>emb|CAA71199.1| omega-6 desaturase [Gossypium hirsutum]
Length=383

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            ++ IQLTLGWPLYL FNV+GRPY RFACH+DPYGPI+SDRER+QI+ISD G+ A  Y LY
Sbjct  181  SITIQLTLGWPLYLAFNVAGRPYDRFACHYDPYGPIFSDRERLQIYISDAGVLAVAYALY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L  AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP
Sbjct  241  RLVLAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHP  277



>gb|ABB05230.1| delta 12 desaturase [Linum usitatissimum]
Length=378

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I++SD GIF   Y+LY
Sbjct  176  TLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIYLSDAGIFTVCYILY  235

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP
Sbjct  236  RLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHP  272



>gb|AFJ53078.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53079.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53080.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53081.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53082.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53083.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53084.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53085.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53086.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53087.1| fatty acid desaturase 2 [Linum usitatissimum]
Length=378

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I++SD GIF   Y+LY
Sbjct  176  TLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIYLSDAGIFTVCYILY  235

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP
Sbjct  236  RLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHP  272



>gb|AGZ02023.1| microsomal omega-6-desaturase [Millettia pinnata]
Length=383

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QI+ISD G+ A T+ LY+LA AKGL
Sbjct  189  GWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERLQIYISDAGVLAVTFGLYRLALAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWVVCVYGVPLLIVN FLVLITYLQHTHP
Sbjct  249  AWVVCVYGVPLLIVNAFLVLITYLQHTHP  277



>ref|XP_008392076.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=382

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL +QLTLGWPLYL FNVSGRPY  FACH+ PYGPI+SDRER+QIF+SD G+ A  Y LY
Sbjct  181  TLAVQLTLGWPLYLAFNVSGRPYKGFACHYHPYGPIFSDRERLQIFVSDAGVLAVFYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+C YG PL++VNG+LVLITYLQHTHP
Sbjct  241  RLAVAKGLAWVICFYGGPLMVVNGYLVLITYLQHTHP  277



>gb|AEE69020.1| Fad2 [Vernicia fordii]
Length=383

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+ISD G+ A T+ LY+LAAAKGL
Sbjct  189  GWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIYISDAGVLAVTFGLYRLAAAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  249  AWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>gb|AFX61781.1| omega-6 fatty acid desaturase endoplasmic reticulum isozyme 2b 
[Musa AB Group]
Length=381

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+I L+LGWPLYL FNVSGR YPRFACHFDPYGPI+SDRER QIFISD GI AA+YVLY
Sbjct  179  TLVITLSLGWPLYLAFNVSGRAYPRFACHFDPYGPIFSDRERGQIFISDAGIVAASYVLY  238

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++AA+ G  W+V VYGVPLLIVN +LV+ITYLQHTHP
Sbjct  239  RVAASYGFWWLVRVYGVPLLIVNAWLVIITYLQHTHP  275



>gb|ACF49508.1| omega-6 desaturase [Linum usitatissimum]
Length=378

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I++SD GIF   Y+LY
Sbjct  176  TLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIYLSDAGIFTVCYILY  235

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP
Sbjct  236  RLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHP  272



>gb|AEE69021.1| Fad2 [Vernicia fordii]
Length=383

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+ISD G+ A T+ LY+LAAAKGL
Sbjct  189  GWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIYISDAGVLAVTFGLYRLAAAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  249  AWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>gb|AAN87573.1| delta 12 oleic acid desaturase FAD2 [Vernicia fordii]
Length=383

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+ISD G+ A T+ LY+LAAAKGL
Sbjct  189  GWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIYISDAGVLAVTFGLYRLAAAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYGVPLLIVN FLV+ITYLQHTHP
Sbjct  249  AWVICVYGVPLLIVNAFLVMITYLQHTHP  277



>ref|NP_001047927.1| Os02g0716500 [Oryza sativa Japonica Group]
 dbj|BAD09176.1| putative delta-12 oleate desaturase [Oryza sativa Japonica Group]
 dbj|BAD12887.1| putative delta-12 oleate desaturase [Oryza sativa Japonica Group]
 dbj|BAF09841.1| Os02g0716500 [Oryza sativa Japonica Group]
 gb|EAY87292.1| hypothetical protein OsI_08694 [Oryza sativa Indica Group]
 gb|EAZ24392.1| hypothetical protein OsJ_08147 [Oryza sativa Japonica Group]
 gb|ACN87220.1| delta-12 fatty acid desaturase [Oryza sativa Japonica Group]
Length=388

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + +QLTLGWPLYL FNVSGRPYPRFACHFDPYGPIY+DRER+QIFISD G+ +A   L+K
Sbjct  190  IFVQLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIYNDRERVQIFISDVGVVSAGLALFK  249

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L++A G  WVV VYGVPLLIVN +LVLITYLQHTHP
Sbjct  250  LSSAFGFWWVVRVYGVPLLIVNAWLVLITYLQHTHP  285



>ref|XP_006647793.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Oryza brachyantha]
Length=389

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL FNVSGRPYPRFACHFDPYGPIY+DRER QIFISD G+ AA   L+K
Sbjct  190  IVVQLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIYNDRERAQIFISDVGVVAAGAALFK  249

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L++A G  WVV VYGVPLLIVN +LVLITYLQHTHP
Sbjct  250  LSSAFGFWWVVRVYGVPLLIVNAWLVLITYLQHTHP  285



>ref|XP_009376128.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Pyrus x bretschneideri]
Length=382

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL +QLTLGWPLYL FNVSGRPY  FACH+ PYGPI+SDRER+QIF+SD G+ A  Y LY
Sbjct  181  TLAVQLTLGWPLYLAFNVSGRPYKGFACHYHPYGPIFSDRERLQIFVSDIGVLAVFYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+C YG PL++VNG+LVLITYLQHTHP
Sbjct  241  RLAVAKGLAWVICFYGGPLMVVNGYLVLITYLQHTHP  277



>ref|XP_006492862.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Citrus sinensis]
 ref|XP_006492863.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Citrus sinensis]
 gb|KDO70932.1| hypothetical protein CISIN_1g0167812mg [Citrus sinensis]
Length=383

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDPYGPIYSDRER+QIFISD GI A  Y LY
Sbjct  181  TLTVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSDRERLQIFISDAGILAMIYSLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L AAKGL +V C+YG PLL+VNGFLVLIT LQHTHP
Sbjct  241  CLVAAKGLVYVFCIYGGPLLVVNGFLVLITLLQHTHP  277



>ref|XP_010265904.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
Length=382

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL+FNVSGR Y RFACH+DPYGPIYS+RER+QI+ISD G+ A TY L++L AAKGL
Sbjct  188  GWPLYLLFNVSGRHYDRFACHYDPYGPIYSNRERMQIYISDAGVLAVTYGLFRLVAAKGL  247

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWVVCVYGVPLLIVNGFLV+ITYLQHTHP
Sbjct  248  AWVVCVYGVPLLIVNGFLVMITYLQHTHP  276



>ref|XP_011037927.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Populus euphratica]
Length=382

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L + + LGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD GIFAAT+VLY
Sbjct  180  SLGVTILLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDLGIFAATFVLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             +A ++GL +++C+YGVPLLI NGFLV ITYLQHTHP
Sbjct  240  SIAVSRGLGFLICIYGVPLLIANGFLVTITYLQHTHP  276



>ref|XP_008240937.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Prunus mume]
Length=382

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLTLGWPLYL FNVSGR Y  FACH+ PYGPI+SDRER+QIF+SD G+ A  Y LY
Sbjct  181  TLTIQLTLGWPLYLAFNVSGRHYEGFACHYHPYGPIFSDRERLQIFLSDAGVLAVVYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVC YG PL++VNGFLVLITYLQHTHP
Sbjct  241  RLAVAKGLAWVVCYYGGPLMVVNGFLVLITYLQHTHP  277



>ref|XP_007204396.1| hypothetical protein PRUPE_ppa007098mg [Prunus persica]
 gb|EMJ05595.1| hypothetical protein PRUPE_ppa007098mg [Prunus persica]
 gb|AGM53489.1| omega-6 fatty acid desaturase [Prunus persica]
Length=382

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL IQLTLGWPLYL FNVSGR Y  FACH+ PYGPI+SDRER+QIF+SD G+ A  Y LY
Sbjct  181  TLTIQLTLGWPLYLAFNVSGRHYEGFACHYHPYGPIFSDRERLQIFLSDAGVLAVVYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVC YG PL++VNGFLVLITYLQHTHP
Sbjct  241  RLAVAKGLAWVVCYYGGPLMVVNGFLVLITYLQHTHP  277



>ref|XP_011075145.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Sesamum indicum]
Length=383

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L++Q TLGWPLYL+FNVSGR Y RFACH+DP  PIYSDRER+QI ISD G+ A TY LY+
Sbjct  182  LIVQFTLGWPLYLLFNVSGRHYDRFACHYDPKSPIYSDRERLQILISDAGVLAVTYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LA AKGLAW+VCVYG PLL+VN FLVLITYLQHTHP
Sbjct  242  LAIAKGLAWLVCVYGGPLLVVNAFLVLITYLQHTHP  277



>ref|XP_007145683.1| hypothetical protein PHAVU_007G259500g [Phaseolus vulgaris]
 gb|ESW17677.1| hypothetical protein PHAVU_007G259500g [Phaseolus vulgaris]
Length=383

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYSDRER+QI++SD G+ A  Y LY
Sbjct  182  TLFITLTLGWPLYLAFNVSGRNYERFACHYDPYGPIYSDRERLQIYVSDVGVLAVCYGLY  241

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            KL  AKG  WVVCVYGVPL++VN  LVLIT+LQHTHP
Sbjct  242  KLVLAKGFLWVVCVYGVPLMVVNALLVLITFLQHTHP  278



>gb|ACA14461.1| oleate desaturase [Caragana korshinskii]
Length=283

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLLI LTLGWPLYL FNVSGRPY RFA HF P+ PIYSDRER+ I++SD  +FAATY+LY
Sbjct  178  TLLITLTLGWPLYLAFNVSGRPYDRFASHFHPHAPIYSDRERLLIYVSDAAVFAATYLLY  237

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KG+ WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  238  HIATIKGMVWVVCVYGVPLLIVNGFLVTITYLQHTH  273



>ref|XP_009417293.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=381

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I L+LGWPLYL FNVSGR YPRFACHFDPYGPIYSDRER QIFISD GI AA++VLY
Sbjct  179  TLAITLSLGWPLYLAFNVSGRAYPRFACHFDPYGPIYSDRERGQIFISDAGIVAASFVLY  238

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++AA+ G  W+V VYGVPLLIVN +LV+ITYLQHTHP
Sbjct  239  RVAASYGFWWLVRVYGVPLLIVNAWLVIITYLQHTHP  275



>gb|KHN35589.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=361

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             TL + LTLGWPLYL  NVSGRPY RFA H+DPYGPIYSDRER+QI+ISD G+ A  Y L
Sbjct  158  LTLAVTLTLGWPLYLALNVSGRPYDRFAYHYDPYGPIYSDRERLQIYISDAGVLAVCYGL  217

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++LA AKGLAWVVCVYGVPLL+VNGF VLIT+LQHT P
Sbjct  218  FRLAMAKGLAWVVCVYGVPLLVVNGFSVLITFLQHTQP  255



>ref|XP_010091397.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXB44402.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=381

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL+FNVSGRPY RFACHFDPYGPIY DRER+QI+ISDTGI A  Y LY+L   KGL
Sbjct  189  GWPLYLLFNVSGRPYDRFACHFDPYGPIYLDRERLQIYISDTGILAVCYGLYRLTMVKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  249  AWVLCVYGVPLLVVNGFLVLITFLQHTHP  277



>dbj|BAD89863.1| microsomal omega-6 fatty acid desaturase [Glycine max]
Length=337

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL  NVSGRPY RFA H+DPYGPIYSDRER+QI+ISD G+ A  Y L+
Sbjct  135  TLAVTLTLGWPLYLALNVSGRPYDRFAYHYDPYGPIYSDRERLQIYISDAGVLAVCYGLF  194

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWVVCVYGVPLL+VNGF VLIT+LQHT P
Sbjct  195  RLAMAKGLAWVVCVYGVPLLVVNGFSVLITFLQHTQP  231



>gb|ADP02395.1| delta-12 oleate desaturase [Gossypium hirsutum]
Length=385

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIYSDRER+Q++ISDTGIFA  YVLY
Sbjct  180  SLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYSDRERLQVYISDTGIFAVIYVLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            K+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH
Sbjct  240  KIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTH  275



>emb|CAA65744.1| omega-6 desaturase [Gossypium hirsutum]
Length=385

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIYSDRER+Q++ISDTGIFA  YVLY
Sbjct  180  SLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYSDRERLQVYISDTGIFAVIYVLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            K+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH
Sbjct  240  KIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTH  275



>ref|XP_009390650.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=386

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I LTLGWPLYL FNVSGR YPRFA HFDPYGPIYSDRER QIFISD G+ AA YVLY
Sbjct  184  TLAITLTLGWPLYLAFNVSGRCYPRFASHFDPYGPIYSDRERAQIFISDAGLMAALYVLY  243

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++AA  G  W+V VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  244  RVAACYGFWWLVRVYGVPLLIVNGWLVLITYLQHTHP  280



>ref|XP_011037928.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Populus euphratica]
Length=376

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L + L +GWPLYL FNVSGRPY RFACH+DPY PIYSDRER+Q++ISD GI AAT+VLY
Sbjct  174  SLAVSLLVGWPLYLTFNVSGRPYDRFACHYDPYSPIYSDRERLQVYISDLGILAATFVLY  233

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             +A ++GLA++VC+YGVPLLI NGFLV ITYLQHTHP
Sbjct  234  NIATSQGLAFLVCIYGVPLLIANGFLVTITYLQHTHP  270



>gb|AAW63041.1| microsomal delta-12 oleate desaturase [Olea europaea]
Length=383

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L+ QLTLGWPLYLMFNVSGR Y RFACH++P+ P+YSDRER QI ISD G+ A T  LY+
Sbjct  182  LVFQLTLGWPLYLMFNVSGRHYDRFACHYNPHSPMYSDRERAQILISDAGVLAVTCGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP
Sbjct  242  LTAAKGLAWVFCVYGGPLLVVNGFLVLITYLQHTHP  277



>dbj|BAC22091.1| delta-12 desaturase [Spinacia oleracea]
Length=382

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL++ LTLGWPLYL+FNVSGR Y RFACH+DP  PIYSDRER+QIFISD GI    + LY
Sbjct  180  TLVVTLTLGWPLYLLFNVSGRKYERFACHYDPSSPIYSDRERLQIFISDVGISIVAFGLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LAAAKG++WV+CVYG PLL+VNGFLVLIT+LQHTHP
Sbjct  240  HLAAAKGISWVLCVYGGPLLVVNGFLVLITFLQHTHP  276



>gb|ADZ39688.1| microsomal delta-12 oleate desaturase [Olea europaea subsp. europaea]
Length=383

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L+ QLTLGWPLYLMFNVSGR Y RFACH++P+ P+YSDRER QI ISD G+ A T  LY+
Sbjct  182  LVFQLTLGWPLYLMFNVSGRHYDRFACHYNPHSPMYSDRERAQILISDAGVLAVTCGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP
Sbjct  242  LTAAKGLAWVFCVYGGPLLLVNGFLVLITYLQHTHP  277



>ref|XP_002323284.1| Omega-6 fatty acid desaturase family protein [Populus trichocarpa]
 gb|EEF05045.1| Omega-6 fatty acid desaturase family protein [Populus trichocarpa]
Length=385

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL  NVSGRPY RFACH+DPYGPI++DRER +I+ISD G+ A TY LY
Sbjct  181  TITITLTLGWPLYLACNVSGRPYDRFACHYDPYGPIFNDRERAEIYISDAGVLAVTYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            +LA AKGLAWV+CVYG PLL+VN FLVLITYLQHTH
Sbjct  241  RLAVAKGLAWVLCVYGGPLLVVNAFLVLITYLQHTH  276



>ref|XP_004497897.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cicer arietinum]
Length=384

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFA H+DPYGPIYSDRER+QI+ISD G+ AA+Y LY+L  A+GL
Sbjct  190  GWPLYLTFNVSGRPYDRFASHYDPYGPIYSDRERLQIYISDAGVIAASYGLYRLVLAQGL  249

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             WVVCVYG+PLLIVNGFLVLITYLQHTHP
Sbjct  250  NWVVCVYGIPLLIVNGFLVLITYLQHTHP  278



>ref|XP_010943510.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Elaeis guineensis]
Length=391

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  294  FTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVL  115
             T+++ LTLGWPLYL FNVSGRPYPR ACH+DPY PIYSDRER QIFISDTG+ AA++ L
Sbjct  188  LTMVVTLTLGWPLYLAFNVSGRPYPRLACHYDPYSPIYSDRERAQIFISDTGVLAASFAL  247

Query  114  YKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            Y+L  A G  WVV VYGVPLLIVNG+LV ITYLQHTH
Sbjct  248  YRLVGAFGFWWVVRVYGVPLLIVNGWLVTITYLQHTH  284



>ref|XP_004304366.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Fragaria vesca subsp. vesca]
Length=382

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I LTLGWPLYL FNVSGRPY  FACH+ PYGPIYSDRER+QI+ISD G+ A  Y LY
Sbjct  181  TLAITLTLGWPLYLAFNVSGRPYDGFACHYHPYGPIYSDRERLQIYISDAGVLAVCYGLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGLAWV+C YG PLL+VN FLVLIT+LQHTHP
Sbjct  241  RLAVAKGLAWVLCFYGGPLLVVNAFLVLITFLQHTHP  277



>gb|KHG24863.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
1 [Gossypium arboreum]
Length=385

 Score =   157 bits (398),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIY+DRER+Q++ISDTGIFA  YVLY
Sbjct  180  SLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYTDRERLQVYISDTGIFAVIYVLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            K+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH
Sbjct  240  KIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTH  275



>gb|EYU39931.1| hypothetical protein MIMGU_mgv1a008167mg [Erythranthe guttata]
Length=377

 Score =   157 bits (397),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L +Q TLGWPLYL+FNVSGRPY RFACHFDP  PIYSDRER QI ISD G+ A  Y LY+
Sbjct  176  LTVQFTLGWPLYLLFNVSGRPYNRFACHFDPNSPIYSDRERAQILISDAGVLAIVYGLYR  235

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L  AKGL+W  CVYG PLL+VNGFLVLITYLQHTHP
Sbjct  236  LVLAKGLSWAFCVYGGPLLVVNGFLVLITYLQHTHP  271



>ref|XP_006429873.1| hypothetical protein CICLE_v10011949mg [Citrus clementina]
 gb|ESR43113.1| hypothetical protein CICLE_v10011949mg [Citrus clementina]
Length=383

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL FNVSGRPY RFACHFDPYGPIYS RER+QIFISD GI A  Y LY
Sbjct  181  TLTVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSHRERLQIFISDAGILAMIYSLY  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             L AAKGL +V C+YG PLL+VNGFLVLIT LQHTHP
Sbjct  241  CLVAAKGLVYVFCIYGGPLLVVNGFLVLITLLQHTHP  277



>gb|EYU39930.1| hypothetical protein MIMGU_mgv1a008167mg [Erythranthe guttata]
Length=383

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L +Q TLGWPLYL+FNVSGRPY RFACHFDP  PIYSDRER QI ISD G+ A  Y LY+
Sbjct  182  LTVQFTLGWPLYLLFNVSGRPYNRFACHFDPNSPIYSDRERAQILISDAGVLAIVYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L  AKGL+W  CVYG PLL+VNGFLVLITYLQHTHP
Sbjct  242  LVLAKGLSWAFCVYGGPLLVVNGFLVLITYLQHTHP  277



>gb|ACZ06072.1| microsomal omega-6 fatty acid desaturase [Arachis hypogaea]
Length=383

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+ISD G+ A +Y L +L  AKGL
Sbjct  189  GWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVSYGLIRLVMAKGL  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWVV VYGVPLL+VNGFLVLITYLQHTHP
Sbjct  249  AWVVAVYGVPLLVVNGFLVLITYLQHTHP  277



>ref|XP_006368553.1| hypothetical protein POPTR_0001s05000g [Populus trichocarpa]
 gb|ERP65122.1| hypothetical protein POPTR_0001s05000g [Populus trichocarpa]
Length=360

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L + L +GWPLYL FNVSGRPY RFACH+DPY PIYSDRE++Q++ISD GI AAT+VLY
Sbjct  158  SLAVSLLIGWPLYLTFNVSGRPYDRFACHYDPYSPIYSDREKLQVYISDLGILAATFVLY  217

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             +A ++GLA+++C+YGVPLLI NGFLV ITYLQHTHP
Sbjct  218  SIATSQGLAFLICIYGVPLLIANGFLVTITYLQHTHP  254



>ref|XP_006850001.1| hypothetical protein AMTR_s00022p00172860 [Amborella trichopoda]
 gb|ERN11582.1| hypothetical protein AMTR_s00022p00172860 [Amborella trichopoda]
Length=375

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LT+GWPLYL FNVSGR YPRFACHFDPYGPIYSDRE  QIFISD GI AA Y +Y
Sbjct  175  TLFVSLTMGWPLYLAFNVSGRAYPRFACHFDPYGPIYSDRECTQIFISDLGILAALYAIY  234

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            + + A G   VVCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  235  RASFAYGFTHVVCVYGVPLLIVNGFLVLITFLQHTHP  271



>gb|AAS57577.1| delta12-oleic acid desaturase [Euphorbia lagascae]
Length=382

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L   L +GWPLYL FNVSGRPY RFACH+DPYGPI+S+RER+QI+ISD G+F  TY+LY
Sbjct  180  SLAGTLLIGWPLYLAFNVSGRPYDRFACHYDPYGPIFSERERLQIYISDIGMFVTTYILY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            + AA KG AW+VC YG+PLLIVN FLV ITYLQHTHP
Sbjct  240  QAAAVKGFAWLVCTYGIPLLIVNSFLVTITYLQHTHP  276



>gb|AAL93620.1| fatty acid desaturase 2 [Olea europaea subsp. europaea]
Length=383

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L+ QLTLGWPLYLMFNVSGR Y RFACH++P  P+YSDRER QI ISD G+ A T  LY+
Sbjct  182  LVFQLTLGWPLYLMFNVSGRHYDRFACHYNPNSPMYSDRERAQILISDAGVLAVTCGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP
Sbjct  242  LTAAKGLAWVFCVYGGPLLVVNGFLVLITYLQHTHP  277



>ref|XP_011033218.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Populus euphratica]
Length=454

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+ I LTLGWPLYL  NVSGRPY RFACH+DPYGPI++DRER +I+ISD G+ A TY LY
Sbjct  250  TIAITLTLGWPLYLACNVSGRPYDRFACHYDPYGPIFNDRERAEIYISDAGVLAVTYGLY  309

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            +LA AKGLAWV+CVYG PLL+VN FLVLITYLQHTH
Sbjct  310  RLAVAKGLAWVLCVYGGPLLVVNAFLVLITYLQHTH  345



>gb|AIT96964.1| FAD2 desaturase [Corylus avellana]
Length=382

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL  NVSGRPY RFACH+DPYGPIYS+RER QIF+SD G+FA TYVLY  A +KGL
Sbjct  188  GWPLYLALNVSGRPYDRFACHYDPYGPIYSNRERCQIFVSDAGVFATTYVLYYAAMSKGL  247

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW+V +YG+PLLIVNGFLVLITYLQHTHP
Sbjct  248  AWLVSIYGMPLLIVNGFLVLITYLQHTHP  276



>gb|AHV83757.1| omega-6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>ref|NP_001130234.1| delta-12 fatty acid desaturaseFAD2 [Zea mays]
 gb|ACF78398.1| unknown [Zea mays]
 gb|AFW73115.1| LOW QUALITY PROTEIN: delta-12 fatty acid desaturaseFAD2 [Zea 
mays]
Length=387

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+DRER QIF+SD G+ A  + LYK
Sbjct  189  IVVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYNDRERAQIFVSDAGVVAVAFGLYK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA G+ WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  249  LAAAFGVWWVVRVYAVPLLIVNAWLVLITYLQHTHP  284



>gb|AAL23676.1| delta-12 fatty acid desaturase [Persea americana]
Length=382

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL   LTLGWPLYL FNVSGR Y RFACHFDPYGPIYSDRER+QI ISD G+ A    L+
Sbjct  180  TLAFSLTLGWPLYLAFNVSGRKYDRFACHFDPYGPIYSDRERLQILISDLGVLAVLCGLF  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +L A  GL WVVCVYGVPLLIVNGFLVLIT+LQHTHP
Sbjct  240  RLVAVCGLGWVVCVYGVPLLIVNGFLVLITFLQHTHP  276



>gb|AAB84262.1| omega-6 desaturase [Arachis hypogaea]
 gb|ADN86003.1| oleate desaturase [Arachis hypogaea var. hirsuta]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AER27513.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AAF82293.1| microsomal oleate desaturase [Arachis hypogaea]
 gb|AAZ22543.1| oleate desaturase [Arachis hypogaea]
 gb|ABM47430.1| delta-12 fatty acid desaturase [Arachis hypogaea]
 gb|ABM47431.1| delta-12 fatty acid desaturase [Arachis hypogaea]
 gb|ADI46402.1| omega-6 fatty acid desaturase [Arachis hypogaea]
 gb|ADM83593.1| omega 6 fatty acid desaturase [Arachis hypogaea]
 gb|ADN86004.1| oleate desaturase [Arachis hypogaea var. hirsuta]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AAK67829.1| delta-12 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AAY67653.1| oleate desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AAF82295.1| microsomal oleate desaturase [Arachis ipaensis]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AEW67305.1| delta-12 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AAF82294.1| microsomal oleate desaturase [Arachis duranensis]
 gb|ADM83592.1| omega 6 fatty acid desaturase [Arachis hypogaea]
 gb|ADX20839.1| omega 6 fatty acid desaturase [Arachis hypogaea]
 gb|AER27517.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AER27515.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AER27514.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFIALTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>ref|NP_001237865.1| microsomal oleate desaturase FAD2-4 [Glycine max]
 gb|ABF84063.1| microsomal oleate desaturase FAD2-3 [Glycine max]
Length=383

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + LTLGWPLYL  NVSGRPY RFA H DPY PIYSD ER+QI+ISD G+ A  Y L+
Sbjct  181  TLAVTLTLGWPLYLALNVSGRPYDRFASHLDPYSPIYSDNERLQIYISDAGVLAVCYGLF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP
Sbjct  241  CLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHP  277



>gb|ADX20841.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|ADI46403.1| omega-6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AAC31698.1| delta-12 fatty acid desaturase [Borago officinalis]
Length=383

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QI+ISD GI A  Y LY+L AAKG+
Sbjct  189  GWPLYLMFNVSGRPYDRFACHFDPKSPIYNDRERLQIYISDAGIVAVMYGLYRLVAAKGV  248

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWVVC YGVPLL+VNGFLVLITYLQHT P
Sbjct  249  AWVVCYYGVPLLVVNGFLVLITYLQHTQP  277



>gb|AHV83758.1| omega-6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|AFX61782.1| omega-6 fatty acid desaturase endoplasmic reticulum isozyme 2a 
[Musa AB Group]
Length=386

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL I LTLGWPLY  FNVSGR YPRFA HFDPYGPIYSDRER QIFISD G+ AA YVLY
Sbjct  184  TLAITLTLGWPLYPAFNVSGRCYPRFASHFDPYGPIYSDRERAQIFISDAGLMAALYVLY  243

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++AA  G  W+V VYGVPLLIVNG+LVLITYLQHTHP
Sbjct  244  RVAACYGFWWLVRVYGVPLLIVNGWLVLITYLQHTHP  280



>gb|ACG37433.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Zea mays]
Length=394

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+DRER QIF+SD G+ A  + LYK
Sbjct  189  IVVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYNDRERAQIFVSDAGVVAVAFGLYK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA G+ WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  249  LAAAFGVWWVVRVYAVPLLIVNAWLVLITYLQHTHP  284



>gb|AAY53559.1| oleate desaturase [Arachis hypogaea]
Length=379

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|ADM83594.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|ACJ66779.1| omega-6 desaturase [Portulaca oleracea]
Length=383

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL+FNVSGR Y RFACH+DPYGPIYSDRER+QI++SD GI A +Y LY+LA AKGL
Sbjct  188  GWPLYLLFNVSGRKYERFACHYDPYGPIYSDRERLQIYLSDAGILAVSYGLYRLAVAKGL  247

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYG PLL+VN +LVLITYLQHTHP
Sbjct  248  AWVLCVYGGPLLVVNAYLVLITYLQHTHP  276



>dbj|BAE93382.1| delta-12 fatty acid desaturase [Zea mays]
 gb|ABF50053.1| FAD2 [Zea mays]
Length=387

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+DRER QIF+SD G+ A  + LYK
Sbjct  189  IVVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYNDRERAQIFVSDAGVAAVAFGLYK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA G+ WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  249  LAAAFGVWWVVRVYAVPLLIVNAWLVLITYLQHTHP  284



>ref|XP_010231291.1| PREDICTED: LOW QUALITY PROTEIN: omega-6 fatty acid desaturase, 
endoplasmic reticulum isozyme 2-like [Brachypodium distachyon]
Length=389

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+DRER QIFISD G+ A +  L K
Sbjct  190  IVVQLTLGWPLYLALNASGRPYPRFACHFDPYGPIYNDRERAQIFISDVGVAAVSLALLK  249

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LA+A G  WVV VYGVPLLIVN +LVLITYLQHTHP
Sbjct  250  LASAFGFWWVVRVYGVPLLIVNSWLVLITYLQHTHP  285



>ref|XP_010672659.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672660.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL+FNVSGR Y RFACHFDP  PIYSDRER+QI+ISD GI   TY LY+LAAAKGL
Sbjct  188  GWPLYLLFNVSGRRYERFACHFDPSSPIYSDRERLQIYISDVGILTMTYGLYRLAAAKGL  247

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AWV+CVYG PLL+VNGFLVLIT+LQHTHP
Sbjct  248  AWVLCVYGGPLLVVNGFLVLITFLQHTHP  276



>ref|XP_010928433.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Elaeis guineensis]
Length=391

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL + L LGWPLYL FNVSGRPYPRFACH+DPYGPIYSDRER QIFISD G+ AA Y L 
Sbjct  189  TLAVTLILGWPLYLAFNVSGRPYPRFACHYDPYGPIYSDRERAQIFISDAGVLAAFYALC  248

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            +LA A G  WVV VYGVPLLIVNG+LV ITYLQHTH
Sbjct  249  RLAGAFGFWWVVRVYGVPLLIVNGWLVTITYLQHTH  284



>gb|ACL53784.1| unknown [Zea mays]
Length=392

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + +QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY DRER QIF+SD G+ A  + LYK
Sbjct  192  VAVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYGDRERAQIFVSDAGVAAVAFGLYK  251

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA GL WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  252  LAAAFGLWWVVRVYAVPLLIVNAWLVLITYLQHTHP  287



>gb|ABV44669.1| fatty acid desaturase-2 [Zea mays]
Length=390

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + +QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY DRER QIF+SD G+ A  + LYK
Sbjct  190  VAVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYGDRERAQIFVSDAGVAAVAFGLYK  249

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA GL WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  250  LAAAFGLWWVVRVYAVPLLIVNAWLVLITYLQHTHP  285



>ref|NP_001149122.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Zea mays]
 gb|ACG34271.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Zea mays]
 gb|ACG36665.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Zea mays]
Length=392

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + +QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY DRER QIF+SD G+ A  + LYK
Sbjct  192  VAVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYGDRERAQIFVSDAGVAAVAFGLYK  251

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA GL WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  252  LAAAFGLWWVVRVYAVPLLIVNAWLVLITYLQHTHP  287



>gb|AIB55752.1| delta-12 fatty acid desaturase [Fragaria x ananassa]
Length=375

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T++  LTLGWPLYL FNVSGRPY RFACH+DPY PI+SDRE +QI+ISD GI     VLY
Sbjct  174  TIIFTLTLGWPLYLAFNVSGRPYDRFACHYDPYSPIFSDRESLQIYISDLGILVTASVLY  233

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGL W+V VYGVPLLI NGFLVLITYLQHTHP
Sbjct  234  RLAMAKGLTWLVRVYGVPLLITNGFLVLITYLQHTHP  270



>gb|AIT96965.1| FAD2 desaturase [Corylus avellana]
Length=382

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL  NVSGRPY RFACH+DPYGPIYS+RER QIF+SD G+FA TYVLY  A +KGL
Sbjct  188  GWPLYLALNVSGRPYDRFACHYDPYGPIYSNRERCQIFVSDAGVFATTYVLYYAAMSKGL  247

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            AW+V +YG+PLLIVNGFLVLITYLQHTHP
Sbjct  248  AWLVFIYGMPLLIVNGFLVLITYLQHTHP  276



>gb|AAX14399.1| oleate desaturase [Arachis monticola]
Length=379

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFAGHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>gb|KEH41705.1| microsomal omega-3 fatty acid desaturase [Medicago truncatula]
Length=384

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  267  GWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLAAAKGL  88
            GWPLYL FNVSGRPY RFA H+DPYGPIYSDRER+QI++SD G+ A +Y LY+L  A+GL
Sbjct  190  GWPLYLAFNVSGRPYDRFASHYDPYGPIYSDRERLQIYVSDVGVLAVSYGLYRLVLAQGL  249

Query  87   AWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             WV+CVYG+PLLIVNGFLVLITYLQHTHP
Sbjct  250  NWVICVYGIPLLIVNGFLVLITYLQHTHP  278



>gb|ADN86005.1| oleate desaturase [Arachis hypogaea var. hirsuta]
Length=331

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL  NVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLALNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>ref|XP_004953689.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Setaria italica]
Length=387

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACH+DPYGPIY+DRER+QIFISD G+ A ++ LYK
Sbjct  189  IVVQLTLGWPLYLTTNASGRPYPRFACHYDPYGPIYNDRERMQIFISDAGVMAVSFGLYK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAA  G  WVV +Y VPLLIVN +LVLITYLQHTHP
Sbjct  249  LAATFGFWWVVRIYAVPLLIVNAWLVLITYLQHTHP  284



>gb|AFK12604.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|AFK12603.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|AFK12596.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12597.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12598.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12599.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12601.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12605.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12606.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12608.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12609.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12610.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12611.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12612.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|AFK12607.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|AFK12600.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|AFK12602.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|ADM83591.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I L LGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLALGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>ref|XP_011037924.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Populus euphratica]
Length=380

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L ++L LGWPLYL FN SGRPY RFACH+DPY PIYSDRER+ I+ISD GIFAAT+VLY
Sbjct  182  SLAVKLLLGWPLYLTFNASGRPYDRFACHYDPYSPIYSDRERLHIYISDLGIFAATFVLY  241

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  +GLA+V+ +YGVPL+ VNGFLV ITYLQHTHP
Sbjct  242  RVAITQGLAFVMSIYGVPLIFVNGFLVTITYLQHTHP  278



>ref|XP_011037925.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Populus euphratica]
Length=380

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L ++L LGWPLYL FN SGRPY RFACH+DPY PIYSDRER+ I+ISD GIFAAT+VLY
Sbjct  182  SLAVKLLLGWPLYLTFNASGRPYDRFACHYDPYSPIYSDRERLHIYISDLGIFAATFVLY  241

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A  +GLA+V+ +YGVPL+ VNGFLV ITYLQHTHP
Sbjct  242  RVAITQGLAFVMSIYGVPLIFVNGFLVTITYLQHTHP  278



>gb|AFK12595.1| fad2-3, partial [Helianthus petiolaris]
Length=348

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  167  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  226

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  227  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  263



>gb|KHG30631.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Gossypium arboreum]
Length=383

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -2

Query  282  IQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYKLA  103
            IQLTLGWPLYL+FN++G PY R ACH+DPYGPI+SDR+R+QI++SD G+ A TY LY+L 
Sbjct  184  IQLTLGWPLYLLFNITGPPYDRLACHYDPYGPIFSDRQRLQIYVSDAGVLAVTYALYRLV  243

Query  102  AAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP
Sbjct  244  LAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHP  277



>gb|AER27516.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I++SD+ +FA TY+LY
Sbjct  177  SLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIYVSDSSVFAVTYLLY  236

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
             +A  K L WVVCVYGVPLLIVNGFLV ITYLQHTH
Sbjct  237  HIATLKSLGWVVCVYGVPLLIVNGFLVTITYLQHTH  272



>ref|XP_004295164.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Fragaria vesca subsp. vesca]
Length=393

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T++  LTLGWPLYL FNVSGRPY RFACH+DPY PI+SD+E +QI+ISD GI     VLY
Sbjct  174  TIIFTLTLGWPLYLAFNVSGRPYDRFACHYDPYSPIFSDQETLQIYISDLGILVTASVLY  233

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA AKGL W+V VYGVPLLI NGFLVLITYLQHTHP
Sbjct  234  RLAMAKGLTWLVRVYGVPLLITNGFLVLITYLQHTHP  270



>ref|XP_003570235.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Brachypodium distachyon]
 ref|XP_003570236.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Brachypodium distachyon]
 ref|XP_010235888.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Brachypodium distachyon]
Length=387

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+DRER QIF+SD G+ A +  L K
Sbjct  189  IVVQLTLGWPLYLAMNASGRPYPRFACHFDPYGPIYNDRERAQIFVSDVGMVAVSLALLK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LA++ G  WVV VYGVPLLIVN +LVLITYLQHTHP
Sbjct  249  LASSFGFWWVVRVYGVPLLIVNAWLVLITYLQHTHP  284



>ref|XP_008677266.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Zea mays]
Length=501

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + +QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY DRER QIF+SD G+ A  + LYK
Sbjct  301  VAVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYGDRERAQIFVSDAGVAAVAFGLYK  360

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA GL WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  361  LAAAFGLWWVVRVYAVPLLIVNAWLVLITYLQHTHP  396



>ref|XP_008344778.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
 ref|XP_008363340.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=387

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            ++L+ LTLGWPLYL FN SGR Y RFACH+DP GPI+S RER+QI+ISD GI A TYVLY
Sbjct  182  SILVTLTLGWPLYLAFNASGRDYDRFACHYDPKGPIFSTRERLQIYISDLGIVAVTYVLY  241

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            ++A AKG  W+ C+YGVPLL+VNGFLVLITYL HTH
Sbjct  242  RIAMAKGFVWLTCIYGVPLLVVNGFLVLITYLHHTH  277



>gb|AAL68983.1|AF251844_1 delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19365.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19366.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19367.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19368.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19369.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19370.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19371.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19372.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19373.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19374.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19375.1| delta-12 oleate desaturase [Helianthus annuus]
Length=382

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFISD GI    Y+L+
Sbjct  181  TLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFISDAGILTVFYILF  240

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP
Sbjct  241  RLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHP  277



>gb|AAL61825.1| putative delta12 oleic acid desaturase-related fatty acid conjugase 
[Vernicia fordii]
Length=255

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL+  L +GWPLYL FNVSGR Y RFACH+DPY PIYSDRER+QI+ISD  IF A YVLY
Sbjct  144  TLVATLFIGWPLYLAFNVSGRYYDRFACHYDPYSPIYSDRERLQIYISDAMIFVAAYVLY  203

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH  4
            K+A AKGLAW+VC+YGVPLLIVN  +V IT LQHTH
Sbjct  204  KIAMAKGLAWLVCIYGVPLLIVNALVVTITSLQHTH  239



>gb|AFW63614.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Zea mays]
Length=556

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            + +QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY DRER QIF+SD G+ A  + LYK
Sbjct  356  VAVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYGDRERAQIFVSDAGVAAVAFGLYK  415

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAAA GL WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  416  LAAAFGLWWVVRVYAVPLLIVNAWLVLITYLQHTHP  451



>gb|AIA21668.1| oleate desaturase [Crambe kralikii]
Length=383

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+ISD GI A  Y LY+
Sbjct  182  LTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIYISDAGILAVCYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             AAA+GLA ++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  242  YAAAQGLASMICVYGVPLLIVNGFLVLITYLQHTHP  277



>dbj|BAJ86651.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91784.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88886.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=387

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+DRER QIFISD G+ A +  L K
Sbjct  189  IVVQLTLGWPLYLALNASGRPYPRFACHFDPYGPIYNDRERAQIFISDVGVLAVSLALLK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            L ++ G  WVV VYGVPLLIVN +LVLITYLQHTHP
Sbjct  249  LVSSFGFWWVVRVYGVPLLIVNAWLVLITYLQHTHP  284



>gb|AGN95844.1| fatty acid delta12-desturase FAD2-4, partial [Hiptage benghalensis]
Length=307

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            TL   L +GWPLYL FNVSGRPY RFACH+DPY PIYS+RER++I+ISD  IFA +YVLY
Sbjct  105  TLAATLIIGWPLYLTFNVSGRPYDRFACHYDPYSPIYSERERVEIYISDIWIFATSYVLY  164

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            +    KGL WV+C+YGVPLLIVN F+V+I YLQHTHP
Sbjct  165  QAIIVKGLGWVICIYGVPLLIVNAFVVMIPYLQHTHP  201



>gb|AIA21669.1| oleate desaturase [Crambe kralikii]
Length=383

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+ISD GI A  Y LY+
Sbjct  182  LTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIYISDAGILAVCYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             AAA+GLA ++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  242  YAAAQGLASMICVYGVPLLIVNGFLVLITYLQHTHP  277



>gb|AEK06377.1| microsomal oleate desaturase FAD2-8 [Carthamus tinctorius]
Length=379

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            T+   L LGWPLYL FNVSGRPY RFACH+ P  PI++ RER+QI+ISD GI A +Y+LY
Sbjct  180  TVFTTLVLGWPLYLAFNVSGRPYDRFACHYAPNSPIFTSRERLQIWISDAGIIAVSYLLY  239

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            ++A AK +AWVVC+YGVPLLIVNGFLV+ITYLQHTHP
Sbjct  240  RMALAKSVAWVVCIYGVPLLIVNGFLVMITYLQHTHP  276



>ref|XP_006407366.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 ref|XP_006407367.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 ref|XP_006407368.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48819.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48820.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48821.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
Length=383

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L++Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+ISD GI A  Y LY+
Sbjct  182  LIVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIYISDAGILAVCYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             AAA+G+A ++CVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  242  YAAAQGMASMLCVYGVPLLIVNGFLVLITYLQHTHP  277



>gb|AIA21649.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+ISD GI A  Y LY+
Sbjct  182  LTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIYISDAGILAVCYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             AAA+G+A +VCVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  242  YAAAQGVASMVCVYGVPLLIVNGFLVLITYLQHTHP  277



>gb|AGS12443.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+ISD GI A  Y LY+
Sbjct  182  LTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIYISDAGILAVCYGLYR  241

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
             AAA+G+A +VCVYGVPLLIVNGFLVLITYLQHTHP
Sbjct  242  YAAAQGVASMVCVYGVPLLIVNGFLVLITYLQHTHP  277



>ref|XP_010673536.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  112
            +L++ L LGWPLYL+FN SGRPY RFACH+DP GPI+S RER Q+ +SD G+    ++LY
Sbjct  186  SLIVTLMLGWPLYLLFNASGRPYDRFACHYDPNGPIFSSRERAQVMVSDLGLIGVLFLLY  245

Query  111  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            K+A AKGLAW++C+YGVPLL+VNGFLV ITYLQHTHP
Sbjct  246  KVAMAKGLAWLICIYGVPLLVVNGFLVTITYLQHTHP  282



>gb|ACA28704.1| fatty acid desaturase [Sorghum bicolor]
Length=387

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLYK  109
            +++QLTLGWPLYL  N SGRPYPRFACHFDPYGPIY+D ER QIFISD G+ A ++ LYK
Sbjct  189  IVVQLTLGWPLYLATNASGRPYPRFACHFDPYGPIYNDWERAQIFISDAGVMAVSFGLYK  248

Query  108  LAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHP  1
            LAA  G  WVV VY VPLLIVN +LVLITYLQHTHP
Sbjct  249  LAATFGFWWVVRVYAVPLLIVNAWLVLITYLQHTHP  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560672394880