BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034A17

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008218165.1|  PREDICTED: probable nucleolar protein 5-2          110   5e-24   Prunus mume [ume]
ref|XP_007208461.1|  hypothetical protein PRUPE_ppa003941mg             110   5e-24   Prunus persica
gb|KDO50622.1|  hypothetical protein CISIN_1g0088521mg                  108   5e-24   Citrus sinensis [apfelsine]
ref|XP_006491841.1|  PREDICTED: probable nucleolar protein 5-1-like     109   7e-24   Citrus sinensis [apfelsine]
ref|XP_006432265.1|  hypothetical protein CICLE_v10000758mg             109   7e-24   Citrus clementina [clementine]
emb|CAN73717.1|  hypothetical protein VITISV_038844                     108   1e-23   Vitis vinifera
emb|CBI34244.3|  unnamed protein product                                108   1e-23   Vitis vinifera
ref|XP_007131795.1|  hypothetical protein PHAVU_011G042200g             108   2e-23   Phaseolus vulgaris [French bean]
gb|KDO43234.1|  hypothetical protein CISIN_1g013537mg                   107   2e-23   Citrus sinensis [apfelsine]
ref|XP_006436388.1|  hypothetical protein CICLE_v10031140mg             107   4e-23   Citrus clementina [clementine]
ref|XP_002273273.2|  PREDICTED: probable nucleolar protein 5-2          107   5e-23   Vitis vinifera
gb|EYU23803.1|  hypothetical protein MIMGU_mgv1a003693mg                107   5e-23   Erythranthe guttata [common monkey flower]
ref|XP_009769588.1|  PREDICTED: probable nucleolar protein 5-2          107   5e-23   Nicotiana sylvestris
dbj|BAB41076.1|  MAR-binding protein                                    107   6e-23   Nicotiana tabacum [American tobacco]
ref|XP_009591833.1|  PREDICTED: probable nucleolar protein 5-2          107   7e-23   Nicotiana tomentosiformis
ref|XP_006468094.1|  PREDICTED: probable nucleolar protein 5-2-li...    106   1e-22   Citrus sinensis [apfelsine]
ref|XP_006468096.1|  PREDICTED: probable nucleolar protein 5-2-li...    106   1e-22   Citrus sinensis [apfelsine]
ref|XP_006468095.1|  PREDICTED: probable nucleolar protein 5-2-li...    106   1e-22   Citrus sinensis [apfelsine]
ref|XP_006468097.1|  PREDICTED: probable nucleolar protein 5-2-li...    106   1e-22   Citrus sinensis [apfelsine]
ref|XP_010243588.1|  PREDICTED: probable nucleolar protein 5-1          105   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_011099778.1|  PREDICTED: probable nucleolar protein 5-2          105   3e-22   Sesamum indicum [beniseed]
ref|XP_010422824.1|  PREDICTED: probable nucleolar protein 5-2          105   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010485906.1|  PREDICTED: probable nucleolar protein 5-2          105   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006297275.1|  hypothetical protein CARUB_v10013290mg             105   4e-22   
ref|XP_011099781.1|  PREDICTED: probable nucleolar protein 5-2          104   6e-22   Sesamum indicum [beniseed]
emb|CDP16371.1|  unnamed protein product                              98.2    6e-22   Coffea canephora [robusta coffee]
gb|EYU23804.1|  hypothetical protein MIMGU_mgv1a003941mg                104   7e-22   Erythranthe guttata [common monkey flower]
ref|XP_008388628.1|  PREDICTED: probable nucleolar protein 5-2          103   1e-21   
ref|XP_010464014.1|  PREDICTED: probable nucleolar protein 5-2          103   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008370662.1|  PREDICTED: probable nucleolar protein 5-2          102   2e-21   
ref|XP_006394992.1|  hypothetical protein EUTSA_v10003966mg             102   2e-21   Eutrema salsugineum [saltwater cress]
gb|KHN25404.1|  Putative nucleolar protein 5-2                          102   2e-21   Glycine soja [wild soybean]
ref|XP_003540996.1|  PREDICTED: probable nucleolar protein 5-2-like     102   2e-21   Glycine max [soybeans]
gb|ACJ85748.1|  unknown                                                 102   2e-21   Medicago truncatula
gb|KDP23603.1|  hypothetical protein JCGZ_23436                         102   2e-21   Jatropha curcas
ref|XP_010546633.1|  PREDICTED: probable nucleolar protein 5-2          102   3e-21   Tarenaya hassleriana [spider flower]
ref|XP_006408115.1|  hypothetical protein EUTSA_v10020473mg             102   3e-21   Eutrema salsugineum [saltwater cress]
ref|XP_003537858.1|  PREDICTED: probable nucleolar protein 5-2-like     102   3e-21   Glycine max [soybeans]
gb|KDP35364.1|  hypothetical protein JCGZ_10348                         102   4e-21   Jatropha curcas
ref|XP_006287421.1|  hypothetical protein CARUB_v10000627mg             102   4e-21   
ref|XP_011013586.1|  PREDICTED: probable nucleolar protein 5-1          102   4e-21   Populus euphratica
ref|XP_011032532.1|  PREDICTED: probable nucleolar protein 5-1          102   4e-21   Populus euphratica
ref|XP_010550954.1|  PREDICTED: probable nucleolar protein 5-2          101   6e-21   Tarenaya hassleriana [spider flower]
ref|XP_003606983.1|  SAR DNA-binding protein-1                          101   7e-21   
ref|XP_009342020.1|  PREDICTED: probable nucleolar protein 5-2          101   8e-21   Pyrus x bretschneideri [bai li]
ref|XP_010025094.1|  PREDICTED: probable nucleolar protein 5-2          101   8e-21   Eucalyptus grandis [rose gum]
gb|KJB26510.1|  hypothetical protein B456_004G245100                  99.0    1e-20   Gossypium raimondii
gb|KJB26512.1|  hypothetical protein B456_004G245100                  99.8    2e-20   Gossypium raimondii
ref|XP_006382714.1|  hypothetical protein POPTR_0005s04710g           99.8    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010421655.1|  PREDICTED: probable nucleolar protein 5-1 is...  98.2    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010904781.1|  PREDICTED: probable nucleolar protein 5-2        99.8    3e-20   Elaeis guineensis
gb|KJB26509.1|  hypothetical protein B456_004G245100                  99.8    3e-20   Gossypium raimondii
gb|AAC16330.1|  SAR DNA-binding protein-1                             99.8    3e-20   Pisum sativum [garden pea]
ref|XP_003611089.1|  SAR DNA-binding protein-1                        99.0    3e-20   
ref|XP_010241493.1|  PREDICTED: probable nucleolar protein 5-2 is...  99.8    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010241470.1|  PREDICTED: probable nucleolar protein 5-2 is...  99.8    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003611088.1|  SAR DNA-binding protein-1                        99.4    4e-20   Medicago truncatula
ref|XP_010421656.1|  PREDICTED: probable nucleolar protein 5-1 is...  98.6    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010494044.1|  PREDICTED: probable nucleolar protein 5-1        98.6    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007030687.1|  NOP56-like pre RNA processing ribonucleoprot...  98.6    5e-20   
ref|XP_002319598.1|  hypothetical protein POPTR_0013s03260g           99.0    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010938712.1|  PREDICTED: probable nucleolar protein 5-2        99.0    5e-20   Elaeis guineensis
emb|CDX80674.1|  BnaC07g27700D                                        98.6    5e-20   
ref|XP_011003824.1|  PREDICTED: probable nucleolar protein 5-2        98.6    6e-20   Populus euphratica
ref|NP_187157.1|  putative SAR DNA-binding protein                    98.6    6e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KJB82560.1|  hypothetical protein B456_013G202500                  98.6    6e-20   Gossypium raimondii
ref|XP_009364569.1|  PREDICTED: probable nucleolar protein 5-2        98.2    7e-20   Pyrus x bretschneideri [bai li]
ref|XP_009411704.1|  PREDICTED: probable nucleolar protein 5-1        98.2    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002884489.1|  hypothetical protein ARALYDRAFT_896572           97.8    8e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_007030686.1|  NOP56-like pre RNA processing ribonucleoprot...  98.2    1e-19   
ref|XP_010687356.1|  PREDICTED: probable nucleolar protein 5-2        97.8    1e-19   Beta vulgaris subsp. vulgaris [field beet]
emb|CAK22424.1|  matrix attachment region binding protein             97.8    1e-19   Beta vulgaris [beet]
ref|XP_010674932.1|  PREDICTED: probable nucleolar protein 5-2        97.4    1e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG01259.1|  putative nucleolar 5-2 -like protein                  97.4    1e-19   Gossypium arboreum [tree cotton]
ref|XP_009382561.1|  PREDICTED: probable nucleolar protein 5-2        97.4    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009111930.1|  PREDICTED: probable nucleolar protein 5-1        97.1    2e-19   Brassica rapa
emb|CDY00004.1|  BnaC09g02970D                                        97.1    2e-19   
ref|XP_008799299.1|  PREDICTED: probable nucleolar protein 5-2        96.7    2e-19   Phoenix dactylifera
emb|CDY19706.1|  BnaA09g03590D                                        97.1    2e-19   Brassica napus [oilseed rape]
ref|XP_009151230.1|  PREDICTED: probable nucleolar protein 5-1        97.1    2e-19   Brassica rapa
emb|CAE45597.1|  SAR DNA-binding protein-like protein                 97.1    2e-19   Lotus japonicus
dbj|BAD11331.1|  BRI1-KD interacting protein 102                      92.8    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008796212.1|  PREDICTED: probable nucleolar protein 5-2 is...  96.7    3e-19   Phoenix dactylifera
ref|XP_008796213.1|  PREDICTED: probable nucleolar protein 5-2 is...  96.7    3e-19   Phoenix dactylifera
gb|KHG00213.1|  putative nucleolar 5-2 -like protein                  96.3    3e-19   Gossypium arboreum [tree cotton]
ref|XP_010455156.1|  PREDICTED: probable nucleolar protein 5-1        96.3    3e-19   Camelina sativa [gold-of-pleasure]
gb|KJB45047.1|  hypothetical protein B456_007G287100                  95.9    4e-19   Gossypium raimondii
gb|KHG01423.1|  putative nucleolar 5-2 -like protein                  95.9    5e-19   Gossypium arboreum [tree cotton]
ref|NP_198064.1|  putative SAR DNA-binding protein                    95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874406.1|  hypothetical protein ARALYDRAFT_489610           95.5    6e-19   
ref|XP_004239682.1|  PREDICTED: probable nucleolar protein 5-2        95.1    6e-19   Solanum lycopersicum
ref|XP_006362168.1|  PREDICTED: probable nucleolar protein 5-2-li...  95.5    7e-19   
gb|AAC16331.1|  SAR DNA-binding protein-2                             95.1    8e-19   Pisum sativum [garden pea]
gb|KFK23538.1|  hypothetical protein AALP_AAs63573U000200             94.4    1e-18   Arabis alpina [alpine rockcress]
dbj|BAA31260.1|  SAR DNA binding protein                              94.0    1e-18   Oryza sativa [red rice]
ref|XP_011457678.1|  PREDICTED: probable nucleolar protein 5-2        94.4    1e-18   Fragaria vesca subsp. vesca
ref|NP_001050112.1|  Os03g0350100                                     94.0    3e-18   
gb|ABF95925.1|  Nucleolar protein NOP5, putative, expressed           93.6    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59058.1|  hypothetical protein OsJ_10836                        93.6    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050113.1|  Os03g0350300                                     93.6    3e-18   
ref|XP_002456868.1|  hypothetical protein SORBIDRAFT_03g044260        93.6    3e-18   
ref|XP_004247627.1|  PREDICTED: probable nucleolar protein 5-2        93.6    3e-18   
ref|XP_004507477.1|  PREDICTED: probable nucleolar protein 5-1-like   93.6    3e-18   Cicer arietinum [garbanzo]
gb|EEC75255.1|  hypothetical protein OsI_11566                        92.8    7e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006650080.1|  PREDICTED: probable nucleolar protein 5-2-like   92.4    7e-18   Oryza brachyantha
ref|XP_008455669.1|  PREDICTED: probable nucleolar protein 5-2        92.0    9e-18   Cucumis melo [Oriental melon]
ref|XP_006345813.1|  PREDICTED: probable nucleolar protein 5-2-like   92.0    1e-17   Solanum tuberosum [potatoes]
emb|CDY50583.1|  BnaC02g39570D                                        91.7    1e-17   Brassica napus [oilseed rape]
emb|CDY52494.1|  BnaAnng11410D                                        91.7    1e-17   Brassica napus [oilseed rape]
ref|XP_004139213.1|  PREDICTED: probable nucleolar protein 5-2-li...  90.9    2e-17   Cucumis sativus [cucumbers]
ref|XP_004139212.1|  PREDICTED: probable nucleolar protein 5-2-li...  91.3    2e-17   
gb|AFW88399.1|  hypothetical protein ZEAMMB73_019419                  88.6    9e-17   
ref|XP_008660157.1|  PREDICTED: probable nucleolar protein 5-2        89.0    1e-16   Zea mays [maize]
ref|XP_002512277.1|  nucleolar protein nop56, putative                88.6    1e-16   Ricinus communis
ref|XP_008655653.1|  PREDICTED: probable nucleolar protein 5-2        87.4    4e-16   Zea mays [maize]
ref|XP_004984387.1|  PREDICTED: probable nucleolar protein 5-2-like   86.3    9e-16   Setaria italica
ref|XP_004984388.1|  PREDICTED: probable nucleolar protein 5-2-like   86.3    9e-16   Setaria italica
gb|KFK37913.1|  hypothetical protein AALP_AA3G046300                  85.9    1e-15   Arabis alpina [alpine rockcress]
ref|XP_003562489.1|  PREDICTED: probable nucleolar protein 5-2        85.5    2e-15   Brachypodium distachyon [annual false brome]
gb|AFW84118.1|  hypothetical protein ZEAMMB73_870642                  85.1    2e-15   
ref|XP_003557835.1|  PREDICTED: probable nucleolar protein 5-2        83.6    6e-15   Brachypodium distachyon [annual false brome]
ref|XP_006838803.1|  hypothetical protein AMTR_s00002p00260990        83.6    8e-15   Amborella trichopoda
gb|EMS65034.1|  hypothetical protein TRIUR3_04158                     83.2    9e-15   Triticum urartu
gb|AAB61073.1|  similar to S. cerevisiae SIK1P (PID:g984964)          81.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAN15014.1|  SAR DNA binding protein                              77.8    6e-13   Bromus inermis [awnless brome grass]
ref|XP_002533223.1|  nucleolar protein nop56, putative                76.3    2e-12   Ricinus communis
gb|KJB26511.1|  hypothetical protein B456_004G245100                  75.5    3e-12   Gossypium raimondii
ref|XP_007030688.1|  NOP56-like pre RNA processing ribonucleoprot...  74.3    6e-12   
tpg|DAA45361.1|  TPA: hypothetical protein ZEAMMB73_906298            70.1    2e-10   
ref|XP_002985284.1|  hypothetical protein SELMODRAFT_121625           66.2    3e-09   Selaginella moellendorffii
gb|AAN72071.1|  SAR DNA-binding protein - like                        65.5    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002970093.1|  hypothetical protein SELMODRAFT_146841           64.7    1e-08   Selaginella moellendorffii
ref|XP_001753892.1|  predicted protein                                63.2    3e-08   
ref|XP_001756465.1|  predicted protein                                60.5    3e-07   
emb|CDP04715.1|  unnamed protein product                              54.7    2e-05   Coffea canephora [robusta coffee]



>ref|XP_008218165.1| PREDICTED: probable nucleolar protein 5-2 [Prunus mume]
Length=538

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LGR AGSAKGKPKIEVYDKDRKKG G LIT AKAYNPAADSVLG T
Sbjct  387  AKLEARLRNLEGRELGRFAGSAKGKPKIEVYDKDRKKGAGGLITAAKAYNPAADSVLGQT  446

Query  538  EP  533
             P
Sbjct  447  TP  448



>ref|XP_007208461.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
 gb|EMJ09660.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
Length=539

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LGR AGSAKGKPKIEVYDKDRKKG G LIT AKAYNPAADSVLG T
Sbjct  387  AKLEARLRNLEGRELGRFAGSAKGKPKIEVYDKDRKKGAGGLITAAKAYNPAADSVLGQT  446

Query  538  EP  533
             P
Sbjct  447  TP  448



>gb|KDO50622.1| hypothetical protein CISIN_1g0088521mg, partial [Citrus sinensis]
 gb|KDO50623.1| hypothetical protein CISIN_1g0088521mg, partial [Citrus sinensis]
Length=396

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIEVYDKDRKKGPGA+IT AK YNPAADS+LG  
Sbjct  232  AKLEARLRNLEGKELGRAAGSAKGKPKIEVYDKDRKKGPGAMITAAKTYNPAADSILGLM  291

Query  538  EPTANEDEPE  509
            E  A++D+ E
Sbjct  292  ENAASKDDEE  301



>ref|XP_006491841.1| PREDICTED: probable nucleolar protein 5-1-like [Citrus sinensis]
Length=551

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIEVYDKDRKKGPGA+IT AK YNPAADS+LG  
Sbjct  387  AKLEARLRNLEGKELGRAAGSAKGKPKIEVYDKDRKKGPGAMITAAKTYNPAADSILGLM  446

Query  538  EPTANEDEPE  509
            E  A++D+ E
Sbjct  447  ENAASKDDEE  456



>ref|XP_006432265.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
 gb|ESR45505.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
Length=551

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIEVYDKDRKKGPGA+IT AK YNPAADS+LG  
Sbjct  387  AKLEARLRNLEGKELGRAAGSAKGKPKIEVYDKDRKKGPGAMITAAKTYNPAADSILGLM  446

Query  538  EPTANEDEPE  509
            E  A++D+ E
Sbjct  447  ENAASKDDEE  456



>emb|CAN73717.1| hypothetical protein VITISV_038844 [Vitis vinifera]
Length=472

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNPAADSVLG  
Sbjct  387  AKLEARLRNLEGRELGHSAGSAKGKPKIEVYDKDRKKGSGALITAAKTYNPAADSVLGRI  446

Query  538  EPTANEDEPEL  506
            E +A  +E E+
Sbjct  447  EDSAAREEEEM  457



>emb|CBI34244.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNPAADSVLG  
Sbjct  387  AKLEARLRNLEGRELGHSAGSAKGKPKIEVYDKDRKKGSGALITAAKTYNPAADSVLGRI  446

Query  538  EPTANEDEPEL  506
            E +A  +E E+
Sbjct  447  EDSAAREEEEM  457



>ref|XP_007131795.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
 gb|ESW03789.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
Length=556

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKGPG LITPAK YNP+ADSV+G  
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGPGGLITPAKTYNPSADSVIGQI  446

Query  538  EPTANEDEPE  509
                +ED  E
Sbjct  447  NSAMDEDVQE  456



>gb|KDO43234.1| hypothetical protein CISIN_1g013537mg [Citrus sinensis]
Length=441

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSVLG T
Sbjct  277  AKLEARLRNLEGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVLGLT  336

Query  538  EPTANEDEPE  509
            E  A+ +E E
Sbjct  337  ENAADGNEVE  346



>ref|XP_006436388.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
 gb|ESR49628.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
Length=552

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSVLG T
Sbjct  387  AKLEARLRNLEGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVLGLT  446

Query  538  EPTANEDEPE  509
            E  A+ +E E
Sbjct  447  ENAADGNEVE  456



>ref|XP_002273273.2| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
 ref|XP_010659961.1| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
Length=573

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNPAADSVLG  
Sbjct  387  AKLEARLRNLEGRELGHSAGSAKGKPKIEVYDKDRKKGSGALITAAKTYNPAADSVLGRI  446

Query  538  EPTANEDEPEL  506
            E +A  +E E+
Sbjct  447  EDSAAREEEEM  457



>gb|EYU23803.1| hypothetical protein MIMGU_mgv1a003693mg [Erythranthe guttata]
Length=569

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G +ITPAK YNPAADS+LG TE
Sbjct  414  KLEARLRNLEGKELGRSAGSAKGKPKIEFYDKDRKKGSGGMITPAKTYNPAADSILGLTE  473

Query  535  PTANEDEPE  509
              +N D+ E
Sbjct  474  SLSNNDKDE  482



>ref|XP_009769588.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana sylvestris]
Length=559

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LG+ AGSAKGKPKIEVYDKDRKKG GALITPAK YNPAADSV+GHT
Sbjct  387  AKLEARLRALEGKELGKSAGSAKGKPKIEVYDKDRKKGAGALITPAKVYNPAADSVIGHT  446

Query  538  E  536
            E
Sbjct  447  E  447



>dbj|BAB41076.1| MAR-binding protein [Nicotiana tabacum]
Length=555

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LG+ AGSAKGKPKIEVYDKDRKKG GALITPAK YNPAADSV+GHT
Sbjct  387  AKLEARLRALEGKELGKSAGSAKGKPKIEVYDKDRKKGAGALITPAKVYNPAADSVIGHT  446

Query  538  E  536
            E
Sbjct  447  E  447



>ref|XP_009591833.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana tomentosiformis]
Length=559

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LG+ AGSAKGKPKIEVYDKDRKKG GALITPAK YNPAADSV+GHT
Sbjct  387  AKLEARLRALEGKELGKSAGSAKGKPKIEVYDKDRKKGAGALITPAKVYNPAADSVIGHT  446

Query  538  E  536
            E
Sbjct  447  E  447



>ref|XP_006468094.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Citrus 
sinensis]
Length=549

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G T
Sbjct  387  AKLEARLRNLEGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLT  446

Query  538  EPTANEDEPE  509
            E  A+ +E E
Sbjct  447  ENAADGNEVE  456



>ref|XP_006468096.1| PREDICTED: probable nucleolar protein 5-2-like isoform X3 [Citrus 
sinensis]
Length=565

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G T
Sbjct  387  AKLEARLRNLEGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLT  446

Query  538  EPTANEDEPE  509
            E  A+ +E E
Sbjct  447  ENAADGNEVE  456



>ref|XP_006468095.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Citrus 
sinensis]
Length=573

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G T
Sbjct  387  AKLEARLRNLEGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLT  446

Query  538  EPTANEDEPE  509
            E  A+ +E E
Sbjct  447  ENAADGNEVE  456



>ref|XP_006468097.1| PREDICTED: probable nucleolar protein 5-2-like isoform X4 [Citrus 
sinensis]
Length=588

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G T
Sbjct  387  AKLEARLRNLEGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLT  446

Query  538  EPTANEDEPE  509
            E  A+ +E E
Sbjct  447  ENAADGNEVE  456



>ref|XP_010243588.1| PREDICTED: probable nucleolar protein 5-1 [Nelumbo nucifera]
Length=577

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YN AADSVLG T
Sbjct  387  AKLEARLRNLEGRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNTAADSVLGRT  446

Query  538  -EPTANEDEPE  509
             EP A + E E
Sbjct  447  AEPVAEKLEKE  457



>ref|XP_011099778.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099779.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099780.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=585

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR  GSAKGKPKIE YDKDRKKG G LITPAK YNPAADS+LG T
Sbjct  387  AKLEARLRNLEGKELGRSVGSAKGKPKIEFYDKDRKKGSGGLITPAKTYNPAADSILGLT  446

Query  538  EPTANEDEPE  509
            E  + +D+ E
Sbjct  447  ESLSKKDKYE  456



>ref|XP_010422824.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=554

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T
Sbjct  387  AKLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLLGQT  446

Query  538  EPTANED  518
             P  +ED
Sbjct  447  -PAKSED  452



>ref|XP_010485906.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
 ref|XP_010485908.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=535

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T
Sbjct  387  AKLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLLGQT  446

Query  538  EPTANED  518
             P  +ED
Sbjct  447  -PAKSED  452



>ref|XP_006297275.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
 gb|EOA30173.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
Length=593

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T
Sbjct  422  AKLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLLGQT  481

Query  538  EPTANED  518
             P  +ED
Sbjct  482  -PAKSED  487



>ref|XP_011099781.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=583

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R+LEGR+LGR AGS KGKPKIEVYDKDRKKG G LITPAK YNPAADSVLG T
Sbjct  387  AKLEARLRSLEGRELGRSAGSVKGKPKIEVYDKDRKKGSGGLITPAKTYNPAADSVLGLT  446

Query  538  EPTANED  518
            E  + ++
Sbjct  447  ESLSKDE  453



>emb|CDP16371.1| unnamed protein product [Coffea canephora]
Length=125

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR R+LEGR+L R AGSAKGKPKIEVYDKDRK G G LITP K YNPAAD+VLG TE
Sbjct  39   KLEARLRSLEGRELNRAAGSAKGKPKIEVYDKDRKTGAGGLITPGKTYNPAADAVLGPTE  98

Query  535  PTANEDEPELEK  500
             ++ +++ E EK
Sbjct  99   LSSEKEKNEQEK  110



>gb|EYU23804.1| hypothetical protein MIMGU_mgv1a003941mg [Erythranthe guttata]
Length=553

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEGR+LGR AGSAKGKPKIE YDKDRKKG G +ITPAK YNPAADS+LG TE
Sbjct  388  KLEARLRNLEGRELGRSAGSAKGKPKIEFYDKDRKKGSGGMITPAKTYNPAADSILGLTE  447

Query  535  PTANEDE  515
              + + E
Sbjct  448  SLSEKVE  454



>ref|XP_008388628.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=552

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAAD+VLG T 
Sbjct  388  KLEARLRNLEGRELGHFAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADAVLGKTT  447

Query  535  PTANEDEPELE  503
            P+ N ++P  E
Sbjct  448  PS-NXEKPXAE  457



>ref|XP_010464014.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=553

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG  
Sbjct  387  AKLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLLGQ-  445

Query  538  EPTANED  518
            +P  +ED
Sbjct  446  KPAKSED  452



>ref|XP_008370662.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=553

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAADSVLG T 
Sbjct  388  KLEARLRNLEGRELGHHAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADSVLGKTT  447

Query  535  PTANE  521
            P+  E
Sbjct  448  PSKTE  452



>ref|XP_006394992.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
 gb|ESQ32278.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
Length=536

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T 
Sbjct  388  KLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNSAADSLLGQT-  446

Query  535  PTANEDE  515
            P A+  E
Sbjct  447  PKADSAE  453



>gb|KHN25404.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=553

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+ADSV+G  
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADSVIGQM  446

Query  538  EPTANEDEPE  509
              +A +++ +
Sbjct  447  VNSAMDEDAQ  456



>ref|XP_003540996.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
Length=556

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+ADSV+G  
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADSVIGQM  446

Query  538  EPTANEDEPE  509
              +A +++ +
Sbjct  447  VNSAMDEDAQ  456



>gb|ACJ85748.1| unknown [Medicago truncatula]
 gb|AFK40384.1| unknown [Medicago truncatula]
 gb|AFK49114.1| unknown [Medicago truncatula]
Length=553

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAKAYN AADSV+   
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKAYNTAADSVI---  443

Query  538  EPTAN----EDEPE  509
            EP +N    ED PE
Sbjct  444  EPMSNSAMDEDTPE  457



>gb|KDP23603.1| hypothetical protein JCGZ_23436 [Jatropha curcas]
Length=577

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+L R AGSAKGKPKIE YDKDRKKG G LITPAKAYNPAAD+VLG T
Sbjct  387  AKLEARLRNLEGRELSRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKAYNPAADAVLGQT  446



>ref|XP_010546633.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=563

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGRDLGRL+GSAKGKPKIE YDKD+K G GALITPAK YN AADS+LG T
Sbjct  387  AKLEARLRNLEGRDLGRLSGSAKGKPKIEAYDKDKKAGSGALITPAKTYNTAADSLLGQT  446



>ref|XP_006408115.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
 gb|ESQ49568.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
Length=541

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G L TPAK YN AADS+LG T
Sbjct  387  AKLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLFTPAKTYNSAADSLLGQT  446



>ref|XP_003537858.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
 gb|KHN39811.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=551

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+ADSV+G  
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADSVIGQM  446

Query  538  EPTA-NEDEPE  509
              +A +ED  E
Sbjct  447  VDSAIDEDAQE  457



>gb|KDP35364.1| hypothetical protein JCGZ_10348 [Jatropha curcas]
Length=565

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEG++L R AGSAKGKPKIE YDKDRKKG GAL+T AK YNP+ADSVLG T 
Sbjct  388  KLEARLRNLEGKELSRSAGSAKGKPKIEAYDKDRKKGAGALLTAAKTYNPSADSVLGQTV  447

Query  535  PTANEDE  515
             T N++E
Sbjct  448  STGNDEE  454



>ref|XP_006287421.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
 gb|EOA20319.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
Length=551

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YNPAADS+L    
Sbjct  408  KLEARLRNLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNPAADSLL--QT  465

Query  535  PTANED  518
            PTA+ +
Sbjct  466  PTADSE  471



>ref|XP_011013586.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011013588.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-  539
            +LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+VLG T 
Sbjct  388  KLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVLGQTP  447

Query  538  EPTANEDEPE  509
            + TA + E E
Sbjct  448  DSTARKFEVE  457



>ref|XP_011032532.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032533.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032534.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-  539
            +LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+VLG T 
Sbjct  388  KLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVLGQTP  447

Query  538  EPTANEDEPE  509
            + TA + E E
Sbjct  448  DSTARKFEVE  457



>ref|XP_010550954.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
 ref|XP_010550955.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=539

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGRDLGRL+GS+KGKPKIE YDKD+K G GALITPAK YN AADS LG T
Sbjct  387  AKLEARLRNLEGRDLGRLSGSSKGKPKIEAYDKDKKAGSGALITPAKTYNTAADSFLGQT  446

Query  538  EPTA  527
              +A
Sbjct  447  PKSA  450



>ref|XP_003606983.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES89180.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=553

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YN AADSV+   
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNTAADSVI---  443

Query  538  EPTAN----EDEPE  509
            EP +N    ED PE
Sbjct  444  EPMSNSAMDEDTPE  457



>ref|XP_009342020.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=552

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAADSVLG   
Sbjct  388  KLEARLRNLEGRELGHHAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADSVLGKMT  447

Query  535  PTANE  521
            P+  E
Sbjct  448  PSKTE  452



>ref|XP_010025094.1| PREDICTED: probable nucleolar protein 5-2 [Eucalyptus grandis]
 gb|KCW61686.1| hypothetical protein EUGRSUZ_H04416 [Eucalyptus grandis]
Length=579

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNP+ADS LG T
Sbjct  387  AKLEARLRNLEGRELGHSAGSAKGKPKIEVYDKDRKKGAGALITAAKTYNPSADSTLGQT  446

Query  538  EPTANEDEPELEK  500
               A  +  E EK
Sbjct  447  LNNAAGNGEEAEK  459



>gb|KJB26510.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=409

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSVLG T
Sbjct  229  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVLGQT  287

Query  538  EPTANEDE  515
              +   DE
Sbjct  288  TNSGALDE  295



>gb|KJB26512.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=531

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSVLG T
Sbjct  351  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVLGQT  409

Query  538  EPTANEDE  515
              +   DE
Sbjct  410  TNSGALDE  417



>ref|XP_006382714.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 ref|XP_006382715.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60511.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60512.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
Length=562

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-  539
            +LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+VLG T 
Sbjct  388  KLEARLRNLEGKELGRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVLGQTP  447

Query  538  EPTANEDEPE  509
            + TA + E E
Sbjct  448  DSTARKFEVE  457



>ref|XP_010421655.1| PREDICTED: probable nucleolar protein 5-1 isoform X1 [Camelina 
sativa]
Length=419

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            +LEAR RNLEGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  278  KLEARLRNLEGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLL  333



>ref|XP_010904781.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=588

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEGR+LGR AGS+KGKPKIEVYDKDRK+G GALITPAK YNPA+D VLG T
Sbjct  387  AKLEARLRVLEGRELGRSAGSSKGKPKIEVYDKDRKQGAGALITPAKTYNPASDLVLGGT  446

Query  538  EPTANEDE  515
               + E E
Sbjct  447  TEPSGEQE  454



>gb|KJB26509.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=567

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSVLG T
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVLGQT  445

Query  538  EPTANEDE  515
              +   DE
Sbjct  446  TNSGALDE  453



>gb|AAC16330.1| SAR DNA-binding protein-1 [Pisum sativum]
Length=560

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKD+KKG G LITPAK YN AADSV+   
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDKKKGAGGLITPAKTYNTAADSVIHQK  446

Query  538  EPTA-NEDEPE  509
              +A +ED PE
Sbjct  447  SNSAMDEDTPE  457



>ref|XP_003611089.1| SAR DNA-binding protein-1 [Medicago truncatula]
Length=480

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YN AADS++   
Sbjct  277  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNTAADSIIDKK  336

Query  538  EPTA-NEDEPELEKMD  494
              +A +ED  EL   D
Sbjct  337  SDSAMDEDTEELSAAD  352



>ref|XP_010241493.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Nelumbo 
nucifera]
Length=580

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 56/73 (77%), Gaps = 6/73 (8%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+L R AGS KGKPKIE YDKDRKKG GALITPAK YN +ADS+LG T
Sbjct  387  AKLEARLRNLEGRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNTSADSILGRT  446

Query  538  EPTANEDEPELEK  500
                   EP +EK
Sbjct  447  ------TEPVIEK  453



>ref|XP_010241470.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241474.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241483.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 56/73 (77%), Gaps = 6/73 (8%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEGR+L R AGS KGKPKIE YDKDRKKG GALITPAK YN +ADS+LG T
Sbjct  391  AKLEARLRNLEGRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNTSADSILGRT  450

Query  538  EPTANEDEPELEK  500
                   EP +EK
Sbjct  451  ------TEPVIEK  457



>ref|XP_003611088.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES94046.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=590

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YN AADS++   
Sbjct  387  AKLEARLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNTAADSIIDKK  446

Query  538  EPTA-NEDEPELEKMD  494
              +A +ED  EL   D
Sbjct  447  SDSAMDEDTEELSAAD  462



>ref|XP_010421656.1| PREDICTED: probable nucleolar protein 5-1 isoform X2 [Camelina 
sativa]
Length=529

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            +LEAR RNLEGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  388  KLEARLRNLEGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLL  443



>ref|XP_010494044.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=531

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            +LEAR RNLEGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  388  KLEARLRNLEGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLL  443



>ref|XP_007030687.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11189.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
Length=536

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDR+KG G LITP K YNPAADS+LG T
Sbjct  384  AKLEARLRTLEGKELGRSAGSAKGKPKIEVYDKDRRKGAG-LITPVKTYNPAADSLLGQT  442

Query  538  EPTANEDEPELEK  500
             P   +  P+ +K
Sbjct  443  TPDEQDTVPKKKK  455



>ref|XP_002319598.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
 gb|EEE95521.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
Length=561

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD++LG T
Sbjct  388  KLEARLRNLEGKELGRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAILGQT  446



>ref|XP_010938712.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=600

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
            A+LEAR R LEGR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YNP+ D VLG  
Sbjct  387  AKLEARLRVLEGRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSTDLVLGQS  446

Query  541  TEPTA-NEDEPE  509
            TEP A + DE E
Sbjct  447  TEPAAKSADEQE  458



>emb|CDX80674.1| BnaC07g27700D [Brassica napus]
Length=536

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR R LEG+DLGRL+GSAKGKPKIEVYDKD+K G G LITPAK YN AADS+LG T 
Sbjct  388  KLEARLRALEGKDLGRLSGSAKGKPKIEVYDKDKKSGSGGLITPAKTYNTAADSLLGQTS  447

Query  535  PTAN  524
               N
Sbjct  448  TAEN  451



>ref|XP_011003824.1| PREDICTED: probable nucleolar protein 5-2 [Populus euphratica]
Length=563

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LEAR RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD++LG T
Sbjct  388  KLEARLRNLEGKELGRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAILGQT  446



>ref|NP_187157.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|Q9MAB3.1|NOP5B_ARATH RecName: Full=Probable nucleolar protein 5-2; AltName: Full=MAR-binding 
NOP56/58 homolog 2; AltName: Full=Nucleolar protein 
58-2 [Arabidopsis thaliana]
 gb|AAF27012.1|AC009177_2 putative SAR DNA-binding protein-1 [Arabidopsis thaliana]
 gb|AAG40837.1|AF302491_1 NOP58-like protein [Arabidopsis thaliana]
 gb|AAL06533.1|AF412080_1 AT3g05060/T12H1_2 [Arabidopsis thaliana]
 gb|AEE74181.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GS+KGKPKIEVY+KD+K G G LITPAK YN AADS+LG T
Sbjct  388  AKLEARLRNLEGKDLGRLSGSSKGKPKIEVYNKDKKMGSGGLITPAKTYNTAADSLLGET  447



>gb|KJB82560.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82561.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82562.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82564.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82565.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82566.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=564

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADSVL   
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSVLSQI  445

Query  538  EPTANEDE  515
              TA  DE
Sbjct  446  TNTAALDE  453



>ref|XP_009364569.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=550

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAAD+VLG   
Sbjct  388  KLEARLRNLEGRELGHSAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADAVLGKMA  447

Query  535  PTANEDEPELE  503
            P  N ++P  E
Sbjct  448  P--NTEKPAAE  456



>ref|XP_009411704.1| PREDICTED: probable nucleolar protein 5-1 [Musa acuminata subsp. 
malaccensis]
Length=588

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEGR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD VLG T
Sbjct  387  AKLEARLRVLEGRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVLGQT  446



>ref|XP_002884489.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60748.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR RNLEG+DLGRL+GSAKGKPKIEVY+KD+K G G LITPAK YN AADS+LG +
Sbjct  388  AKLEARLRNLEGKDLGRLSGSAKGKPKIEVYNKDKKMGSGGLITPAKTYNTAADSLLGES  447



>ref|XP_007030686.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
 gb|EOY11188.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
Length=565

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDR+KG G LITP K YNPAADS+LG T
Sbjct  387  AKLEARLRTLEGKELGRSAGSAKGKPKIEVYDKDRRKGAG-LITPVKTYNPAADSLLGQT  445

Query  538  EPTANEDEPELEK  500
             P   +  P+ +K
Sbjct  446  TPDEQDTVPKKKK  458



>ref|XP_010687356.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A+LEAR RNLEG++LGR AGSAKGKP+IEVYDKD KKG GALIT AK YNPAADS+LG
Sbjct  387  AKLEARLRNLEGKELGRSAGSAKGKPQIEVYDKDHKKGAGALITAAKTYNPAADSILG  444



>emb|CAK22424.1| matrix attachment region binding protein [Beta vulgaris]
Length=572

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A+LEAR RNLEG++LGR AGSAKGKP+IEVYDKD KKG GALIT AK YNPAADS+LG
Sbjct  387  AKLEARLRNLEGKELGRSAGSAKGKPQIEVYDKDHKKGAGALITAAKTYNPAADSILG  444



>ref|XP_010674932.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A+LEAR RNLEG++LGR AGSAKGKP+IEVYDKD KKG GALITP K YNPAADS LG
Sbjct  387  AKLEARLRNLEGKELGRSAGSAKGKPQIEVYDKDHKKGVGALITPGKTYNPAADSFLG  444



>gb|KHG01259.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=548

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSV G T
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVRGQT  445

Query  538  EPTANEDE  515
              +   DE
Sbjct  446  TSSGALDE  453



>ref|XP_009382561.1| PREDICTED: probable nucleolar protein 5-2 [Musa acuminata subsp. 
malaccensis]
Length=585

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEGR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD V G T
Sbjct  387  AKLEARLRVLEGRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVFGQT  446

Query  538  EPTA  527
               A
Sbjct  447  TDLA  450



>ref|XP_009111930.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
Length=536

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LEAR R+LEG+DLGRL+GSAKGKPK+EVYDKD+K G G LITPAK YN AADS++G T
Sbjct  388  KLEARLRSLEGKDLGRLSGSAKGKPKVEVYDKDKKSGSGGLITPAKTYNTAADSLMGQT  446



>emb|CDY00004.1| BnaC09g02970D [Brassica napus]
Length=536

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LEAR R+LEG+DLGRL+GSAKGKPK+EVYDKD+K G G LITPAK YN AADS++G T
Sbjct  388  KLEARLRSLEGKDLGRLSGSAKGKPKVEVYDKDKKSGSGGLITPAKTYNTAADSLIGQT  446



>ref|XP_008799299.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
 ref|XP_008799300.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
Length=497

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEGR+LGR AGS+KGKPKIEVYDKDRKKG GALIT AK YNP++D VLG T
Sbjct  387  AKLEARLRVLEGRELGRSAGSSKGKPKIEVYDKDRKKGAGALITAAKTYNPSSDLVLGGT  446

Query  538  -EPTANED  518
             EP+  ++
Sbjct  447  IEPSGEQE  454



>emb|CDY19706.1| BnaA09g03590D [Brassica napus]
Length=535

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LEAR R+LEG+DLGRL+GSAKGKPK+EVYDKD+K G G LITPAK YN AADS++G T
Sbjct  388  KLEARLRSLEGKDLGRLSGSAKGKPKVEVYDKDKKSGSGGLITPAKTYNTAADSLIGQT  446



>ref|XP_009151230.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
 emb|CDX86179.1| BnaA06g28960D [Brassica napus]
Length=537

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            ++EAR R LEG+DLGRL+GSAKGKPKIEVYDKD+K G G LITPAK YN AADS+LG T 
Sbjct  388  KVEARLRALEGKDLGRLSGSAKGKPKIEVYDKDKKNGSGGLITPAKTYNTAADSLLGQTS  447

Query  535  PTAN  524
               N
Sbjct  448  TAEN  451



>emb|CAE45597.1| SAR DNA-binding protein-like protein [Lotus japonicus]
Length=537

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LE R RNLEG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+V+   
Sbjct  373  AKLELRLRNLEGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVISQK  432

Query  538  EPTA-NEDEPE  509
              +A +ED  E
Sbjct  433  SDSAMDEDTHE  443



>dbj|BAD11331.1| BRI1-KD interacting protein 102 [Oryza sativa Japonica Group]
Length=189

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG +
Sbjct  10   KLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  68



>ref|XP_008796212.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Phoenix 
dactylifera]
Length=564

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
            A+LEAR R LEGR+L R AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD VLG  
Sbjct  387  AKLEARLRVLEGRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVLGQS  446

Query  541  TEP  533
            TEP
Sbjct  447  TEP  449



>ref|XP_008796213.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Phoenix 
dactylifera]
Length=583

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
            A+LEAR R LEGR+L R AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD VLG  
Sbjct  387  AKLEARLRVLEGRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVLGQS  446

Query  541  TEP  533
            TEP
Sbjct  447  TEP  449



>gb|KHG00213.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
 gb|KHG00214.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=562

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADSVL   
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSVLSQI  445

Query  538  EPTANEDE  515
              TA  +E
Sbjct  446  TNTAALNE  453



>ref|XP_010455156.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=529

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            +LEAR R LEGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS L
Sbjct  388  KLEARLRTLEGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSFL  443



>gb|KJB45047.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
 gb|KJB45048.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=567

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADS++G  
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSLIGQI  445

Query  541  TEPTANEDE  515
            T  TA E++
Sbjct  446  TNSTALEEQ  454



>gb|KHG01423.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=567

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADS++G  
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSLIGQI  445

Query  541  TEPTANEDE  515
            T  TA E++
Sbjct  446  TNSTALEEQ  454



>ref|NP_198064.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|O04658.2|NOP5A_ARATH RecName: Full=Probable nucleolar protein 5-1; AltName: Full=MAR-binding 
NOP56/58 homolog 1; AltName: Full=NOP58-like protein 
F108; AltName: Full=Nucleolar protein 58-1 [Arabidopsis 
thaliana]
 gb|AAG40836.1|AF302490_1 NOP58-like protein F108 [Arabidopsis thaliana]
 gb|AAL66978.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20318.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AED93652.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            +LEAR R LEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  388  KLEARLRTLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLL  443



>ref|XP_002874406.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50665.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            +LEAR R LEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  388  KLEARLRTLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLL  443



>ref|XP_004239682.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
 ref|XP_010321330.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=513

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
             +LEAR R LEG++LG+ AGSAKGKPKIE YDKDRKKG GALITPAK YNP+AD+VLG
Sbjct  387  VKLEARLRALEGKELGKSAGSAKGKPKIEAYDKDRKKGAGALITPAKVYNPSADAVLG  444



>ref|XP_006362168.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362169.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Solanum 
tuberosum]
Length=548

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 2/61 (3%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++L + AGSAKGKPKIEVYDKDRKK  G LITPAK YNP+ADSV+GHT
Sbjct  387  AKLEARLRALEGKELSKSAGSAKGKPKIEVYDKDRKK--GGLITPAKVYNPSADSVMGHT  444

Query  538  E  536
            E
Sbjct  445  E  445



>gb|AAC16331.1| SAR DNA-binding protein-2 [Pisum sativum]
Length=550

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 7/74 (9%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LG  AGSAKGKPKIE YDKD+KKG G LITPAK YN AADSV+   
Sbjct  387  AKLEARLRGLEGKELGHFAGSAKGKPKIEAYDKDKKKGSGGLITPAKTYNTAADSVI---  443

Query  538  EPTAN----EDEPE  509
            EP +N    ED PE
Sbjct  444  EPKSNSAMDEDTPE  457



>gb|KFK23538.1| hypothetical protein AALP_AAs63573U000200 [Arabis alpina]
Length=483

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LE R RNLEG+DLGRL+GSAKGKPK+EVY+KD+K G G L T AK YNPAADS+LG  
Sbjct  369  AKLEVRLRNLEGKDLGRLSGSAKGKPKVEVYNKDKKIGYGGLDTSAKTYNPAADSLLGQA  428

Query  538  EPTANE  521
              T+ E
Sbjct  429  STTSEE  434



>dbj|BAA31260.1| SAR DNA binding protein [Oryza sativa]
Length=485

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
             +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  
Sbjct  388  VKLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  447

Query  541  TEPT  530
            TE T
Sbjct  448  TEET  451



>ref|XP_011457678.1| PREDICTED: probable nucleolar protein 5-2 [Fragaria vesca subsp. 
vesca]
Length=548

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            ++EAR R+LEG+ L + AGS KGKP IE YDKDRKKG G LIT AKAYNPAADSVLG T 
Sbjct  393  KVEARIRSLEGKALSQSAGSTKGKPLIEAYDKDRKKGAGGLITAAKAYNPAADSVLGQTT  452

Query  535  PTANEDEPELEK  500
            P    DE   EK
Sbjct  453  PAGKTDETTNEK  464



>ref|NP_001050112.1| Os03g0350100 [Oryza sativa Japonica Group]
 dbj|BAF12026.1| Os03g0350100, partial [Oryza sativa Japonica Group]
Length=556

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
             +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  
Sbjct  388  VKLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  447

Query  541  TEPT  530
            TE T
Sbjct  448  TEET  451



>gb|ABF95925.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95926.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95927.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89998.1| hypothetical protein OsI_11565 [Oryza sativa Indica Group]
 dbj|BAG94281.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
             +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  
Sbjct  388  VKLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  447

Query  541  TEPT  530
            TE T
Sbjct  448  TEET  451



>gb|EEE59058.1| hypothetical protein OsJ_10836 [Oryza sativa Japonica Group]
Length=525

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
             +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  
Sbjct  345  VKLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  404

Query  541  TEPT  530
            TE T
Sbjct  405  TEET  408



>ref|NP_001050113.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|ABF95928.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12027.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|EAZ26910.1| hypothetical protein OsJ_10837 [Oryza sativa Japonica Group]
 dbj|BAG93321.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
             +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG +
Sbjct  388  VKLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  447



>ref|XP_002456868.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
 gb|EES01988.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
Length=568

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-T  539
            +LE R + LEGR+LG+ AGS KGKPKIEVY+KDRKKG GAL TPAK YNPAAD VLGH T
Sbjct  389  KLETRLQVLEGRELGKSAGSTKGKPKIEVYEKDRKKGAGALTTPAKTYNPAADLVLGHST  448

Query  538  EPTANEDE  515
            E T  + E
Sbjct  449  EETPKKSE  456



>ref|XP_004247627.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=547

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 2/60 (3%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++L + AGSAKGKPKIEVYDKDRKK  G LITPAK YNP+ADSV+GHT
Sbjct  387  AKLEARLRALEGKELSKSAGSAKGKPKIEVYDKDRKK--GGLITPAKVYNPSADSVMGHT  444



>ref|XP_004507477.1| PREDICTED: probable nucleolar protein 5-1-like [Cicer arietinum]
Length=553

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LEAR R LEG++LGR AGSAKGKPKIE YDKD KKG GALIT AK YN AADSV+   
Sbjct  387  AKLEARLRALEGKELGRFAGSAKGKPKIEAYDKDLKKGAGALITQAKTYNTAADSVIDVK  446

Query  538  EPTANEDEPE  509
              TA E++ +
Sbjct  447  SKTAMEEDIQ  456



>gb|EEC75255.1| hypothetical protein OsI_11566 [Oryza sativa Indica Group]
Length=657

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
             +LE R R LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG +
Sbjct  477  VKLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQS  536



>ref|XP_006650080.1| PREDICTED: probable nucleolar protein 5-2-like [Oryza brachyantha]
Length=565

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-  542
             +LE R R LEG++LGR AGSAKGKPKIEVY+KDRKKG GALIT AK YNPAAD VLG  
Sbjct  388  VKLETRLRVLEGKELGRSAGSAKGKPKIEVYEKDRKKGAGALITAAKTYNPAADLVLGQS  447

Query  541  TEPT  530
            TE T
Sbjct  448  TEET  451



>ref|XP_008455669.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis melo]
 gb|ADN33903.1| MAR-binding protein [Cucumis melo subsp. melo]
Length=554

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A+LEAR R+LEG++LG +AGSAKGKPKIE YDKDRKK  G LIT AK YNPAADS+LG
Sbjct  387  AKLEARLRSLEGKELGHVAGSAKGKPKIEAYDKDRKKSIGGLITAAKTYNPAADSLLG  444



>ref|XP_006345813.1| PREDICTED: probable nucleolar protein 5-2-like [Solanum tuberosum]
Length=541

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
             +LE R R LEG++LG+ AGSAKGKPKIE YDKDRKKG GALITPAK YN +AD+VLG T
Sbjct  387  VKLEVRLRALEGKELGKSAGSAKGKPKIEAYDKDRKKGAGALITPAKVYNLSADAVLGCT  446

Query  538  EPTANEDEP  512
                + DEP
Sbjct  447  N-NESVDEP  454



>emb|CDY50583.1| BnaC02g39570D [Brassica napus]
Length=525

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR R+LEG+DLGRLAGSAKGKPKIEVY+KD+K G G LI PA+ YN AADS+L  T 
Sbjct  378  KLEARLRSLEGKDLGRLAGSAKGKPKIEVYNKDKKMGSGGLIAPAETYNTAADSLLVQTT  437

Query  535  PTA  527
             +A
Sbjct  438  VSA  440



>emb|CDY52494.1| BnaAnng11410D [Brassica napus]
Length=531

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR R+LEG+DLGRLAGSAKGKPKIEVY+KD+K G G LI PAK YN AADS+L   E
Sbjct  388  KLEARLRSLEGKDLGRLAGSAKGKPKIEVYNKDKKMGSGGLIAPAKTYNTAADSLLVSAE  447



>ref|XP_004139213.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156444.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN60839.1| hypothetical protein Csa_2G012710 [Cucumis sativus]
Length=544

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A+LEAR R+LEG++LG +AGSAKGKP+IE YDKDRKK  G LIT AK YNPAADS+LG
Sbjct  387  AKLEARLRSLEGKELGHVAGSAKGKPRIEAYDKDRKKSIGGLITAAKTYNPAADSLLG  444



>ref|XP_004139212.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156443.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
Length=566

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A+LEAR R+LEG++LG +AGSAKGKP+IE YDKDRKK  G LIT AK YNPAADS+LG
Sbjct  409  AKLEARLRSLEGKELGHVAGSAKGKPRIEAYDKDRKKSIGGLITAAKTYNPAADSLLG  466



>gb|AFW88399.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=452

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LE R + LEGR+LG+ AGS KGKPKIEVY+KDRKKG GAL TPAK YNPAAD VL    
Sbjct  279  KLETRLQVLEGRELGKSAGSTKGKPKIEVYEKDRKKGTGALTTPAKTYNPAADLVLTEET  338

Query  535  PTANE  521
            P  +E
Sbjct  339  PKKSE  343



>ref|XP_008660157.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008660158.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 gb|AFW88396.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88397.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88398.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=562

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LE R + LEGR+LG+ AGS KGKPKIEVY+KDRKKG GAL TPAK YNPAAD VL    
Sbjct  389  KLETRLQVLEGRELGKSAGSTKGKPKIEVYEKDRKKGTGALTTPAKTYNPAADLVLTEET  448

Query  535  PTANE  521
            P  +E
Sbjct  449  PKKSE  453



>ref|XP_002512277.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF49729.1| nucleolar protein nop56, putative [Ricinus communis]
Length=575

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LE R R+LEGR+L R AGS KGKPKIE YDKDRKKG G LITPAKAYN +AD+VL  T
Sbjct  387  AKLEERLRSLEGRELSRSAGSNKGKPKIEAYDKDRKKGAGGLITPAKAYNASADAVLEQT  446



>ref|XP_008655653.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008655660.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 tpg|DAA45362.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=564

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LE R + LEGR+LG+ AGS KGKPKIEVY+KDRK+G GAL TPAK YNPAAD VL    
Sbjct  389  KLETRLQVLEGRELGKSAGSTKGKPKIEVYEKDRKQGAGALTTPAKTYNPAADLVLTEET  448

Query  535  PTANE  521
            P  +E
Sbjct  449  PKKSE  453



>ref|XP_004984387.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=568

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-T  539
            +LE R + LE ++ G+ AGS KGKPKIEVY+KDRKKG GALITPAK YNPA D VLG  T
Sbjct  389  KLETRLQVLENKEFGKSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPATDVVLGQST  448

Query  538  EPTANEDE  515
            E T  + E
Sbjct  449  EETPKKSE  456



>ref|XP_004984388.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=567

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-T  539
            +LE R + LE ++ G+ AGS KGKPKIEVY+KDRKKG GALITPAK YNPA D VLG  T
Sbjct  389  KLETRLQVLENKEFGKSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPATDVVLGQST  448

Query  538  EPTANEDE  515
            E T  + E
Sbjct  449  EETPKKSE  456



>gb|KFK37913.1| hypothetical protein AALP_AA3G046300 [Arabis alpina]
Length=529

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            A+LE R RNLEG+ LGRL+GSAKGKP IEVY+KDRK G G L TPAK YN AAD++L  T
Sbjct  387  AKLEVRLRNLEGKSLGRLSGSAKGKPMIEVYEKDRKMGYGGLNTPAKTYNSAADALLEKT  446

Query  538  EPT  530
             PT
Sbjct  447  -PT  448



>ref|XP_003562489.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG-HT  539
            +LE R R LEG++LGR AGSAKGKPKIE Y+KDR KG GALITPAK YNPA+D VLG  T
Sbjct  388  KLETRLRVLEGKELGRSAGSAKGKPKIEAYEKDR-KGAGALITPAKTYNPASDLVLGKST  446

Query  538  EPTANEDE  515
            E T  + E
Sbjct  447  EETPKKSE  454



>gb|AFW84118.1| hypothetical protein ZEAMMB73_870642 [Zea mays]
Length=586

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-T  539
            +LE R + LEGR+LG+ AGS KGKPKIEVY+KDRK G  AL TPAK YNPAAD VLG  T
Sbjct  381  KLETRLQVLEGRELGKSAGSTKGKPKIEVYEKDRKNGARALTTPAKTYNPAADLVLGQST  440

Query  538  EPTANEDE  515
            E T  + E
Sbjct  441  EETPKKSE  448



>ref|XP_003557835.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LE R R LEG++LGR AGS KGKPKIEVY+KDR KG GALITPAK YNP+AD VL  +
Sbjct  389  KLETRLRVLEGKELGRSAGSTKGKPKIEVYEKDR-KGAGALITPAKTYNPSADLVLAKS  446



>ref|XP_006838803.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
 gb|ERN01372.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
Length=591

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  545
            A++EAR R+LEGR+LGR AGS KGK K+EVY+KDRKK    L+T AK YNPAADS LG
Sbjct  387  AKIEARLRSLEGRELGRAAGSTKGKMKVEVYNKDRKKSDAGLLTAAKTYNPAADSTLG  444



>gb|EMS65034.1| hypothetical protein TRIUR3_04158 [Triticum urartu]
Length=560

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LE R R LEG++LGR AGS KGKPKIE Y+KDR KG GALITPAK YN AAD VLG T
Sbjct  388  KLETRLRVLEGKELGRSAGSTKGKPKIEAYEKDR-KGGGALITPAKTYNSAADLVLGQT  445



>gb|AAB61073.1| similar to S. cerevisiae SIK1P (PID:g984964) [Arabidopsis thaliana]
Length=439

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKA  575
            +LEAR R LEG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK 
Sbjct  388  KLEARLRTLEGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKV  434



>dbj|BAN15014.1| SAR DNA binding protein [Bromus inermis]
Length=539

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  539
            +LE   R LEG++L + AGS KGKPKIEVY+KDRK G G LITPAKAYNP+AD VL  +
Sbjct  389  KLETMLRVLEGKELAKSAGSMKGKPKIEVYEKDRKNGAG-LITPAKAYNPSADLVLAQS  446



>ref|XP_002533223.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF29163.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LEAR RNLEGR+LGR AGSAKGK KIE YDKDRKKG GAL+  AK YNP+ADS+LG T 
Sbjct  388  KLEARLRNLEGRELGRSAGSAKGKTKIEAYDKDRKKGAGALLAAAKTYNPSADSILGQTL  447

Query  535  P--TANEDE  515
               T N++E
Sbjct  448  SFNTVNDEE  456



>gb|KJB26511.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=450

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAK  578
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK
Sbjct  387  AKLEARLRALEGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAK  432



>ref|XP_007030688.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
 gb|EOY11190.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
Length=443

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKA  575
            A+LEAR R LEG++LGR AGSAKGKPKIEVYDKDR+KG G LITP K 
Sbjct  387  AKLEARLRTLEGKELGRSAGSAKGKPKIEVYDKDRRKGAG-LITPVKV  433



>tpg|DAA45361.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=450

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  536
            +LE R + LEGR+LG+ AGS KGKPKIEVY+KDRK+G GAL TPAK       SV+    
Sbjct  389  KLETRLQVLEGRELGKSAGSTKGKPKIEVYEKDRKQGAGALTTPAK-----VSSVMISCS  443

Query  535  PT  530
            P+
Sbjct  444  PS  445



>ref|XP_002985284.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
 gb|EFJ13778.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
Length=576

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            A++EAR R LEGR LG+ +G+AKGK KIE YDKDRK     L+T AKAY   AD  L
Sbjct  387  AKVEARLRQLEGRALGKASGAAKGKAKIEAYDKDRKGATPGLLTAAKAYETQADITL  443



>gb|AAN72071.1| SAR DNA-binding protein - like [Arabidopsis thaliana]
Length=423

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKK  608
            +LEAR R LEG+DLGRL+GSAKGKPKIEVYDKD+KK
Sbjct  388  KLEARLRTLEGKDLGRLSGSAKGKPKIEVYDKDKKK  423



>ref|XP_002970093.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
 gb|EFJ29217.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
Length=575

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            A++EAR R LEGR LG+ +G+AKGK KIE YDKDRK     L+T AK Y   AD  L
Sbjct  387  AKVEARLRQLEGRALGKASGAAKGKAKIEAYDKDRKGATPGLLTAAKTYETQADITL  443



>ref|XP_001753892.1| predicted protein [Physcomitrella patens]
 gb|EDQ81214.1| predicted protein [Physcomitrella patens]
Length=578

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGSA-KGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH  542
            A++EAR R LEGR LG+   SA KGKP I+ Y+KDRK G   L++ AK YNP+AD  +  
Sbjct  387  AKVEARLRQLEGRALGKTPVSASKGKPNIQAYEKDRKSGTPGLLSAAKVYNPSADVTMD-  445

Query  541  TEPT  530
             EPT
Sbjct  446  -EPT  448



>ref|XP_001756465.1| predicted protein [Physcomitrella patens]
 gb|EDQ78861.1| predicted protein [Physcomitrella patens]
Length=558

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = -1

Query  718  AQLEARXRNLEGRDLGRLAGS--AKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  548
            A++EAR R LEGR LG+   +  +KGKP I+VYDKDRK G   L++  K YN +AD  +
Sbjct  387  AKVEARLRQLEGRALGKSISTPGSKGKPNIQVYDKDRKSGTPGLLSAGKVYNTSADVTM  445



>emb|CDP04715.1| unnamed protein product [Coffea canephora]
Length=422

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  715  QLEARXRNLEGRDLGRLAGSAKGKPKIEVYDK  620
            +LEAR R+LEGR+L R AGSAKGKPKIEVYDK
Sbjct  388  KLEARLRSLEGRELNRAAGSAKGKPKIEVYDK  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410