BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF034A07

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM12952.1|  auxin-regulated protein                                 263   2e-82   Zinnia elegans [garden zinnia]
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      259   4e-81   Sesamum indicum [beniseed]
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      256   4e-80   Cicer arietinum [garbanzo]
gb|ABI36491.1|  AUX/IAA8A                                               249   4e-80   Malus domestica [apple tree]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    255   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             255   3e-79   Prunus persica
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           255   4e-79   Prunus mume [ume]
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 253   4e-79   Medicago truncatula
gb|ABY48132.1|  GH1 protein                                             253   5e-79   Medicago truncatula
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    255   5e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    255   5e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    253   5e-79   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             253   6e-79   Phaseolus vulgaris [French bean]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             253   6e-79   Phaseolus vulgaris [French bean]
gb|AGV54485.1|  auxin-responsive protein                                253   1e-78   Phaseolus vulgaris [French bean]
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    253   1e-78   Cicer arietinum [garbanzo]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           253   2e-78   Pyrus x bretschneideri [bai li]
gb|ADL36578.1|  ARF domain class transcription factor                   253   2e-78   Malus domestica [apple tree]
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      252   3e-78   Sesamum indicum [beniseed]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             252   4e-78   Citrus clementina [clementine]
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      252   5e-78   Citrus sinensis [apfelsine]
gb|ABW24025.1|  aux/IAA protein                                         244   7e-78   Eucommia ulmoides
gb|KHN04889.1|  Auxin-responsive protein IAA8                           248   9e-78   Glycine soja [wild soybean]
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    251   9e-78   Eucalyptus grandis [rose gum]
ref|XP_007047689.1|  Transcription factor, putative isoform 3           249   2e-77   
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           249   2e-77   Glycine max [soybeans]
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    249   3e-77   
gb|AAB70005.1|  GH1 protein                                             249   3e-77   Glycine max [soybeans]
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      250   4e-77   Nelumbo nucifera [Indian lotus]
ref|XP_007047687.1|  Transcription factor, putative isoform 1           249   4e-77   Theobroma cacao [chocolate]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           249   5e-77   Fragaria vesca subsp. vesca
gb|ACJ84551.1|  unknown                                                 248   1e-76   Medicago truncatula
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             247   2e-76   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                246   3e-76   Erythranthe guttata [common monkey flower]
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    246   7e-76   Glycine max [soybeans]
gb|KHN46011.1|  Auxin-responsive protein IAA9                           245   7e-76   Glycine soja [wild soybean]
gb|AFK38170.1|  unknown                                                 245   9e-76   Lotus japonicus
gb|KHN22187.1|  Auxin-responsive protein IAA9                           245   1e-75   Glycine soja [wild soybean]
gb|AFK49626.1|  unknown                                                 245   1e-75   Medicago truncatula
gb|KJB18136.1|  hypothetical protein B456_003G035700                    245   2e-75   Gossypium raimondii
emb|CDP00957.1|  unnamed protein product                                244   6e-75   Coffea canephora [robusta coffee]
gb|AFZ78618.1|  hypothetical protein                                    243   8e-75   Populus tomentosa [Chinese white poplar]
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      243   9e-75   Populus euphratica
emb|CAC84706.1|  aux/IAA protein                                        243   1e-74   Populus tremula x Populus tremuloides
emb|CBI19314.3|  unnamed protein product                                241   1e-74   Vitis vinifera
ref|XP_002302351.1|  auxin-responsive family protein                    243   1e-74   Populus trichocarpa [western balsam poplar]
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                     243   1e-74   Gossypium arboreum [tree cotton]
ref|NP_001268170.1|  Aux/IAA protein                                    242   2e-74   Vitis vinifera
gb|AAL92850.1|  Aux/IAA protein                                         242   2e-74   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              242   2e-74   Vitis vinifera
gb|KDP32156.1|  hypothetical protein JCGZ_12617                         242   4e-74   Jatropha curcas
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like      241   9e-74   Cucumis sativus [cucumbers]
ref|XP_002528895.1|  transcription factor, putative                     241   1e-73   Ricinus communis
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     238   4e-73   Gossypium arboreum [tree cotton]
gb|ABM53871.1|  IAA3                                                    232   4e-73   Cestrum elegans
gb|KJB71166.1|  hypothetical protein B456_011G109000                    238   4e-73   Gossypium raimondii
gb|KJB71165.1|  hypothetical protein B456_011G109000                    238   5e-73   Gossypium raimondii
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      238   5e-73   Nicotiana tomentosiformis
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      237   1e-72   Nicotiana sylvestris
ref|NP_001275473.1|  Aux/IAA protein                                    236   2e-72   Solanum tuberosum [potatoes]
gb|ABB55368.1|  Aux/IAA protein-like                                    236   2e-72   Solanum tuberosum [potatoes]
emb|CAI77628.1|  Aux/IAA protein                                        234   6e-72   Solanum lycopersicum
ref|XP_010105114.1|  Auxin-responsive protein IAA9                      236   8e-72   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          236   9e-72   Amborella trichopoda
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    234   1e-71   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 234   2e-71   
emb|CAD10639.1|  IAA9 protein                                           234   3e-71   Nicotiana tabacum [American tobacco]
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like      234   4e-71   Cucumis melo [Oriental melon]
gb|ABM53870.1|  IAA2                                                    226   4e-71   Cestrum elegans
ref|XP_007047688.1|  Transcription factor, putative isoform 2           233   8e-71   Theobroma cacao [chocolate]
gb|KJB64033.1|  hypothetical protein B456_010G031600                    232   9e-71   Gossypium raimondii
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 232   2e-70   Malus domestica [apple tree]
gb|KJB58777.1|  hypothetical protein B456_009G226000                    232   2e-70   Gossypium raimondii
gb|KJB58781.1|  hypothetical protein B456_009G226000                    232   3e-70   Gossypium raimondii
emb|CDP02673.1|  unnamed protein product                                232   3e-70   Coffea canephora [robusta coffee]
gb|KJB64027.1|  hypothetical protein B456_010G031600                    231   3e-70   Gossypium raimondii
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    231   4e-70   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                229   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             231   6e-70   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      231   6e-70   Pyrus x bretschneideri [bai li]
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         230   1e-69   Jatropha curcas
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      230   1e-69   Prunus mume [ume]
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             231   1e-69   Prunus persica
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg             228   1e-69   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          229   2e-69   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    229   2e-69   Citrus sinensis [apfelsine]
gb|ABR17764.1|  unknown                                                 228   3e-69   Picea sitchensis
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      229   3e-69   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 229   3e-69   Cucumis sativus [cucumbers]
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    229   3e-69   
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like      228   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      228   4e-69   Cucumis melo [Oriental melon]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     228   4e-69   Gossypium arboreum [tree cotton]
gb|AEI70507.1|  auxin-responsive protein                                228   4e-69   Gossypium hirsutum [American cotton]
gb|ACJ84768.1|  unknown                                                 223   5e-69   Medicago truncatula
ref|XP_003543635.1|  PREDICTED: auxin-responsive protein IAA27-like     226   5e-69   Glycine max [soybeans]
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    227   6e-69   Fragaria vesca subsp. vesca
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             228   6e-69   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             228   6e-69   Phaseolus vulgaris [French bean]
gb|KJB18140.1|  hypothetical protein B456_003G035700                    229   6e-69   Gossypium raimondii
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    228   8e-69   Fragaria vesca subsp. vesca
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   228   1e-68   Citrus sinensis [apfelsine]
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...    227   1e-68   
ref|XP_007047690.1|  Transcription factor, putative isoform 4           228   1e-68   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               227   1e-68   Glycine max [soybeans]
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8           226   1e-68   Camelina sativa [gold-of-pleasure]
gb|KHN08222.1|  Auxin-responsive protein IAA8                           227   1e-68   Glycine soja [wild soybean]
ref|NP_001189579.1|  auxin-responsive protein IAA8                      226   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g             226   1e-68   Phaseolus vulgaris [French bean]
ref|NP_179852.1|  auxin-responsive protein IAA8                         226   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like      226   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg             226   2e-68   Eutrema salsugineum [saltwater cress]
gb|KHN32629.1|  Auxin-responsive protein IAA27                          225   2e-68   Glycine soja [wild soybean]
emb|CAN77436.1|  hypothetical protein VITISV_007399                     226   3e-68   Vitis vinifera
gb|ABR16139.1|  unknown                                                 229   4e-68   Picea sitchensis
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      226   4e-68   Glycine max [soybeans]
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     225   4e-68   Nelumbo nucifera [Indian lotus]
gb|AFK41338.1|  unknown                                                 220   6e-68   Medicago truncatula
ref|NP_001240013.1|  uncharacterized protein LOC100804423               224   7e-68   Glycine max [soybeans]
emb|CBI36106.3|  unnamed protein product                                223   7e-68   Vitis vinifera
gb|KHN09036.1|  Auxin-responsive protein IAA8                           225   9e-68   Glycine soja [wild soybean]
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                223   1e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_003597715.1|  Auxin-responsive protein IAA                       223   2e-67   Medicago truncatula
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           224   2e-67   Glycine max [soybeans]
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     223   3e-67   Vitis vinifera
emb|CBI28036.3|  unnamed protein product                                217   4e-67   Vitis vinifera
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           223   5e-67   Ricinus communis
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                221   6e-67   Erythranthe guttata [common monkey flower]
ref|XP_002303297.1|  auxin-responsive protein IAA27                     223   6e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             222   7e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          222   7e-67   Nelumbo nucifera [Indian lotus]
ref|NP_569017.2|  auxin-responsive protein IAA9                         221   1e-66   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    222   1e-66   
gb|AFK38538.1|  unknown                                                 220   2e-66   Lotus japonicus
gb|ABK24636.1|  unknown                                                 222   2e-66   Picea sitchensis
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    219   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8           221   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     220   4e-66   Elaeis guineensis
ref|NP_850028.1|  auxin-responsive protein IAA8                         219   4e-66   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     219   5e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    220   5e-66   Populus euphratica
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   219   8e-66   Citrus sinensis [apfelsine]
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    219   9e-66   Citrus sinensis [apfelsine]
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     218   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864969.1|  auxin-induced protein IAA9                         219   1e-65   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           217   1e-65   Ricinus communis
ref|XP_011009359.1|  PREDICTED: auxin-responsive protein IAA27-like     219   2e-65   Populus euphratica
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             218   2e-65   Citrus clementina [clementine]
ref|XP_010463453.1|  PREDICTED: auxin-responsive protein IAA9-lik...    217   2e-65   Camelina sativa [gold-of-pleasure]
gb|KJB71172.1|  hypothetical protein B456_011G109000                    218   3e-65   Gossypium raimondii
ref|XP_009130522.1|  PREDICTED: auxin-responsive protein IAA9-lik...    213   4e-65   Brassica rapa
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          217   4e-65   Vitis vinifera
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like      218   5e-65   Tarenaya hassleriana [spider flower]
gb|AAM64650.1|  auxin-induced protein IAA9                              217   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...    217   7e-65   Camelina sativa [gold-of-pleasure]
ref|NP_851275.1|  auxin-responsive protein IAA9                         217   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg             217   7e-65   Eutrema salsugineum [saltwater cress]
gb|AEV89263.1|  IAA9                                                    216   7e-65   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     215   8e-65   Nicotiana tomentosiformis
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...    216   8e-65   Brassica rapa
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg             216   1e-64   Capsella rubella
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             215   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     216   1e-64   Elaeis guineensis
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    216   2e-64   
emb|CDY68170.1|  BnaCnng57860D                                          215   2e-64   Brassica napus [oilseed rape]
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          216   2e-64   Amborella trichopoda
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like      216   2e-64   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         215   2e-64   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         214   2e-64   
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           215   2e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         216   3e-64   Jatropha curcas
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             214   3e-64   Citrus clementina [clementine]
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg             215   3e-64   
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg             216   3e-64   Citrus clementina [clementine]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like      214   4e-64   Tarenaya hassleriana [spider flower]
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     214   4e-64   Phoenix dactylifera
ref|XP_008462174.1|  PREDICTED: auxin-responsive protein IAA27-like     215   4e-64   Cucumis melo [Oriental melon]
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    214   4e-64   Phoenix dactylifera
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          214   5e-64   Cucumis melo [Oriental melon]
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    214   5e-64   Phoenix dactylifera
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like     214   5e-64   Elaeis guineensis
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     214   7e-64   Phoenix dactylifera
ref|XP_002298231.1|  hypothetical protein POPTR_0001s18680g             214   7e-64   
gb|ABD98054.1|  auxin-regulated protein                                 213   7e-64   Striga asiatica [witchweed]
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     213   7e-64   Nicotiana sylvestris
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9           214   8e-64   Camelina sativa [gold-of-pleasure]
emb|CDY18679.1|  BnaA09g07160D                                          213   9e-64   Brassica napus [oilseed rape]
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     213   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like     213   2e-63   Nicotiana tomentosiformis
emb|CDP03299.1|  unnamed protein product                                213   2e-63   Coffea canephora [robusta coffee]
emb|CDY25617.1|  BnaA04g13090D                                          211   2e-63   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8           211   2e-63   Brassica rapa
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      214   2e-63   Cicer arietinum [garbanzo]
ref|XP_009130521.1|  PREDICTED: auxin-responsive protein IAA9-lik...    208   3e-63   Brassica rapa
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative           214   3e-63   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     212   4e-63   Elaeis guineensis
ref|XP_002864971.1|  hypothetical protein ARALYDRAFT_358770             215   4e-63   
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      212   5e-63   Medicago truncatula
emb|CDY37837.1|  BnaAnng04980D                                          210   7e-63   Brassica napus [oilseed rape]
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    208   8e-63   Tarenaya hassleriana [spider flower]
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like      212   1e-62   Cucumis sativus [cucumbers]
emb|CDX89499.1|  BnaC04g35180D                                          209   1e-62   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     209   2e-62   Nicotiana sylvestris
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          210   2e-62   Sesamum indicum [beniseed]
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     209   2e-62   Cucumis sativus [cucumbers]
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    209   2e-62   Citrus sinensis [apfelsine]
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like      208   3e-62   Nicotiana sylvestris
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    209   3e-62   Gossypium arboreum [tree cotton]
gb|AEQ94167.1|  auxin induced family protein                            203   3e-62   Elaeis guineensis
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     209   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...    210   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     210   4e-62   Prunus mume [ume]
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...    210   5e-62   Tarenaya hassleriana [spider flower]
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     207   7e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             207   1e-61   Phaseolus vulgaris [French bean]
gb|ABI36495.1|  AUX/IAA27 A                                             201   1e-61   Malus domestica [apple tree]
gb|KEH27147.1|  auxin response factor                                   206   1e-61   Medicago truncatula
gb|AFK45766.1|  unknown                                                 206   1e-61   Medicago truncatula
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like      209   1e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             207   2e-61   Phaseolus vulgaris [French bean]
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     207   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     207   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001280937.1|  auxin-responsive protein IAA27                     207   3e-61   Malus domestica [apple tree]
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     207   3e-61   Pyrus x bretschneideri [bai li]
gb|KJB54240.1|  hypothetical protein B456_009G026700                    206   3e-61   Gossypium raimondii
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...    207   3e-61   Phoenix dactylifera
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         207   4e-61   Theobroma cacao [chocolate]
gb|KHN41649.1|  Auxin-responsive protein IAA27                          205   4e-61   Glycine soja [wild soybean]
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like     205   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      207   5e-61   Eucalyptus grandis [rose gum]
ref|NP_001239808.1|  uncharacterized protein LOC100778529               205   6e-61   Glycine max [soybeans]
ref|XP_009380571.1|  PREDICTED: auxin-responsive protein IAA21-li...    206   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     204   9e-61   Solanum tuberosum [potatoes]
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like     206   9e-61   Fragaria vesca subsp. vesca
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          205   1e-60   Prunus mume [ume]
gb|KHN16618.1|  Auxin-responsive protein IAA27                          204   1e-60   Glycine soja [wild soybean]
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    202   1e-60   Gossypium arboreum [tree cotton]
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             204   2e-60   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     206   2e-60   Morus notabilis
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     203   2e-60   Nicotiana tomentosiformis
ref|XP_008348504.1|  PREDICTED: auxin-responsive protein IAA21-li...    204   3e-60   Malus domestica [apple tree]
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          204   3e-60   Glycine max [soybeans]
ref|XP_008348505.1|  PREDICTED: auxin-responsive protein IAA21-li...    204   3e-60   Malus domestica [apple tree]
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    205   3e-60   Glycine max [soybeans]
ref|XP_009377833.1|  PREDICTED: auxin-responsive protein IAA21-like     204   3e-60   Pyrus x bretschneideri [bai li]
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     204   4e-60   Eucalyptus grandis [rose gum]
ref|NP_001266034.1|  IAA6 protein                                       202   5e-60   Solanum lycopersicum
ref|XP_006584591.1|  PREDICTED: uncharacterized protein LOC100804...    203   5e-60   Glycine max [soybeans]
dbj|BAB10673.1|  auxin-induced protein IAA9                             204   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...    204   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 202   7e-60   Medicago truncatula
gb|AFK49596.1|  unknown                                                 202   7e-60   Medicago truncatula
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          202   7e-60   Fragaria vesca subsp. vesca
ref|XP_009353580.1|  PREDICTED: auxin-responsive protein IAA21-like     204   8e-60   Pyrus x bretschneideri [bai li]
ref|NP_001241183.1|  uncharacterized protein LOC100804782               203   8e-60   Glycine max [soybeans]
ref|XP_003530133.1|  PREDICTED: auxin-responsive protein IAA27-like     203   9e-60   Glycine max [soybeans]
gb|KJB18638.1|  hypothetical protein B456_003G064200                    200   1e-59   Gossypium raimondii
gb|AEI70506.1|  auxin-responsive protein                                202   2e-59   Gossypium hirsutum [American cotton]
ref|XP_006465642.1|  PREDICTED: auxin-responsive protein IAA8-lik...    203   2e-59   Citrus sinensis [apfelsine]
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    202   2e-59   Gossypium arboreum [tree cotton]
gb|KJB56779.1|  hypothetical protein B456_009G135900                    202   3e-59   Gossypium raimondii
ref|XP_006426927.1|  hypothetical protein CICLE_v10025988mg             202   5e-59   Citrus clementina [clementine]
gb|AFK35603.1|  unknown                                                 194   6e-59   Lotus japonicus
ref|XP_008783242.1|  PREDICTED: auxin-responsive protein IAA17-li...    201   7e-59   Phoenix dactylifera
gb|KJB18635.1|  hypothetical protein B456_003G064200                    201   9e-59   Gossypium raimondii
gb|KJB18637.1|  hypothetical protein B456_003G064200                    201   1e-58   Gossypium raimondii
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          199   1e-58   Tarenaya hassleriana [spider flower]
emb|CDY45607.1|  BnaCnng13150D                                          200   1e-58   Brassica napus [oilseed rape]
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    200   1e-58   Malus domestica [apple tree]
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like     199   1e-58   Cicer arietinum [garbanzo]
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...    200   2e-58   Brassica rapa
emb|CDO98008.1|  unnamed protein product                                200   3e-58   Coffea canephora [robusta coffee]
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          199   3e-58   Eucalyptus grandis [rose gum]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     197   4e-58   Elaeis guineensis
gb|EYU21477.1|  hypothetical protein MIMGU_mgv1a011145mg                198   4e-58   Erythranthe guttata [common monkey flower]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     196   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009129008.1|  PREDICTED: auxin-responsive protein IAA27          197   5e-58   Brassica rapa
ref|NP_194637.1|  phytochrome-associated protein 2                      198   6e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KDP33705.1|  hypothetical protein JCGZ_07276                         197   6e-58   Jatropha curcas
ref|XP_002867425.1|  phytochrome-associated protein 2                   198   6e-58   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    197   1e-57   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     197   1e-57   
gb|AFK41855.1|  unknown                                                 191   1e-57   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     196   1e-57   
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     195   2e-57   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    194   2e-57   
ref|XP_010107373.1|  Auxin-responsive protein IAA27                     201   2e-57   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          194   2e-57   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     194   3e-57   
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     194   3e-57   
gb|ACF88333.1|  unknown                                                 194   5e-57   
gb|AAP44405.1|  auxin-induced protein 2                                 195   6e-57   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             193   7e-57   
ref|XP_007135656.1|  hypothetical protein PHAVU_010G147200g             196   7e-57   
emb|CDY06836.1|  BnaC01g09350D                                          193   1e-56   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     192   1e-56   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             194   1e-56   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          194   1e-56   
dbj|BAJ33683.1|  unnamed protein product                                194   1e-56   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          193   2e-56   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg             195   3e-56   
gb|ABI36497.1|  AUX/IAA27 B                                             187   4e-56   
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                            190   4e-56   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     193   4e-56   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        191   4e-56   
ref|XP_007215616.1|  hypothetical protein PRUPE_ppa007893mg             194   5e-56   
dbj|BAJ84870.1|  predicted protein                                      191   5e-56   
gb|EPS59988.1|  auxin-regulated protein                                 193   5e-56   
dbj|BAK01326.1|  predicted protein                                      191   5e-56   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    192   7e-56   
gb|ADL36587.1|  ARF domain class transcription factor                   188   8e-56   
gb|ABI36493.1|  AUX/IAA16 A                                             187   8e-56   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    191   9e-56   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     190   9e-56   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             192   9e-56   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    191   1e-55   
gb|ABI36496.1|  AUX/IAA26                                               186   1e-55   
gb|KJB54244.1|  hypothetical protein B456_009G026700                    192   1e-55   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          188   1e-55   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like     192   1e-55   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          190   2e-55   
ref|XP_002302075.1|  auxin-induced protein aux28                        189   2e-55   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     190   2e-55   
dbj|BAM10419.1|  Aux/IAA protein                                        185   2e-55   
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                     192   2e-55   
gb|KJB42200.1|  hypothetical protein B456_007G141900                    189   3e-55   
emb|CBI35213.3|  unnamed protein product                                186   3e-55   
gb|ACF87179.1|  unknown                                                 190   3e-55   
ref|XP_007024228.1|  Phytochrome-associated protein 2 isoform 1         192   3e-55   
ref|XP_006383686.1|  auxin-induced protein aux28                        189   3e-55   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     190   4e-55   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    189   4e-55   
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             189   4e-55   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           189   4e-55   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       189   5e-55   
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             188   5e-55   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   188   5e-55   
ref|NP_001266049.1|  IAA9 protein                                       189   6e-55   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         188   6e-55   
ref|XP_006656052.1|  PREDICTED: auxin-responsive protein IAA21-like     185   6e-55   
gb|KJB54243.1|  hypothetical protein B456_009G026700                    190   7e-55   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        189   7e-55   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        189   9e-55   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               188   9e-55   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        187   1e-54   
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     188   1e-54   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               187   1e-54   
gb|ABH01143.1|  auxin-regulated protein                                 188   1e-54   
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...    190   1e-54   
ref|NP_001067209.1|  Os12g0601300                                       188   1e-54   
emb|CDY08767.1|  BnaA06g24570D                                          190   1e-54   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              187   1e-54   
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27          189   1e-54   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     187   2e-54   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     187   2e-54   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     187   2e-54   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       187   2e-54   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     187   3e-54   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     186   3e-54   
gb|KJB82525.1|  hypothetical protein B456_013G200700                    186   4e-54   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          186   4e-54   
gb|AEE25654.1|  auxin-responsive protein                                186   5e-54   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                186   5e-54   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    186   5e-54   
ref|NP_001266052.1|  IAA8                                               187   5e-54   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     186   6e-54   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          186   7e-54   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like     187   8e-54   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      185   9e-54   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     185   9e-54   
gb|KJB11141.1|  hypothetical protein B456_001G242900                    185   1e-53   
gb|EEC80532.1|  hypothetical protein OsI_22819                          183   1e-53   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          185   1e-53   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   184   1e-53   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          185   1e-53   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          184   1e-53   
gb|AFK44192.1|  unknown                                                 185   1e-53   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             185   1e-53   
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        184   2e-53   
gb|KHG04941.1|  Auxin-induced AUX28                                     184   2e-53   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    184   2e-53   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     184   2e-53   
ref|NP_001057554.1|  Os06g0335500                                       185   2e-53   
ref|NP_001242283.1|  uncharacterized protein LOC100795749               186   2e-53   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 184   2e-53   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     184   3e-53   
gb|ACU19136.1|  unknown                                                 184   3e-53   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     183   4e-53   
gb|KHN22078.1|  Auxin-responsive protein IAA16                          183   4e-53   
ref|NP_001239753.1|  uncharacterized protein LOC100781847               183   4e-53   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            181   4e-53   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            182   6e-53   
gb|ABR16302.1|  unknown                                                 186   6e-53   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     183   7e-53   
emb|CDO99148.1|  unnamed protein product                                183   7e-53   
gb|KJB56782.1|  hypothetical protein B456_009G135900                    185   7e-53   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             182   8e-53   
gb|KJB18639.1|  hypothetical protein B456_003G064200                    186   8e-53   
gb|KJB44871.1|  hypothetical protein B456_007G276900                    180   8e-53   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             184   1e-52   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          182   1e-52   
ref|XP_009389389.1|  PREDICTED: auxin-responsive protein IAA17-like     183   2e-52   
gb|KJB56783.1|  hypothetical protein B456_009G135900                    186   2e-52   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        182   3e-52   
ref|NP_001241599.1|  uncharacterized protein LOC100803065               181   3e-52   
gb|ABI36487.1|  AUX/IAA7 A                                              178   3e-52   
gb|EMS67401.1|  Auxin-responsive protein IAA21                          178   3e-52   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         181   3e-52   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   181   4e-52   
gb|KHN18836.1|  Auxin-induced protein AUX28                             181   4e-52   
gb|ABM53872.1|  IAA4                                                    178   4e-52   
gb|KJB44873.1|  hypothetical protein B456_007G276900                    181   5e-52   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        181   6e-52   
gb|AEE25650.1|  auxin-responsive protein                                181   7e-52   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             180   8e-52   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             180   8e-52   
dbj|BAJ97201.1|  predicted protein                                      180   8e-52   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        181   9e-52   
gb|ACU18407.1|  unknown                                                 180   1e-51   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             180   1e-51   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        180   1e-51   
gb|AGV54230.1|  auxin-induced protein AUX28                             179   1e-51   
emb|CDY40881.1|  BnaCnng09720D                                          177   1e-51   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        180   2e-51   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     178   2e-51   
gb|ADN34477.1|  auxin influx carrier                                    174   2e-51   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    179   2e-51   
ref|XP_004153443.1|  PREDICTED: auxin-responsive protein IAA16-like     176   2e-51   
ref|XP_002311658.1|  aux/IAA family protein                             179   2e-51   
gb|AFK36086.1|  unknown                                                 179   3e-51   
gb|KCW69644.1|  hypothetical protein EUGRSUZ_F03050                     182   3e-51   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     179   3e-51   
gb|KHN05057.1|  Auxin-responsive protein IAA14                          179   3e-51   
ref|NP_001266070.1|  IAA14                                              178   3e-51   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     179   3e-51   
gb|AFZ78617.1|  hypothetical protein                                    179   3e-51   
gb|AAV50046.1|  auxin-induced protein                                   177   3e-51   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             179   3e-51   
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     178   4e-51   
emb|CBI26357.3|  unnamed protein product                                178   4e-51   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       175   4e-51   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       175   4e-51   
ref|XP_002315736.1|  aux/IAA family protein                             179   4e-51   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          178   5e-51   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       175   5e-51   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             178   5e-51   
emb|CAH59413.1|  auxin resistance protein                               177   5e-51   
emb|CDX97478.1|  BnaC08g13430D                                          174   5e-51   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       177   6e-51   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       175   6e-51   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     180   7e-51   
gb|KJB11145.1|  hypothetical protein B456_001G242900                    178   7e-51   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    177   8e-51   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        178   8e-51   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     177   8e-51   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       175   8e-51   
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        177   9e-51   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       175   9e-51   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        177   1e-50   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       175   1e-50   
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    177   1e-50   
gb|AAM96891.1|  auxin-responsive protein IAA1                           176   1e-50   
gb|ABM53874.1|  IAA6                                                    174   1e-50   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     177   1e-50   
gb|AFK42876.1|  unknown                                                 177   1e-50   
emb|CDY41894.1|  BnaC05g47100D                                          176   1e-50   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     176   2e-50   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             177   2e-50   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590          177   2e-50   
gb|AFK37379.1|  unknown                                                 176   2e-50   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     177   2e-50   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          176   2e-50   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    176   2e-50   
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    177   2e-50   
gb|AEE25653.1|  auxin-responsive protein                                177   2e-50   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     176   2e-50   
gb|KJB38280.1|  hypothetical protein B456_006G246000                    177   2e-50   
ref|NP_187124.1|  auxin-responsive protein IAA16                        176   2e-50   
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          177   2e-50   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    176   2e-50   
gb|ADJ68049.1|  auxin responsive protein                                176   2e-50   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     176   2e-50   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    176   2e-50   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      176   3e-50   
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     176   3e-50   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     176   3e-50   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          176   3e-50   
gb|ACL81167.1|  auxin-responsive protein IAA1                           177   3e-50   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    176   3e-50   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          176   3e-50   
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     176   3e-50   
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          176   3e-50   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             176   4e-50   
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                   178   4e-50   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    176   4e-50   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    176   4e-50   
emb|CDY50750.1|  BnaAnng10570D                                          177   4e-50   
ref|XP_004965463.1|  PREDICTED: auxin-responsive protein IAA21-like     175   4e-50   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     175   4e-50   
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             176   4e-50   



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
             NDEVDGKPGPGALFVKVSMDGAPYLRKVDLR+Y++YQ+LSSA+EKMFSCFTIGQCGSQG
Sbjct  219  TNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRSYSTYQQLSSAIEKMFSCFTIGQCGSQG  278

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            APGRE+LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPWDMFI SCKRLKIMKGSDAIG
Sbjct  279  APGRESLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIGSCKRLKIMKGSDAIG  338

Query  396  LAPRAKEKSKSRN  358
            LAPRA EKSK+RN
Sbjct  339  LAPRAMEKSKNRN  351



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCG QGA
Sbjct  215  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGPQGA  274

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P RE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  275  PSREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  334

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  335  APRAVEKSKNRN  346



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTY +YQELSSALEKMFSCFT+GQCGS GA
Sbjct  217  NDEVDGKPGPTALFVKVSMDGAPYLRKVDLRTYTTYQELSSALEKMFSCFTLGQCGSHGA  276

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMKGSDAIGL
Sbjct  277  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKGSDAIGL  336

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR+
Sbjct  337  APRAMEKSKSRS  348



>gb|ABI36491.1| AUX/IAA8A [Malus domestica]
 gb|ABI36492.1| AUX/IAA8 [Malus domestica]
Length=151

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS GA
Sbjct  20   NDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGSHGA  79

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGL
Sbjct  80   PGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGL  139

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  140  APRAMEKSKNRN  151



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS GA
Sbjct  257  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGA  316

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGL
Sbjct  317  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGL  376

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  377  APRAMEKCRNRN  388



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  247  NDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQYGSHGA  306

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  307  PGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  366

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  367  APRAMEKSKNRN  378



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  247  NDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQYGSHGA  306

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  307  PGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  366

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  367  APRAMEKSKNRN  378



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTYA+YQ+LSSALEKMFSCFT+GQCGS GA
Sbjct  204  NDEVDGKPGPAALFVKVSMDGAPYLRKVDLRTYATYQQLSSALEKMFSCFTLGQCGSHGA  263

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++C+RLKIMKGSDAIGL
Sbjct  264  PGKEMMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCRRLKIMKGSDAIGL  323

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR+
Sbjct  324  APRAMEKSKSRS  335



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTYA+YQ+LSSALEKMFSCFT+GQCGS GA
Sbjct  204  NDEVDGKPGPAALFVKVSMDGAPYLRKVDLRTYATYQQLSSALEKMFSCFTLGQCGSHGA  263

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++C+RLKIMKGSDAIGL
Sbjct  264  PGKEMMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCRRLKIMKGSDAIGL  323

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR+
Sbjct  324  APRAMEKSKSRS  335



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS GA
Sbjct  278  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGA  337

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGL
Sbjct  338  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGL  397

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  398  APRAMEKCRNRN  409



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS GA
Sbjct  279  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGSHGA  338

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGL
Sbjct  339  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGL  398

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  399  APRAMEKCRNRN  410



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS GA
Sbjct  195  NDEVDGKPGPTALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGA  254

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  255  PGREMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  314

Query  393  APRAKEKSKSR  361
            APRA EKSKSR
Sbjct  315  APRAMEKSKSR  325



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLR Y +YQELSSALEKMFSCFT+GQCGS G 
Sbjct  217  NDEVDGKPGPAALFVKVSMDGAPYLRKVDLRNYTTYQELSSALEKMFSCFTLGQCGSHGV  276

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  277  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  336

Query  393  APRAKEKSKSRN  358
            APRA EKS+SR+
Sbjct  337  APRAMEKSRSRS  348



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS GA
Sbjct  219  NDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGSHGA  278

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGL
Sbjct  279  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGL  338

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR 
Sbjct  339  APRAMEKSKSRT  350



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS GA
Sbjct  221  NDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGSHGA  280

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGL
Sbjct  281  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGL  340

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR 
Sbjct  341  APRAMEKSKSRT  352



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS GA
Sbjct  222  NDEVDGKPGPTALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGA  281

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  282  PGREMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  341

Query  393  APRAKEKSKSR  361
            APRA EKSKSR
Sbjct  342  APRAMEKSKSR  352



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS GA
Sbjct  242  NDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGSHGA  301

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGL
Sbjct  302  PGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGL  361

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  362  APRAMEKSKNRN  373



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS GA
Sbjct  242  NDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGSHGA  301

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIGL
Sbjct  302  PGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIGL  361

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  362  APRAMEKSKNRN  373



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPG LFVKVSMDGAPYLRKVDL+TY++YQELSSALEKMFSCF IGQCGS+GA
Sbjct  228  NDEVDGKPGPGTLFVKVSMDGAPYLRKVDLKTYSTYQELSSALEKMFSCFIIGQCGSEGA  287

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P RE LSESKL+D +HGSEYVLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDAIGL
Sbjct  288  PSRETLSESKLKDLIHGSEYVLTYEDKDGDWMLVGDVPWEMFIASCKRLKIMKGSDAIGL  347

Query  393  APRAKEKSKSRN  358
            APRA EKSK RN
Sbjct  348  APRAVEKSKVRN  359



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY +Y ELSSALEKMFSCFTIGQCGS  A
Sbjct  245  NDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEA  304

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  305  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  364

Query  393  APRAKEKSKSRN  358
            APRA EKSK RN
Sbjct  365  APRAMEKSKIRN  376



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY +Y ELSSALEKMFSCFTIGQCGS  A
Sbjct  245  NDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEA  304

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  305  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  364

Query  393  APRAKEKSKSRN  358
            APRA EKSK RN
Sbjct  365  APRAMEKSKIRN  376



>gb|ABW24025.1| aux/IAA protein [Eucommia ulmoides]
Length=156

 Score =   244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGKPGPG+LFVKVSMDGAPYLRKVDL TY +YQELSSALEKMFSCF IGQC SQGA
Sbjct  25   NEEVDGKPGPGSLFVKVSMDGAPYLRKVDLGTYTTYQELSSALEKMFSCFIIGQCASQGA  84

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              +E LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  85   SAKEKLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  144

Query  393  APRAKEKSKSRN  358
            APRA EKSK++N
Sbjct  145  APRAMEKSKNKN  156



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score =   248 bits (634),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQG  577
            NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS G
Sbjct  157  NDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHG  216

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            APGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIG
Sbjct  217  APGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIG  276

Query  396  LAPRAKEKSKSRN  358
            LAPRA EKSKSR+
Sbjct  277  LAPRAMEKSKSRS  289



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGAL+VKVSMDGAPYLRKVDLR Y++YQELSS+LEKMFS FTIGQCGS G 
Sbjct  246  NDEVDGKPGPGALYVKVSMDGAPYLRKVDLRNYSTYQELSSSLEKMFSGFTIGQCGSNGT  305

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE L+ESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPW+MFIESCKRLKIMKG+DAIGL
Sbjct  306  PGREMLNESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWEMFIESCKRLKIMKGADAIGL  365

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  366  APRALEKSKARN  377



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+
Sbjct  214  NDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGS  273

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  274  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  333

Query  393  APRAKEKSKSRN  358
            APRA EKSK+ N
Sbjct  334  APRAMEKSKNSN  345



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQG  577
            NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS G
Sbjct  222  NDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHG  281

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            APGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMKGSDAIG
Sbjct  282  APGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKGSDAIG  341

Query  396  LAPRAKEKSKSR  361
            LAPRA EKSKSR
Sbjct  342  LAPRAMEKSKSR  353



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQG  577
            NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS G
Sbjct  227  NDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHG  286

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            APGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIG
Sbjct  287  APGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIG  346

Query  396  LAPRAKEKSKSRN  358
            LAPRA EKSKSR+
Sbjct  347  LAPRAMEKSKSRS  359



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCGSQG  577
            NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCGS G
Sbjct  207  NDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHG  266

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            APGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDAIG
Sbjct  267  APGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDAIG  326

Query  396  LAPRAKEKSKSRN  358
            LAPRA EKSKSR+
Sbjct  327  LAPRAMEKSKSRS  339



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS G 
Sbjct  255  NEEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSNYQELSSALEKMFSCFTIGQCGSHGP  314

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK SDAIGL
Sbjct  315  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSDAIGL  374

Query  393  APRAKEKSKSRN  358
            APRA EK + RN
Sbjct  375  APRAMEKCRKRN  386



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+
Sbjct  245  NDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGS  304

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  305  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  364

Query  393  APRAKEKSKSRN  358
            APRA EKSK+ N
Sbjct  365  APRAMEKSKNSN  376



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY +YQELSSALEKMFSCFTIGQ GS GA
Sbjct  239  SDEVDGKPGRGALFVKVSMDGAPYLRKVDLRTYGTYQELSSALEKMFSCFTIGQYGSHGA  298

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGL
Sbjct  299  PGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGL  358

Query  393  APRAKEKSKSRN  358
            APR+ EKSK RN
Sbjct  359  APRSMEKSKIRN  370



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS G 
Sbjct  217  NDEVDGKPGAAALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGG  276

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  277  PGKEMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  336

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR+
Sbjct  337  APRAMEKSKSRS  348



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS G 
Sbjct  225  NDEVDGKPGAAALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGG  284

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  285  PGKEMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  344

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR+
Sbjct  345  APRAMEKSKSRS  356



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTY++YQELSS LEKMFSCFT+GQCG  GA
Sbjct  213  NDEVDGKPGPTALFVKVSMDGAPYLRKVDLRTYSTYQELSSGLEKMFSCFTLGQCGPAGA  272

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              RE +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW MFI SCKRLKIMKGSDAIGL
Sbjct  273  QTREMMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIASCKRLKIMKGSDAIGL  332

Query  393  APRAKEKSKSRN  358
            APRA EKSK+RN
Sbjct  333  APRAVEKSKNRN  344



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  A+FVKVSMDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS GA
Sbjct  219  NDEVDGKPGAAAIFVKVSMDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGSHGA  278

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  279  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  338

Query  393  APRAKEKSKSR  361
            APRA EKS+SR
Sbjct  339  APRAMEKSRSR  349



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGK G  ALFVKVSMDGAPYLRKVDLR Y  YQELSSALEKMFSCFT+GQCGS GA
Sbjct  219  NDEVDGKLGAAALFVKVSMDGAPYLRKVDLRNYTMYQELSSALEKMFSCFTLGQCGSHGA  278

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  279  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  338

Query  393  APRAKEKSKSR  361
            APRA EKS+SR
Sbjct  339  APRAMEKSRSR  349



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS GA
Sbjct  216  NDEVDGKPGLSALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGSHGA  275

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKLRD LHGSEYVL+YEDKDGDWMLVGDVPW+MF E+C+RLKIMKGSDAIGL
Sbjct  276  PGRELLSESKLRDLLHGSEYVLSYEDKDGDWMLVGDVPWEMFTETCRRLKIMKGSDAIGL  335

Query  393  APRAKEKSKSRN  358
            APRA EKSK R+
Sbjct  336  APRAMEKSKIRS  347



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSMDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS GA
Sbjct  219  NDEVDGKPGAVALFVKVSMDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGSHGA  278

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  279  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  338

Query  393  APRAKEKSKSR  361
            APRA EKS+SR
Sbjct  339  APRAMEKSRSR  349



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS G 
Sbjct  217  NDEVDGKPGAAALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGSHGG  276

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKG DAIGL
Sbjct  277  PGKEMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGFDAIGL  336

Query  393  APRAKEKSKSRN  358
            APRA EKSKSR+
Sbjct  337  APRAMEKSKSRS  348



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G 
Sbjct  238  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSNGT  297

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+E LSES+L+D LHGSEYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  298  AGKETLSESRLKDLLHGSEYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  357

Query  393  APRAKEKSKSRN  358
            APRA EKSK+ N
Sbjct  358  APRAMEKSKANN  369



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            V +EVDGK GPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS G
Sbjct  234  VAEEVDGKSGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQCGSHG  293

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
              G+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK SDAIG
Sbjct  294  VEGKEVLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSSDAIG  353

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK++SRN
Sbjct  354  LAPRAVEKNRSRN  366



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  235  EEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAP  294

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLA
Sbjct  295  GREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLA  354

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  355  PRAMEKCKNRN  365



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  236  EEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAP  295

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLA
Sbjct  296  GREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLA  355

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  356  PRAMEKCKNRN  366



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  235  EEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAP  294

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLA
Sbjct  295  GREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLA  354

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  355  PRAMEKCKNRN  365



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  187  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  246

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  247  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  306

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  307  APRAVEKCKNRN  318



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  236  EEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAP  295

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGLA
Sbjct  296  GREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLA  355

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  356  PRAMEKCKNRN  366



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGA+FVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G 
Sbjct  237  NDEVDGKPGPGAVFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSHGT  296

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+E LSES+L+D LHGSEYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  297  AGKEILSESRLKDLLHGSEYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  356

Query  393  APRAKEKSKSRN  358
            APRA EKSK+ N
Sbjct  357  APRAVEKSKANN  368



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  348  APRAVEKCKNRN  359



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  348  APRAVEKCKNRN  359



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  348  APRAVEKCKNRN  359



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG GALF+KVSMDGAPYLRKVDLRTY++YQELS ALEKMFSCFTIGQCGS GA
Sbjct  249  NDEVDGKPGLGALFIKVSMDGAPYLRKVDLRTYSTYQELSCALEKMFSCFTIGQCGSHGA  308

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSE KLRD L+GSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMK SDAIGL
Sbjct  309  PGKEKLSEIKLRDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKSSDAIGL  368

Query  393  APRAKEKSK  367
            APRA EKSK
Sbjct  369  APRAMEKSK  377



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 ref|XP_004160925.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score =   241 bits (615),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSM+GAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS GA
Sbjct  249  NDEVDGKPGSSALFVKVSMEGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSHGA  308

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GR+ LSESKLRD LHGSEYVLTYED+DGDWMLVG++PW+MFI+SCKRLKI+KGSDAIGL
Sbjct  309  SGRDKLSESKLRDHLHGSEYVLTYEDRDGDWMLVGEIPWEMFIDSCKRLKIVKGSDAIGL  368

Query  393  APRAKEKSKSR  361
            APRA E++K+R
Sbjct  369  APRATERTKNR  379



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPG LFVKVSMDGAPYLRKVDLRT+++YQELS ALEKMFSCFTIGQCGS GA
Sbjct  251  NDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRTHSTYQELSRALEKMFSCFTIGQCGSHGA  310

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P RE LSESKLRD L+GSEY LTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  311  PEREKLSESKLRDLLNGSEYALTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  370

Query  393  APRAKEKSK  367
            APRA EK K
Sbjct  371  APRAMEKFK  379



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G 
Sbjct  220  NDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGT  279

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DAIGL
Sbjct  280  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADAIGL  339

Query  393  APRAKEKSK  367
            AP+A +KSK
Sbjct  340  APKAMDKSK  348



>gb|ABM53871.1| IAA3 [Cestrum elegans]
Length=153

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EV+GK G  ALF+KVSMDGAPYLRKVDLR Y++Y+ELSSALEKMFSCFTIGQ GS GA
Sbjct  22   NEEVNGKAGSPALFIKVSMDGAPYLRKVDLRNYSAYRELSSALEKMFSCFTIGQYGSHGA  81

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  82   PGKEMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  141

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  142  APRAMEKCRSRN  153



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G 
Sbjct  220  NDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGT  279

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DAIGL
Sbjct  280  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADAIGL  339

Query  393  APRAKEKSK  367
            AP+A +KSK
Sbjct  340  APKAMDKSK  348



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G 
Sbjct  221  NDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGT  280

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DAIGL
Sbjct  281  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADAIGL  340

Query  393  APRAKEKSK  367
            AP+A +KSK
Sbjct  341  APKAMDKSK  349



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  215  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  274

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  275  PGKEMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  334

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  335  APRAMEKCRSRN  346



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  215  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  274

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  275  PGKELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  334

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  335  APRAMEKCRSRN  346



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLRTY++YQELSSALE MFSCFTIGQ GS GA
Sbjct  218  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGSHGA  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  278  PGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  337

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  338  APRAMEKCRSRN  349



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLRTY++YQELSSALE MFSCFTIGQ GS GA
Sbjct  218  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGSHGA  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  278  PGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  337

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  338  APRAMEKCRSRN  349



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  177  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGA  236

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  237  PGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  296

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  297  APRAMEKCRSRN  308



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGKP PGALF+KVSMDGAPYLRKVDLRTYA+YQELSSALEKMFSCFTIGQCGS GA
Sbjct  238  NEEVDGKPSPGALFIKVSMDGAPYLRKVDLRTYATYQELSSALEKMFSCFTIGQCGSHGA  297

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCK+LKIMKGSDAIGL
Sbjct  298  PGKEKMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKKLKIMKGSDAIGL  357

Query  393  APRAKE  376
              ++ +
Sbjct  358  GSKSND  363



>ref|XP_006850381.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGKPG G LFVKVSMDGAPYLRKVDL+TY++YQELS+ALEKMFSCFTIGQCGS G 
Sbjct  262  NEEVDGKPGFGGLFVKVSMDGAPYLRKVDLKTYSAYQELSTALEKMFSCFTIGQCGSHGV  321

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GR+ LSESKL+D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGSDAIGL
Sbjct  322  SGRDGLSESKLKDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSDAIGL  381

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  382  APRAMEKCRNRN  393



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  218  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGA  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  278  PGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  337

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  338  APRAMEKCRSRN  349



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G  ALF+KVSMDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  218  NEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGA  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDAIGL
Sbjct  278  PGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGL  337

Query  393  APRAKEKSKSRN  358
            APRA EK +SRN
Sbjct  338  APRAMEKCRSRN  349



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++VDGK G  ALF+KVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  215  NEKVDGKAGSPALFIKVSMDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGA  274

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSES+L+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMKGSDAIGL
Sbjct  275  PGKEMLSESQLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKGSDAIGL  334

Query  393  APRAKEKSKSRN  358
            APR  EK +SRN
Sbjct  335  APRGMEKCRSRN  346



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSM+GAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G 
Sbjct  249  NDEVDGKPGSSALFVKVSMEGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSHGV  308

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GR+ LSESKLRD LHGSEYVLTYED+DGDWMLVG++PW+MFI+SCKRLKI+KGSDAIGL
Sbjct  309  SGRDKLSESKLRDHLHGSEYVLTYEDRDGDWMLVGEIPWEMFIDSCKRLKIVKGSDAIGL  368

Query  393  APRAKEKSK  367
            APRA E  K
Sbjct  369  APRATEIQK  377



>gb|ABM53870.1| IAA2 [Cestrum elegans]
Length=152

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
             N+EVDGKPG   L +KVSMDGAPYLRKVDLR Y +YQELSSALE MFSCFTIG+CGS G
Sbjct  20   TNEEVDGKPGSTVLLIKVSMDGAPYLRKVDLRNYFAYQELSSALENMFSCFTIGECGSHG  79

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            APG+E+LSESKL+D   GSEYVLTYEDKDGDWMLVGDVPW++FI +CKRL+IMK SDAIG
Sbjct  80   APGKESLSESKLKDLFRGSEYVLTYEDKDGDWMLVGDVPWELFINTCKRLRIMKSSDAIG  139

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK ++RN
Sbjct  140  LAPRAMEKCRARN  152



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+
Sbjct  245  NDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGS  304

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  305  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  364

Query  393  A  391
            A
Sbjct  365  A  365



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGK GPGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G 
Sbjct  199  TDEVDGKAGPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGT  258

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGL
Sbjct  259  SGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGL  318

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  319  APRAMEKCRNRN  330



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS GAP
Sbjct  234  EEVDGKSGPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFRCFTIGQYGSHGAP  293

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLA
Sbjct  294  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLA  352

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  353  PRAMEKCRNRN  363



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DEVDGK GP ALFVKVSMDGAPYLRKVDL+ Y+ YQ+LSSALEKMFSCFTIGQCGS G  
Sbjct  237  DEVDGKAGPDALFVKVSMDGAPYLRKVDLKNYSKYQDLSSALEKMFSCFTIGQCGSHGPL  296

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLA
Sbjct  297  GRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLA  356

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  357  PRAVEKCRNRN  367



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DEVDGK GP ALFVKVSMDGAPYLRKVDL+ Y+ YQ+LSSALEKMFSCFTIGQCGS G  
Sbjct  238  DEVDGKAGPDALFVKVSMDGAPYLRKVDLKNYSKYQDLSSALEKMFSCFTIGQCGSHGPL  297

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGLA
Sbjct  298  GRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGLA  357

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  358  PRAVEKCRNRN  368



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGKP  GALFVKVSM GAPYLRKVDL+TY++YQELSSALEKMFSCFT+GQCG++  
Sbjct  243  NNEVDGKPSSGALFVKVSMAGAPYLRKVDLKTYSAYQELSSALEKMFSCFTLGQCGAEEV  302

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+E LSE+KLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C++LKIMKGSDAIGL
Sbjct  303  SGKEMLSETKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRKLKIMKGSDAIGL  362

Query  393  APRAKEKSKSRN  358
            APR+ EK K+R+
Sbjct  363  APRSVEKCKNRD  374



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGK GPGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G 
Sbjct  226  TDEVDGKAGPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGT  285

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGL
Sbjct  286  SGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGL  345

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  346  APRAMEKCRNRN  357



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGAL+VKVSMDGAPYLRKVDLR Y++YQELSS+LEKMFS FTIGQCGS G 
Sbjct  246  NDEVDGKPGPGALYVKVSMDGAPYLRKVDLRNYSTYQELSSSLEKMFSGFTIGQCGSNGT  305

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE L+ESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPW+MFIESCKRLKIMKG+DAIGL
Sbjct  306  PGREMLNESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWEMFIESCKRLKIMKGADAIGL  365



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  717  LFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLR  538
            +FVKVSMDGAPYLRKVDLRT A+YQELSSALEKMFSCFTIGQCG +GAP RE LSESKLR
Sbjct  187  IFVKVSMDGAPYLRKVDLRTCATYQELSSALEKMFSCFTIGQCGPEGAPSREVLSESKLR  246

Query  537  DFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  358
            D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  247  DILHGSEYVLTYEDKDGDWMLVGDVPWEMFISSCKRLKIMKGSDAIGLAPRALEKSKNRN  306



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EV+GK GPGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  237  EEVEGKSGPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAP  296

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDAIGLA
Sbjct  297  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDAIGLA  355

Query  390  PRAKEKSKSRN  358
            PR+ EK ++RN
Sbjct  356  PRSMEKCRNRN  366



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  234  EEVDGKSNPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAP  293

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF ++CKR++IMK SDAIGLA
Sbjct  294  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTDTCKRMRIMKSSDAIGLA  352

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  353  PRAMEKCRNRN  363



>gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GP  LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS G  
Sbjct  238  EEVDGKGGPSGLFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGGL  297

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK SDAIGLA
Sbjct  298  GREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSSDAIGLA  357

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  358  PRAVEKCKNRN  368



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EV+GK GPGALFVKVS+DGAPYLRK+DL+ Y++YQELSSALEKMFSCFTIGQ GS GAP
Sbjct  237  EEVEGKSGPGALFVKVSLDGAPYLRKIDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAP  296

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDAIGLA
Sbjct  297  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDAIGLA  355

Query  390  PRAKEKSKSRN  358
            PR+ EK ++RN
Sbjct  356  PRSMEKCRNRN  366



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             +EV+GK GPGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  267  TEEVEGKSGPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGA  326

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDAIGL
Sbjct  327  PGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDAIGL  385

Query  393  APRAKEKSKSRN  358
            APR+ EK ++RN
Sbjct  386  APRSMEKCRNRN  397



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  190  TDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGA  249

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  250  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  309

Query  393  APRAKEKSKSRN  358
            AP A EKSK+++
Sbjct  310  APGAVEKSKNKD  321



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGK GPGALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS G 
Sbjct  237  TDEVDGKAGPGALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGT  296

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI +CKRL+IMK SDAIGL
Sbjct  297  LGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWVMFIGTCKRLRIMKSSDAIGL  356

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  357  APRAVEKCRNRN  368



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS GA
Sbjct  234  NDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGA  293

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK +DAIGL
Sbjct  294  LGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSTDAIGL  353

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  354  APRAVEKCRNRN  365



>gb|ABR17764.1| unknown [Picea sitchensis]
Length=324

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
             NDE DGK G  AL+VKVSMDGAPYLRKVDL+ Y  Y +LSSALEKMFSCFTIGQCGS G
Sbjct  192  TNDEDDGKSGSSALYVKVSMDGAPYLRKVDLKLYNCYLDLSSALEKMFSCFTIGQCGSHG  251

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             PGR+ LSESKL D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AIG
Sbjct  252  VPGRDGLSESKLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIG  311

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK K+RN
Sbjct  312  LAPRAMEKCKNRN  324



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFT GQ GS GAP
Sbjct  234  EEVDGKSXPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTJGQYGSHGAP  293

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLA
Sbjct  294  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLA  352

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  353  PRAMEKCRNRN  363



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGK   GALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+ GA
Sbjct  224  NDEVDGKAMAGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGAHGA  283

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G E +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGL
Sbjct  284  LGMEKMSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGL  343

Query  393  APRAKEKSKSR  361
            APRA EK ++R
Sbjct  344  APRAVEKCRNR  354



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS GAP
Sbjct  234  EEVDGKSXPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTIGQYGSHGAP  293

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF ++CKRL+IMK SDAIGLA
Sbjct  294  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTDTCKRLRIMKSSDAIGLA  352

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  353  PRAMEKCRNRN  363



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  193  TDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGLHGA  252

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE+KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  253  QGRERMSETKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  312

Query  393  APRAKEKSKSRN  358
            AP A EKSK+++
Sbjct  313  APGAVEKSKNKD  324



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGK   GALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+ GA
Sbjct  224  NDEVDGKAMAGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGAHGA  283

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G E +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDAIGL
Sbjct  284  LGMEKMSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDAIGL  343

Query  393  APRAKEKSKSR  361
            APRA EK ++R
Sbjct  344  APRAVEKCRNR  354



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGK  PGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G 
Sbjct  226  TDEVDGKARPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGT  285

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGL
Sbjct  286  SGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGL  345

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  346  APRAMEKCRNRN  357



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGK  PGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS G 
Sbjct  226  TDEVDGKARPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSHGT  285

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGL
Sbjct  286  SGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGL  345

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  346  APRAMEKCRNRN  357



>gb|ACJ84768.1| unknown [Medicago truncatula]
Length=190

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE +GKP    L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S G 
Sbjct  59   NDEAEGKPEFDCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNSPGL  118

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGSDAIGL
Sbjct  119  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGSDAIGL  178

Query  393  APRAKEKSKSRN  358
            APRA EKS+S+N
Sbjct  179  APRAMEKSRSQN  190



>ref|XP_003543635.1| PREDICTED: auxin-responsive protein IAA27-like [Glycine max]
Length=307

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G 
Sbjct  176  NDEAEGKSGFGCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFSCFTIGQCNSPGL  235

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGL
Sbjct  236  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGL  295

Query  393  APRAKEKSKSRN  358
            APRA EKS+S+N
Sbjct  296  APRAMEKSRSQN  307



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DEVDGKPGPG L+VKVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ  S GA 
Sbjct  202  DEVDGKPGPGVLYVKVSMDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIGQYVSHGAR  261

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI +CKR++IMK SDAIGLA
Sbjct  262  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFINTCKRMRIMKSSDAIGLA  320

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  321  PRAMEKCRNRN  331



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS GA
Sbjct  234  NDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGA  293

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DAIGL
Sbjct  294  LGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDAIGL  353

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  354  APRAVEKCRNRN  365



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G GALF+KVSMDGAPYLRKVDL  Y++Y ELSSALEKMFSCFTI QCGS G 
Sbjct  235  NEEVDGKVGVGALFIKVSMDGAPYLRKVDLNNYSTYPELSSALEKMFSCFTISQCGSHGI  294

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE L+E+KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF E+CKRL+IMK SDAIGL
Sbjct  295  LGREMLNETKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTETCKRLRIMKSSDAIGL  354

Query  393  APRAKEKSKSR  361
            APR  EKSKSR
Sbjct  355  APRTVEKSKSR  365



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS G 
Sbjct  238  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGSNGT  297

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+E LSES+L+D LHGSEYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAIGL
Sbjct  298  AGKETLSESRLKDLLHGSEYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAIGL  357

Query  393  APRAKEKSKSRN  358
                  +S  +N
Sbjct  358  GNYLVSRSLPKN  369



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DEVDGKPGPG L+VKVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ  S GA 
Sbjct  227  DEVDGKPGPGVLYVKVSMDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIGQYVSHGAR  286

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI +CKR++IMK SDAIGLA
Sbjct  287  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFINTCKRMRIMKSSDAIGLA  345

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  346  PRAMEKCRNRN  356



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS GA
Sbjct  234  NDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGA  293

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DAIGL
Sbjct  294  LGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDAIGL  353

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  354  APRAVEKCRNRN  365



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  A+FVKVSMDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS GA
Sbjct  219  NDEVDGKPGAAAIFVKVSMDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGSHGA  278

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDAIGL
Sbjct  279  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDAIGL  338



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS G+
Sbjct  245  NDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGSHGS  304

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  400
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDAI
Sbjct  305  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDAI  362



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+ VDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTI +CGS G 
Sbjct  229  NEVVDGKKGVGALFVKVSMDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTISKCGSHGI  288

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE L+E+KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDAIGL
Sbjct  289  LGREMLNETKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGL  348

Query  393  APRAKEKSKSR  361
            APRA EKSKSR
Sbjct  349  APRAVEKSKSR  359



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  193  TDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGLHGA  252

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  253  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  312

Query  393  APRAKEKSKSRN  358
            AP A EKSK+++
Sbjct  313  APGAVEKSKNKD  324



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+ VDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTI +CGS G 
Sbjct  229  NEVVDGKKGVGALFVKVSMDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTISKCGSHGI  288

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE L+E+KL+D LHGSEYVLTYED++GDWMLVGDVPW+MFIE+CKRL+IMK SDAIGL
Sbjct  289  LGREMLNETKLKDLLHGSEYVLTYEDREGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGL  348

Query  393  APRAKEKSKSRN  358
            APRA EKSKSRN
Sbjct  349  APRAVEKSKSRN  360



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  205  TDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGA  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  265  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  324

Query  393  APRAKEKSKSR  361
            AP A EKSK++
Sbjct  325  APGAVEKSKNK  335



>ref|XP_007150643.1| hypothetical protein PHAVU_005G169600g [Phaseolus vulgaris]
 gb|ESW22637.1| hypothetical protein PHAVU_005G169600g [Phaseolus vulgaris]
Length=334

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE +GKPG G L+VKVSMDGAPYLRK+DL+TY +Y ELSSALEKMFSCFTIGQC S G 
Sbjct  203  NDEGEGKPGFGCLYVKVSMDGAPYLRKIDLKTYNNYMELSSALEKMFSCFTIGQCNSPGL  262

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGL
Sbjct  263  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGL  322

Query  393  APRAKEKSKSRN  358
            APR  EKS+S+N
Sbjct  323  APRTMEKSRSQN  334



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  188  TDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGA  247

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  248  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  307

Query  393  APRAKEKSKSR  361
            AP A EKSK++
Sbjct  308  APGAVEKSKNK  318



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  194  TDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGLHGA  253

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  254  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  313

Query  393  APRAKEKSKSRN  358
            AP A EKSK+++
Sbjct  314  APGAVEKSKNKD  325



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SY +LSSALEKMFSCFT+GQCG  GA
Sbjct  197  TDEVDGKPGLGPLFVKVSMDGAPYLRKVDLRTYTSYPQLSSALEKMFSCFTLGQCGLHGA  256

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE LSE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIM GSD+IGL
Sbjct  257  QGRERLSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCRKLKIMTGSDSIGL  316

Query  393  APRAKEKSKSR  361
            APRA EKSK++
Sbjct  317  APRAMEKSKNK  327



>gb|KHN32629.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCF+IGQC S G 
Sbjct  176  NDEAEGKSGFGCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFSCFSIGQCNSPGL  235

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGL
Sbjct  236  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGL  295

Query  393  APRAKEKSKSRN  358
            APRA EKS+S+N
Sbjct  296  APRAMEKSRSQN  307



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  393  A  391
            A
Sbjct  348  A  348



>gb|ABR16139.1| unknown [Picea sitchensis]
Length=461

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
             NDE DGK G  AL+VKVSMDGAPYLRKVDL+ Y  Y +LSSALEKMFSCFTIGQCGS G
Sbjct  329  TNDEDDGKSGSSALYVKVSMDGAPYLRKVDLKLYNCYLDLSSALEKMFSCFTIGQCGSHG  388

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             PGR+ LSESKL D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AIG
Sbjct  389  VPGRDGLSESKLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIG  448

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK K+RN
Sbjct  449  LAPRAMEKCKNRN  461



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALFVKVSMDGAPYLRKVDL+ Y +Y +LSSALE MFSCFTIG CGS G  
Sbjct  236  EEVDGKVGPGALFVKVSMDGAPYLRKVDLKNYNAYADLSSALENMFSCFTIGSCGSHGNL  295

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G E L+E+KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF E+CKRL+IMK S+AIGLA
Sbjct  296  GGEVLNETKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTETCKRLRIMKSSEAIGLA  355

Query  390  PRAKEKSKSRN  358
            PRA EKSKSRN
Sbjct  356  PRAVEKSKSRN  366



>ref|XP_010254042.1| PREDICTED: auxin-responsive protein IAA27-like [Nelumbo nucifera]
Length=340

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+ +GK G   L+VKVSMDGAPYLRKVDL+TY SY+ELS+ALEKMFSCFTIGQCGS G 
Sbjct  209  NDDDEGKSGSACLYVKVSMDGAPYLRKVDLKTYGSYKELSAALEKMFSCFTIGQCGSHGV  268

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGR+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGL
Sbjct  269  PGRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGL  328

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  329  APRAMEKCKNRN  340



>gb|AFK41338.1| unknown [Medicago truncatula]
Length=190

 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE +GKP    L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S G 
Sbjct  59   NDEAEGKPEFDCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNSPGL  118

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKG DAIGL
Sbjct  119  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGFDAIGL  178

Query  393  APRAKEKSKSRN  358
            APRA EKS+S+N
Sbjct  179  APRAMEKSRSQN  190



>ref|NP_001240013.1| uncharacterized protein LOC100804423 [Glycine max]
 gb|ACU18729.1| unknown [Glycine max]
 gb|KHM98738.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=319

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G 
Sbjct  188  NDDDEGKSGFGCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFSCFTIGQCNSPGL  247

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGL
Sbjct  248  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGL  307

Query  393  APRAKEKSKSRN  358
            APRA EKS+S+N
Sbjct  308  APRAMEKSRSQN  319



>emb|CBI36106.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++ +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y ELSSALEKMFSCFTIGQCGS G 
Sbjct  161  NEDAEGKSGLGCLYVKVSMDGAPYLRKVDLKIYCNYMELSSALEKMFSCFTIGQCGSHGL  220

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGR+ L+ES L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMKGS+AIGL
Sbjct  221  PGRDGLTESHLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEAIGL  280

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  281  APRAMEKCKNRN  292



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+EVDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFT+ +CGS G 
Sbjct  230  NEEVDGKVGVGALFVKVSMDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTMSKCGSHGI  289

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE L+E+KL+D LHGSEYVLTYED++GDWMLVGDVPW+MFIE+CKRL+IMK SDAIGL
Sbjct  290  LGREMLNETKLKDLLHGSEYVLTYEDREGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGL  349

Query  393  APRAKEKSKSR  361
            APRA EK KSR
Sbjct  350  APRAVEKCKSR  360



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQ G  GA
Sbjct  180  TDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQYGLHGA  239

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  240  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  299

Query  393  APRAKEKSKSR  361
            AP A EKSK++
Sbjct  300  APGAVEKSKNK  310



>ref|XP_003597715.1| Auxin-responsive protein IAA [Medicago truncatula]
 gb|AES67966.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=326

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE +GKP    L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S G 
Sbjct  195  NDEAEGKPEFDCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNSPGL  254

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGSDAIGL
Sbjct  255  PGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGSDAIGL  314

Query  393  APRAKEKSKSRN  358
            APRA EKS+S+N
Sbjct  315  APRAMEKSRSQN  326



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALE MFSCFTIG CGS G  
Sbjct  237  EEVDGKAGSGALFVKVSMDGAPYLRKVDLKNYSAYAELSSALENMFSCFTIGSCGSHGNL  296

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G E L+E+KL+D LHGSEYVLTY+DKDGDWMLVGDVPW+MFIE+CKRL+IMK S+AIGLA
Sbjct  297  GGEVLNETKLKDLLHGSEYVLTYKDKDGDWMLVGDVPWEMFIETCKRLRIMKSSEAIGLA  356

Query  390  PRAKEKSKSRN  358
            PRA EKSK RN
Sbjct  357  PRAVEKSKRRN  367



>ref|XP_002284282.1| PREDICTED: auxin-responsive protein IAA27-like [Vitis vinifera]
Length=343

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++ +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y ELSSALEKMFSCFTIGQCGS G 
Sbjct  212  NEDAEGKSGLGCLYVKVSMDGAPYLRKVDLKIYCNYMELSSALEKMFSCFTIGQCGSHGL  271

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGR+ L+ES L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMKGS+AIGL
Sbjct  272  PGRDGLTESHLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEAIGL  331

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  332  APRAMEKCKNRN  343



>emb|CBI28036.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDE-VDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            NDE  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS G
Sbjct  38   NDEDAEGKLGSGCLYVKVSMDGAPYLRKVDLKLYSTYMELSSALEKMFSCFTIGQCGSNG  97

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIG
Sbjct  98   VPIRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIG  157

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK KSRN
Sbjct  158  LAPRAMEKCKSRN  170



>ref|XP_002516003.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
 gb|EEF46423.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
Length=373

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++ +GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSS LEKMFSCFTIGQCGS G 
Sbjct  242  NEDAEGKSGSGCLYVKVSMDGAPYLRKVDLKTYSNYVELSSGLEKMFSCFTIGQCGSHGL  301

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGR+ LSE+ L+D LHGSEYVLTYEDKD DWMLVGDVPW+MF E+C+RL+IMKGS+AIGL
Sbjct  302  PGRDGLSETCLKDLLHGSEYVLTYEDKDSDWMLVGDVPWEMFTETCRRLRIMKGSEAIGL  361

Query  393  APRAKEKSKSRN  358
            APRA EK KSRN
Sbjct  362  APRAMEKCKSRN  373



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 113/133 (85%), Gaps = 12/133 (9%)
 Frame = -3

Query  720  ALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKL  541
             +FVKVSMDGAPYLRKVDLRT A+YQELSSALEKMFSCFTIGQCG +GAP RE LSESKL
Sbjct  186  VIFVKVSMDGAPYLRKVDLRTCATYQELSSALEKMFSCFTIGQCGPEGAPSREVLSESKL  245

Query  540  RDFLHGSEYVLTYEDKDGDWMLVGDVPWD------------MFIESCKRLKIMKGSDAIG  397
            RD LHGSEYVLTYEDKDGDWMLVGDVPWD            MFI SCKRLKIMKGSDAIG
Sbjct  246  RDILHGSEYVLTYEDKDGDWMLVGDVPWDIDYVTDNCCCLRMFISSCKRLKIMKGSDAIG  305

Query  396  LAPRAKEKSKSRN  358
            LAPRA EKSK+RN
Sbjct  306  LAPRALEKSKNRN  318



>ref|XP_002303297.1| auxin-responsive protein IAA27 [Populus trichocarpa]
 gb|EEE78276.1| auxin-responsive protein IAA27 [Populus trichocarpa]
Length=349

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++V+GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS G 
Sbjct  218  NEDVEGKSGYGCLYVKVSMDGAPYLRKVDLKTYSNYLELSSALEKMFSCFTIGQCGSHGL  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ L+ES+L+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF  SC+RL+IMKGS+AIGL
Sbjct  278  RGQDGLTESRLKDILHGSEYVLTYEDKDGDWMLVGDVPWDMFTNSCRRLRIMKGSEAIGL  337

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  338  APRAMEKCKNRN  349



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ GA
Sbjct  206  SDEVDGKPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGTNGA  265

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  266  TGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  325

Query  393  APRAKEKSKSR  361
            APRA EKSK R
Sbjct  326  APRAMEKSKMR  336



>ref|XP_010249636.1| PREDICTED: auxin-responsive protein IAA27 [Nelumbo nucifera]
Length=343

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            ND+ +GK G  G L+VKVSMDGAPYLRKVDL+TY SY ELS+ALEKMFSCFTIGQCGS G
Sbjct  211  NDDAEGKSGSAGCLYVKVSMDGAPYLRKVDLKTYGSYTELSAALEKMFSCFTIGQCGSHG  270

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             PGR+ LS S+L D LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGS+AIG
Sbjct  271  VPGRDGLSASRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFTDSCRRLRIMKGSEAIG  330

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK KSRN
Sbjct  331  LAPRAMEKCKSRN  343



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  205  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  265  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  324

Query  393  APRAKEKSKSR  361
            APRA EKSK R
Sbjct  325  APRAMEKSKMR  335



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 118/134 (88%), Gaps = 4/134 (3%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS GAP
Sbjct  234  EEVDGKSXPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTIGQYGSHGAP  293

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL-  394
            GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF ++CKRL+IMK SDAIGL 
Sbjct  294  GRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTDTCKRLRIMKSSDAIGLG  352

Query  393  --APRAKEKSKSRN  358
               PRA EK ++RN
Sbjct  353  AHTPRAMEKCRNRN  366



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EV+GK G GA+FVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS G  
Sbjct  188  EEVEGKLGSGAMFVKVSMDGAPYLRKVDLKNYSTYAELSSALEKMFSCFTIGQCGSHGNM  247

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE ++E+KL+D +HGSE VLTYEDKDGDWMLVGDVPW MFI++C+RL+IMK SDAIGLA
Sbjct  248  GREIMNETKLKDLIHGSENVLTYEDKDGDWMLVGDVPWKMFIDTCRRLRIMKSSDAIGLA  307

Query  390  PRAKEKSKSRN  358
            PRA EKSKSR+
Sbjct  308  PRAVEKSKSRS  318



>gb|ABK24636.1| unknown [Picea sitchensis]
Length=390

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ +GKPG  AL+VKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFS FTIGQ GS G P
Sbjct  260  DDSEGKPGSNALYVKVSMDGAPYLRKVDLKMYNRYQELSSALEKMFSGFTIGQYGSHGIP  319

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSESKL D LHGSEYVLTYEDKDGDWMLVGDVPW+MF++SCKRL+IMKGSDAIGLA
Sbjct  320  GRDGLSESKLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSDAIGLA  379

Query  390  PRAKEKSKSRN  358
            PRA EK KSR+
Sbjct  380  PRAMEKCKSRS  390



>ref|XP_009380572.1| PREDICTED: auxin-responsive protein IAA21-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++VDGK G G L+VKVSM+GAPYLRKVDL+TY  Y+ELSSALEKMFSCFTIGQC SQG P
Sbjct  162  EDVDGKLGLGCLYVKVSMEGAPYLRKVDLKTYKDYRELSSALEKMFSCFTIGQCNSQGIP  221

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGLA
Sbjct  222  SRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLA  281

Query  390  PRAKEKSKSRN  358
            PRA EK KSRN
Sbjct  282  PRAMEKCKSRN  292



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDG+P  G LFVKVSMDGAPYLRKVDL+TY SY+ELSSALEKMFSCFT+GQ    G 
Sbjct  223  NDEVDGQPELGPLFVKVSMDGAPYLRKVDLKTYTSYKELSSALEKMFSCFTLGQYRPHGI  282

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSE KL+D LH SEYVLTYEDKDGDWMLVGDVPW+MF+E+C++LKIMKGSDAIGL
Sbjct  283  PGRERLSEIKLKDLLHRSEYVLTYEDKDGDWMLVGDVPWEMFMETCRKLKIMKGSDAIGL  342

Query  393  APRAKEKSKS  364
            APR  EKSK+
Sbjct  343  APRETEKSKN  352



>ref|XP_010915883.1| PREDICTED: auxin-responsive protein IAA17-like [Elaeis guineensis]
Length=332

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS G P
Sbjct  202  EDAEGKQGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALEKMFSCFTIGQCGSHGIP  261

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLA
Sbjct  262  GRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLA  321

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  322  PRAMEKCKNRN  332



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  188  TDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGA  247

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  248  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  307

Query  393  APRAKEKSKSR  361
                K K+K R
Sbjct  308  GAVEKSKNKER  318



>ref|XP_009421456.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=311

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ DGK G G L+VKVSMDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS G P
Sbjct  181  DDADGKQGLGCLYVKVSMDGAPYLRKVDLKIYKNYKELSSALEKMFSCFTIGQCGSHGIP  240

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             ++ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGLA
Sbjct  241  SKDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLA  300

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  301  PRAMEKCKNRN  311



>ref|XP_011010527.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Populus 
euphratica]
Length=349

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++V+GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS G 
Sbjct  218  NEDVEGKTGYGCLYVKVSMDGAPYLRKVDLKTYSNYLELSSALEKMFSCFTIGQCGSNGL  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ L+ES+L+D LHGSEYVLTYEDKD DWMLVGDVPWDMF +SC+RL+IMKGS+AIGL
Sbjct  278  RGQDGLTESRLKDILHGSEYVLTYEDKDDDWMLVGDVPWDMFTDSCRRLRIMKGSEAIGL  337

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  338  APRAMEKCKNRN  349



>gb|KDO56957.1| hypothetical protein CISIN_1g019236mg [Citrus sinensis]
Length=344

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S G 
Sbjct  213  NDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGL  272

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPWDMF E+C+RL+IMKGS+AIGL
Sbjct  273  PGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGL  332

Query  393  APRAKEKSKSRN  358
            APRA EK K+R 
Sbjct  333  APRAMEKCKNRT  344



>ref|XP_006465643.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Citrus 
sinensis]
Length=346

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S G 
Sbjct  215  NDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGL  274

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPWDMF E+C+RL+IMKGS+AIGL
Sbjct  275  PGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGL  334

Query  393  APRAKEKSKSRN  358
            APRA EK K+R 
Sbjct  335  APRAMEKCKNRT  346



>ref|XP_009388718.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ D K GPG L+VKVSMDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS G P
Sbjct  180  EDADEKQGPGCLYVKVSMDGAPYLRKVDLKAYNNYKELSSALEKMFSCFTIGQCGSHGIP  239

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF  SCKR++IMKGSDAIGLA
Sbjct  240  GRDGLSESRLTDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTNSCKRMRIMKGSDAIGLA  299

Query  390  PRAKEKSKSR  361
            PRA EK K+R
Sbjct  300  PRAMEKCKNR  309



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+YA+Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  205  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYANYGELSSALEKMFTTFTLGQCGSNGA  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  265  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  324

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  325  AAAPRAMEKSKMR  337



>ref|XP_002514266.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
 gb|EEF48220.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
Length=297

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ + K G G L++KVSMDGAPYLRKVDL+TY+SY ELSS LEKMFSCFTIGQCGS G 
Sbjct  166  DDDAEAKTGSGCLYIKVSMDGAPYLRKVDLKTYSSYMELSSGLEKMFSCFTIGQCGSHGV  225

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW MF ++C+RL+IMK S+AIGL
Sbjct  226  PSRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFTDTCRRLRIMKSSEAIGL  285

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  286  APRAMEKCKNRN  297



>ref|XP_011009359.1| PREDICTED: auxin-responsive protein IAA27-like [Populus euphratica]
Length=347

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++VDGK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF CFTIGQCGS G 
Sbjct  217  NEDVDGKSGYGYLYVKVSMDGAPYLRKVDLKTYGNYVELSSALEKMFGCFTIGQCGSHGL  276

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ L+ES L+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF +SC+RL+IMKGS+AIGL
Sbjct  277  PARDGLTESCLKD-LHGSEYVLTYEDKDGDWMLVGDVPWDMFTDSCRRLRIMKGSEAIGL  335

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  336  APRAMEKCKNRN  347



>ref|XP_006426926.1| hypothetical protein CICLE_v10025988mg [Citrus clementina]
 gb|ESR40166.1| hypothetical protein CICLE_v10025988mg [Citrus clementina]
Length=344

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S G 
Sbjct  213  NDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGL  272

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES+L D LHGSEYVLTYED+DGDWMLVGDVPWDMF E+C+RL+IMKGS+AIGL
Sbjct  273  PGQDGLSESRLMDLLHGSEYVLTYEDRDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGL  332

Query  393  APRAKEKSKSRN  358
            APRA EK K+R 
Sbjct  333  APRAMEKCKNRT  344



>ref|XP_010463453.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Camelina 
sativa]
Length=304

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  171  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  230

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  231  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  290

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  291  AAAPRAVEKSKMR  303



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 7/129 (5%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+ G 
Sbjct  220  NDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGAHGT  279

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+       RLKIMK +DAIGL
Sbjct  280  PGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWE-------RLKIMKSADAIGL  332

Query  393  APRAKEKSK  367
            AP+A +KSK
Sbjct  333  APKAMDKSK  341



>ref|XP_009130522.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=193

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            +DEVDGKPG   ALFVKVSMDGAPYLRKVDLR+Y +Y ELS ALEKMF+ FT+GQCG+ G
Sbjct  61   SDEVDGKPGSAAALFVKVSMDGAPYLRKVDLRSYTNYMELSLALEKMFTTFTLGQCGANG  120

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            A G++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDAIG
Sbjct  121  AAGKDKLCETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDAIG  180

Query  396  LAPRAKEKSKSR  361
            LAPRA EKSK R
Sbjct  181  LAPRAMEKSKMR  192



>ref|XP_002284118.1| PREDICTED: auxin-responsive protein IAA27 [Vitis vinifera]
Length=320

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDE-VDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            NDE  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS G
Sbjct  188  NDEDAEGKLGSGCLYVKVSMDGAPYLRKVDLKLYSTYMELSSALEKMFSCFTIGQCGSNG  247

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIG
Sbjct  248  VPIRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIG  307

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK KSRN
Sbjct  308  LAPRAMEKCKSRN  320



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  723  GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESK  544
            GALFVKVSMDGAPYLRKVDLRTY  Y+ELSSALEKMFSCFT+GQCG+ G  GRE LSE K
Sbjct  239  GALFVKVSMDGAPYLRKVDLRTYTCYKELSSALEKMFSCFTLGQCGTHGIQGRERLSEIK  298

Query  543  LRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKS  364
            L+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++C +LKIMKGSDAIGLAPRA EKSK+
Sbjct  299  LKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCCKLKIMKGSDAIGLAPRAMEKSKN  358

Query  363  R  361
            +
Sbjct  359  K  359



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  205  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  265  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  324

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  325  AAAPRAMEKSKMR  337



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  206  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  265

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  266  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  325

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  326  AAAPRAVEKSKMR  338



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  205  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  265  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  324

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  325  AAAPRAMEKSKMR  337



>ref|XP_006394001.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 ref|XP_006394002.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 dbj|BAJ33783.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31287.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31288.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=339

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ GA
Sbjct  206  SDEVDGKPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGTNGA  265

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  266  TGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  325

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  326  AAAPRAMEKSKMR  338



>gb|AEV89263.1| IAA9 [Musa acuminata AAA Group]
Length=314

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +  D K GPG L+VKVSMDGAPYLRKVDL+ Y +Y+ELS ALEKMFSCFTIGQCGS G P
Sbjct  180  ENADEKQGPGCLYVKVSMDGAPYLRKVDLKAYNNYKELSPALEKMFSCFTIGQCGSHGIP  239

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF  SCKR++IMKGSDAIGLA
Sbjct  240  GRDGLSESRLTDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTNSCKRMRIMKGSDAIGLA  299

Query  390  PRAKEKSKSR  361
            PRA EK K+R
Sbjct  300  PRAMEKCKNR  309



>ref|XP_009617338.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=285

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+E +GK G G L+VKVSMDGAPYLRKVD++TY +Y ELSSALEKMFSCFTIGQC S G 
Sbjct  152  NNETEGKSGAGCLYVKVSMDGAPYLRKVDVKTYTNYAELSSALEKMFSCFTIGQCTSDGL  211

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGL
Sbjct  212  PGREGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGL  271

Query  393  APRAKEKSKSR  361
            APRA  + K++
Sbjct  272  APRAISRCKNQ  282



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  179  SDEVDGKPGSAALFVKVSMDGAPYLRKVDLRSYGNYGELSSALEKMFTTFTLGQCGSNGA  238

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ L E+KL+DFL+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG+DAIGL
Sbjct  239  AGKDMLRETKLKDFLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGADAIGL  298

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  299  AAAPRAMEKSKMR  311



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  206  SDEVDGRPGAGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  265

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  266  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  325

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  326  AAAPRAVEKSKMR  338



>ref|XP_006381732.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
 gb|ERP59529.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
Length=307

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D  + K G G L+VKVSMDGAPYLRKVDL+T+ SY ELSSALEKMFSCFTIGQCGS   
Sbjct  176  DDGAEVKSGSGCLYVKVSMDGAPYLRKVDLKTFGSYMELSSALEKMFSCFTIGQCGSHVV  235

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES+L D LHGSEYVLTYEDKD DWMLVGDVPW MF +SC+RL+IMKGS+AIGL
Sbjct  236  PGQDGLSESRLMDLLHGSEYVLTYEDKDNDWMLVGDVPWKMFTDSCRRLRIMKGSEAIGL  295

Query  393  APRAKEKSKSRN  358
            APRA EK KSRN
Sbjct  296  APRAMEKCKSRN  307



>ref|XP_010924571.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GKPG G L+VKVSMDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS G P
Sbjct  188  EDTEGKPGTGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGSHGIP  247

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ L ES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+A G+A
Sbjct  248  GRDGLGESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEATGIA  307

Query  390  PRAKEKSKSRN  358
            PRA EK KSR+
Sbjct  308  PRAMEKCKSRS  318



>ref|XP_010547581.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE DGKPG GALFVKVSMDGAPYLRKVDLR+ ASY+ELSSALEKMF+ FT+GQCGS GA
Sbjct  209  NDEGDGKPGAGALFVKVSMDGAPYLRKVDLRSCASYRELSSALEKMFTTFTLGQCGSHGA  268

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P ++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CKRLKIMK SDAIGL
Sbjct  269  PVKDILRETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKRLKIMKSSDAIGL  328

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  329  AAAPRAMEKSKIR  341



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  178  SDEVDGKPGSAALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  237

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  238  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGPDAIGL  297

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  298  AAAPRAMEKSKMR  310



>ref|XP_006833393.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
 gb|ERM98671.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
Length=347

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ++E +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQ G  GA
Sbjct  216  SEEGEGKQGLGCLYVKVSMDGAPYLRKVDLKTYLTYTELSSALEKMFSCFTIGQYGPHGA  275

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGR+ L+ES+L D L+GSEYVLTYEDKDGDWMLVGDVPWDMFI SC+RL+IMKGS+AIGL
Sbjct  276  PGRDGLTESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWDMFIGSCRRLRIMKGSEAIGL  335

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  336  APRAMEKCKARN  347



>ref|XP_010444576.1| PREDICTED: auxin-responsive protein IAA9-like [Camelina sativa]
Length=341

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  208  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  267

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  268  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  327

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  328  AAAPRAVEKSKMR  340



>ref|XP_007013106.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30725.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
Length=312

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ + K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS G 
Sbjct  181  DDDAEAKLGSGCLYVKVSMDGAPYLRKVDLKFYGSYKELSSALEKMFSCFTIGQCGSHGV  240

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGL
Sbjct  241  PSRDGLSESRLIDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGL  300

Query  393  APRAKEKSKSRN  358
            APRA EK K+R 
Sbjct  301  APRAMEKCKNRT  312



>ref|XP_007013107.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY30726.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=313

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ + K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS G 
Sbjct  182  DDDAEAKLGSGCLYVKVSMDGAPYLRKVDLKFYGSYKELSSALEKMFSCFTIGQCGSHGV  241

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGL
Sbjct  242  PSRDGLSESRLIDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGL  301

Query  393  APRAKEKSKSRN  358
            APRA EK K+R 
Sbjct  302  APRAMEKCKNRT  313



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 7/120 (6%)
 Frame = -3

Query  717  LFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLR  538
            LFVKVSMDGAPYLRKVDLR YA+YQELSS LEKMFSCFT+GQCGS       N+SE+KLR
Sbjct  227  LFVKVSMDGAPYLRKVDLRAYATYQELSSGLEKMFSCFTLGQCGS-------NMSETKLR  279

Query  537  DFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  358
            D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSKSRN
Sbjct  280  DLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKSRN  339



>gb|KDP37265.1| hypothetical protein JCGZ_06321 [Jatropha curcas]
Length=342

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS G P
Sbjct  213  EDAEGKSGFGCLYVKVSMDGAPYLRKVDLKTYSNYVELSSALEKMFSCFTIGQCGS-GFP  271

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSE+ L+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+AIGLA
Sbjct  272  GRDGLSETCLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCRRLRIMKGSEAIGLA  331

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  332  PRAMEKCKNRN  342



>ref|XP_006451212.1| hypothetical protein CICLE_v10009070mg [Citrus clementina]
 ref|XP_006475666.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Citrus 
sinensis]
 gb|ESR64452.1| hypothetical protein CICLE_v10009070mg [Citrus clementina]
 gb|KDO66456.1| hypothetical protein CISIN_1g022618mg [Citrus sinensis]
Length=292

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ + K G G L+VKVSMDGAPYLRKVDL+TY+SY +LSSALEKMFSCFTIGQC S   
Sbjct  161  DDDSEAKLGLGCLYVKVSMDGAPYLRKVDLKTYSSYIDLSSALEKMFSCFTIGQCSSHNV  220

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK SDAIGL
Sbjct  221  PSRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSDAIGL  280

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  281  APRAMEKCKNRN  292



>ref|XP_006294565.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 ref|XP_006294566.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27463.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27464.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=330

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
             DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG  GA
Sbjct  190  TDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGA  249

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+IGL
Sbjct  250  QGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGL  309



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 118/150 (79%), Gaps = 18/150 (12%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI--------  598
            NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTI        
Sbjct  234  NDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIDAHSGLYG  293

Query  597  ----------GQCGSQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMF  448
                      GQ GS GA GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MF
Sbjct  294  FSCCCFHLLSGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMF  353

Query  447  IESCKRLKIMKGSDAIGLAPRAKEKSKSRN  358
            I +CKRL+IMK +DAIGLAPRA EK ++RN
Sbjct  354  IGTCKRLRIMKSTDAIGLAPRAVEKCRNRN  383



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDEVDGKPG  ALFVKVSMDGAPYLRKVDL +Y SY+ELSSALEK+F+ FT+GQCGS GA
Sbjct  179  NDEVDGKPGSAALFVKVSMDGAPYLRKVDLTSYTSYRELSSALEKLFTTFTLGQCGSHGA  238

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ +  ++L+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMK SDAIGL
Sbjct  239  PGKDMVGRTELKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDACKRLKIMKSSDAIGL  298

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  299  AAAPRAMEKSKIR  311



>ref|XP_008789309.1| PREDICTED: auxin-responsive protein IAA27-like [Phoenix dactylifera]
Length=318

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKVS+DGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS G P
Sbjct  188  EDTEGKQGTGCLYVKVSLDGAPYLRKVDLKKYLNYKELSSALEKMFSCFTIGQCGSHGIP  247

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IM+GS+A+G+A
Sbjct  248  GRDGLSESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEAVGIA  307

Query  390  PRAKEKSKSRN  358
            PRA EK KSRN
Sbjct  308  PRAMEKCKSRN  318



>ref|XP_008462174.1| PREDICTED: auxin-responsive protein IAA27-like [Cucumis melo]
Length=356

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = -3

Query  750  DEVDGKPGP-GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            DE +GK GP G L+VKVSM+GAPYLRKVDL+ Y++Y ELS ALEKMFSCFTIGQCG++G 
Sbjct  225  DEGEGKSGPSGCLYVKVSMEGAPYLRKVDLKLYSNYSELSLALEKMFSCFTIGQCGTEGH  284

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P +E LSES  +DFLHGSEYVLT EDKDGDWMLVGDVPW+MF ESC+RL+IMKGS+AIGL
Sbjct  285  PTKERLSESNSKDFLHGSEYVLTCEDKDGDWMLVGDVPWEMFTESCRRLRIMKGSEAIGL  344

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  345  APRATEKCKNRN  356



>ref|XP_008783241.1| PREDICTED: auxin-responsive protein IAA17-like isoform X1 [Phoenix 
dactylifera]
Length=326

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDEV-DGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            N EV +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS G
Sbjct  194  NKEVAEGKHGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALEKMFSCFTIGQCGSHG  253

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             PGR+ LSES+L D L+GSE+VLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIG
Sbjct  254  IPGRDGLSESRLMDLLNGSEFVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIG  313

Query  396  LAPRAKEKSKSRN  358
            LAP A EK K+R+
Sbjct  314  LAPTAMEKCKNRS  326



>ref|XP_008462746.1| PREDICTED: auxin-responsive protein IAA27 [Cucumis melo]
Length=307

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ DGK G G L+VKVSMDGAPYLRKVDL+TY SY +LSSALEKMFS FTIG CGS G P
Sbjct  177  DDADGKLGSGCLYVKVSMDGAPYLRKVDLKTYVSYVDLSSALEKMFSSFTIGHCGSNGVP  236

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESC R++IMK S+AIGLA
Sbjct  237  NRDALNESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCTRMRIMKSSEAIGLA  296

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  297  PRAMEKCKNRN  307



>ref|XP_008793078.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Phoenix 
dactylifera]
Length=318

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GKPG G L+VKVSMDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS G P
Sbjct  188  EDTEGKPGTGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGSHGIP  247

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ L ES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+AIG+A
Sbjct  248  SRDGLGESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEAIGIA  307

Query  390  PRAKEKSKSRN  358
            PR  EK KSR+
Sbjct  308  PRVMEKCKSRS  318



>ref|XP_010917562.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS   P
Sbjct  188  EDTEGKQGTGCLYVKVSMDGAPYLRKVDLKTYLNYKELSSALEKMFSCFTIGQCGSHEIP  247

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IM+GS+A+G+A
Sbjct  248  GRDGLSESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEAVGIA  307

Query  390  PRAKEKSKSRN  358
            PRA EK KSRN
Sbjct  308  PRAMEKCKSRN  318



>ref|XP_008802939.1| PREDICTED: auxin-responsive protein IAA17-like [Phoenix dactylifera]
Length=320

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++V+GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P
Sbjct  190  EDVEGKQGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIP  249

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLA
Sbjct  250  CRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLA  309

Query  390  PRAKEKSKSRN  358
            PRA EK K+R+
Sbjct  310  PRAMEKCKNRD  320



>ref|XP_002298231.1| hypothetical protein POPTR_0001s18680g [Populus trichocarpa]
 gb|EEE83036.1| hypothetical protein POPTR_0001s18680g [Populus trichocarpa]
Length=335

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N++VDGK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF CFTIGQCGS G 
Sbjct  205  NEDVDGKSGYGYLYVKVSMDGAPYLRKVDLKTYGNYLELSSALEKMFGCFTIGQCGSHGL  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              R+ L+ES L+D LHGSEYVLT+EDKDGDWMLVGDVPWDMF +SC+RL+IMKGS+AIGL
Sbjct  265  AARDGLTESCLKD-LHGSEYVLTFEDKDGDWMLVGDVPWDMFTDSCRRLRIMKGSEAIGL  323

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  324  APRAMEKCKNRN  335



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 18/133 (14%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            VNDEVDGKPGP AL+VKVSMDGAPYLRKVDLR+YA+YQELSSALEKMFSCFTIGQCG+Q 
Sbjct  191  VNDEVDGKPGPSALYVKVSMDGAPYLRKVDLRSYATYQELSSALEKMFSCFTIGQCGAQ-  249

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
                             G+E VLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDAIG
Sbjct  250  -----------------GTENVLTYEDKDGDWMLVGDVPWEMFIASCKRLKIMKGSDAIG  292

Query  396  LAPRAKEKSKSRN  358
            LAPRA EKSK+RN
Sbjct  293  LAPRAVEKSKNRN  305



>ref|XP_009793769.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=298

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N+E +GK G G L+VKVSMDGAPYLRKVD++ Y +Y ELSSALEKMFSCFTIGQC S G 
Sbjct  165  NNETEGKSGAGCLYVKVSMDGAPYLRKVDVKIYTNYAELSSALEKMFSCFTIGQCTSDGL  224

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PGRE LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGL
Sbjct  225  PGREGLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGL  284

Query  393  APRAKEKSKSR  361
            APRA  K K++
Sbjct  285  APRAISKCKNQ  295



>ref|XP_010484401.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
 ref|XP_010484402.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
Length=343

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG G LFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  210  SDEVDGRPGSGVLFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  269

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  270  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  329

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  330  AAAPRAVEKSKMR  342



>emb|CDY18679.1| BnaA09g07160D [Brassica napus]
Length=312

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y  Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  179  SDEVDGKPGSAALFVKVSMDGAPYLRKVDLRSYGKYGELSSALEKMFTTFTLGQCGSNGA  238

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ L E+KL+DFL+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG+DAIGL
Sbjct  239  AGKDMLRETKLKDFLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGADAIGL  298

Query  393  --APRAKEKSKSR  361
              APR  EKSK R
Sbjct  299  TSAPRGMEKSKMR  311



>ref|XP_009381047.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKVSMDGAPYLRKVDL+TY++Y+E S ALEKMFS FTIGQCGS G P
Sbjct  179  EDANGKQGLGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSLALEKMFSGFTIGQCGSHGIP  238

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GR+ LSES+L DFL GSEYVLTYED+DGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLA
Sbjct  239  GRDGLSESRLMDFLSGSEYVLTYEDRDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLA  298

Query  390  PRAKEKSKSRN  358
            PRA EK ++RN
Sbjct  299  PRAMEKCRNRN  309



>ref|XP_009612337.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=315

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
              ++VDGK G   ++VKVSMDGAPYLRKVDL+ Y SY +LSSALEKMFSCFTIGQCG++G
Sbjct  184  TEEDVDGKLGSACVYVKVSMDGAPYLRKVDLKIYKSYNDLSSALEKMFSCFTIGQCGTEG  243

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             P R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF  SCKRLKIMK SDAIG
Sbjct  244  IPIRDGLTESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTGSCKRLKIMKSSDAIG  303

Query  396  LAPRAKEKSKSR  361
            LAPRA EK K+R
Sbjct  304  LAPRAMEKYKNR  315



>emb|CDP03299.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
             +++ D K G G L+VKVSMDGAPYLRKVD++ Y+SY++LSSALEKMFSCFTIGQCGS G
Sbjct  205  TDEDADAKLGTGCLYVKVSMDGAPYLRKVDIKIYSSYKDLSSALEKMFSCFTIGQCGSHG  264

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
               R+ +SES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF++SCKRL+IMK SDAIG
Sbjct  265  VHIRDGMSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFMDSCKRLRIMKSSDAIG  324

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK K+RN
Sbjct  325  LAPRAMEKCKNRN  337



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  729  GPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSE  550
            G G LFVKVSMDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG  GA GRE +SE
Sbjct  143  GLGPLFVKVSMDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGLHGAHGRERMSE  202

Query  549  SKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKS  370
             KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMKGSD+IGLAP A EKS
Sbjct  203  VKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKGSDSIGLAPSAVEKS  262

Query  369  KSRN  358
            K+++
Sbjct  263  KNKD  266



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  729  GPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSE  550
            G G LFVKVSMDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG  GA GRE +SE
Sbjct  143  GLGPLFVKVSMDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGLHGAHGRERMSE  202

Query  549  SKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKS  370
             KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMKGSD+IGLAP A EKS
Sbjct  203  VKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKGSDSIGLAPSAVEKS  262

Query  369  KSRN  358
            K+++
Sbjct  263  KNKD  266



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 3/135 (2%)
 Frame = -3

Query  753  NDEVDGKPGP--GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  580
            N+EVD K G   GA+FVKVSMDGAPYLRKVDL+ Y +Y +LSSALEKMFSCFTIGQC S 
Sbjct  228  NEEVDEKMGSAGGAVFVKVSMDGAPYLRKVDLKNYTAYSQLSSALEKMFSCFTIGQCESH  287

Query  579  GAPGRENL-SESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  403
            G  GRE + +E+KLRD LHGSEYV+TYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDA
Sbjct  288  GNLGREMMMNETKLRDLLHGSEYVITYEDKDGDWMLVGDVPWVMFIDTCKRLRIMKSSDA  347

Query  402  IGLAPRAKEKSKSRN  358
            IGLAPRA EK+KSRN
Sbjct  348  IGLAPRAVEKNKSRN  362



>ref|XP_009130521.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=195

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 3/134 (2%)
 Frame = -3

Query  753  NDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            +DEVDGKPG   ALFVKVSMDGAPYLRKVDLR+Y +Y ELS ALEKMF+ FT+GQCG+ G
Sbjct  61   SDEVDGKPGSAAALFVKVSMDGAPYLRKVDLRSYTNYMELSLALEKMFTTFTLGQCGANG  120

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            A G++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDAIG
Sbjct  121  AAGKDKLCETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDAIG  180

Query  396  L--APRAKEKSKSR  361
            L  APRA EKSK R
Sbjct  181  LAAAPRAMEKSKMR  194



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+ G  
Sbjct  232  EEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGAHGPL  291

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAIGL
Sbjct  292  GREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAIGL  350



>ref|XP_010925905.1| PREDICTED: auxin-responsive protein IAA17-like [Elaeis guineensis]
Length=323

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P
Sbjct  193  EDAEGKQGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIP  252

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIGLA
Sbjct  253  CRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLA  312

Query  390  PRAKEKSKSRN  358
            PRA EK K+R+
Sbjct  313  PRAMEKCKNRD  323



>ref|XP_002864971.1| hypothetical protein ARALYDRAFT_358770 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41230.1| hypothetical protein ARALYDRAFT_358770 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PGPGA+FVKVSMDGAP LRKVDLR+YA+Y ELSSALEKMF+  T+GQCGS GA
Sbjct  275  SDEVDGRPGPGAMFVKVSMDGAPCLRKVDLRSYANYGELSSALEKMFTTLTLGQCGSNGA  334

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+DFL+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK LKIMKG DAIGL
Sbjct  335  AGKDMLSETKLKDFLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKMLKIMKGCDAIGL  394

Query  393  --APRAKEKSKSR  361
              APRA EKSK R
Sbjct  395  AAAPRAMEKSKMR  407



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 4/132 (3%)
 Frame = -3

Query  750  DEVDGKPGPG-ALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +EVDGK G G A+FVKVSMDGAPYLRKVDL+ Y +Y ELSS+LEKMFSCFTIGQC S G 
Sbjct  219  EEVDGKLGSGGAVFVKVSMDGAPYLRKVDLKNYTAYSELSSSLEKMFSCFTIGQCESHG-  277

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
               + L+E+KLRD LHGSEYV+TYEDKDGDWMLVGDVPW+MFI++C+RL+IMK SDAIGL
Sbjct  278  --NQMLNETKLRDLLHGSEYVITYEDKDGDWMLVGDVPWEMFIDTCRRLRIMKSSDAIGL  335

Query  393  APRAKEKSKSRN  358
            APRA EKSKSRN
Sbjct  336  APRAVEKSKSRN  347



>emb|CDY37837.1| BnaAnng04980D [Brassica napus]
Length=296

 Score =   210 bits (535),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 3/134 (2%)
 Frame = -3

Query  753  NDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            +DEVDGKPG   ALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ G
Sbjct  162  SDEVDGKPGSAAALFVKVSMDGAPYLRKVDLRSYTNYMELSSALEKMFTTFTLGQCGANG  221

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            A G++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDAIG
Sbjct  222  AAGKDKLCETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDAIG  281

Query  396  L--APRAKEKSKSR  361
            L  APRA EKSK R
Sbjct  282  LAAAPRAMEKSKMR  295



>ref|XP_010521483.1| PREDICTED: auxin-responsive protein IAA27-like isoform X3 [Tarenaya 
hassleriana]
Length=239

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DE +GK G GAL+VKVSMDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS    
Sbjct  109  DEPEGKSGAGALYVKVSMDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGSHETS  168

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G+  ++E  L+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLA
Sbjct  169  GKGAINEGNLKDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDAIGLA  228

Query  390  PRAKEKSKSRN  358
            PRA EK +SRN
Sbjct  229  PRAMEKCRSRN  239



>ref|XP_004141756.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 ref|XP_004158995.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 gb|KGN45391.1| hypothetical protein Csa_7G447060 [Cucumis sativus]
Length=356

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -3

Query  750  DEVDGKPGP-GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            DE +GK G  G L+VKVSM+GAPYLRKVDL+ Y++Y ELS ALEKMFSCFTIGQCG++G 
Sbjct  225  DEGEGKSGSSGCLYVKVSMEGAPYLRKVDLKLYSNYSELSLALEKMFSCFTIGQCGTEGL  284

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P +E LSES  +DFLHGSEYVLT EDKDGDWMLVGDVPW+MF ESC+RL+IMKGS+AIGL
Sbjct  285  PTKERLSESNSKDFLHGSEYVLTCEDKDGDWMLVGDVPWEMFTESCRRLRIMKGSEAIGL  344

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  345  APRATEKCKNRN  356



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  729  GPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSE  550
            G G LFVKVSMDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG  GA GRE +SE
Sbjct  148  GLGPLFVKVSMDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGLHGAHGRERMSE  207

Query  549  SKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKS  370
             KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMK SD+IGLAP A EKS
Sbjct  208  VKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKSSDSIGLAPSAVEKS  267

Query  369  KSRN  358
            K+++
Sbjct  268  KNKD  271



>ref|XP_009786555.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=269

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G G L+VKV MDGAPYLRKVD++TY+ Y ELSSALEKMFSCF+IGQC S G P
Sbjct  139  NDAEGKSGSGCLYVKVRMDGAPYLRKVDIKTYSDYGELSSALEKMFSCFSIGQCASDGLP  198

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G+E LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLA
Sbjct  199  GQEELSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLA  258

Query  390  PRAKEKSKSRN  358
            PRA  K K++N
Sbjct  259  PRAIHKCKNKN  269



>ref|XP_011072390.1| PREDICTED: auxin-responsive protein IAA27 [Sesamum indicum]
Length=327

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N EV GK G G L+VKVSM+GAPYLRK+DL+TY  Y ELSSALEKMFSCFTIGQ G QG 
Sbjct  197  NSEVAGKSGSGCLYVKVSMEGAPYLRKIDLKTYRCYAELSSALEKMFSCFTIGQYG-QGL  255

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+E LSES L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGL
Sbjct  256  AGQERLSESHLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGL  315

Query  393  APRAKEKSKSRN  358
            APR  +K KS+N
Sbjct  316  APRTMQKCKSQN  327



>ref|XP_004150556.1| PREDICTED: auxin-responsive protein IAA27-like [Cucumis sativus]
 gb|KGN65095.1| hypothetical protein Csa_1G207820 [Cucumis sativus]
Length=306

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ DGK G G L+VKVSMDGAPYLRKVDL+TY SY +LSSALEKMFS FTIG  GS G P
Sbjct  176  DDADGKLGSGCLYVKVSMDGAPYLRKVDLKTYVSYVDLSSALEKMFSSFTIGHYGSNGVP  235

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESC R++IMK S+AIGLA
Sbjct  236  NRDALNESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCTRMRIMKSSEAIGLA  295

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  296  PRAMEKCKNRN  306



>ref|XP_006475665.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Citrus 
sinensis]
 gb|KDO66455.1| hypothetical protein CISIN_1g022618mg [Citrus sinensis]
Length=294

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 114/134 (85%), Gaps = 2/134 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI--GQCGSQ  580
            +D+ + K G G L+VKVSMDGAPYLRKVDL+TY+SY +LSSALEKMFSCFTI  GQC S 
Sbjct  161  DDDSEAKLGLGCLYVKVSMDGAPYLRKVDLKTYSSYIDLSSALEKMFSCFTIVSGQCSSH  220

Query  579  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  400
              P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK SDAI
Sbjct  221  NVPSRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSDAI  280

Query  399  GLAPRAKEKSKSRN  358
            GLAPRA EK K+RN
Sbjct  281  GLAPRAMEKCKNRN  294



>ref|XP_009771095.1| PREDICTED: auxin-responsive protein IAA8-like, partial [Nicotiana 
sylvestris]
Length=277

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
              ++VDG  G   ++VKVSMD APYLRKVDLR Y SY +LS ALEKMFSCFTIGQCG++G
Sbjct  146  TEEDVDGTLGSACVYVKVSMDDAPYLRKVDLRIYKSYNDLSLALEKMFSCFTIGQCGTEG  205

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
             P R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK SDAIG
Sbjct  206  IPIRDGLTESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSDAIG  265

Query  396  LAPRAKEKSKSR  361
            LAPRA EK K+R
Sbjct  266  LAPRAMEKYKNR  277



>gb|KHG03466.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=310

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -3

Query  753  NDEVDG----KPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  586
            ND+ DG    K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCG
Sbjct  175  NDDGDGNAEAKLGSGCLYVKVSMDGAPYLRKVDLKIYGSYKELSSALEKMFSCFTIGQCG  234

Query  585  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  406
            S G  G + LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK ++
Sbjct  235  SHGVSGGDGLSESRLIDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSTE  294

Query  405  AIGLAPRAKEKSKSRN  358
            AIGLAPRA EK K+R 
Sbjct  295  AIGLAPRAMEKCKNRT  310



>gb|AEQ94167.1| auxin induced family protein [Elaeis guineensis]
Length=124

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  729  GPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSE  550
            G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P R+ L E
Sbjct  1    GFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIPCRDGLFE  60

Query  549  SKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKS  370
            S+L D L+GSEYVLTYEDKDGDWML GDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK 
Sbjct  61   SRLMDLLNGSEYVLTYEDKDGDWMLFGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKC  120

Query  369  KSRN  358
            K+R+
Sbjct  121  KNRD  124



>ref|XP_009390697.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ DGK G G L+VKVSMDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIG CGS G P
Sbjct  182  DDADGKQGLGCLYVKVSMDGAPYLRKVDLKMYDNYKELSSALEKMFSCFTIGPCGSHGIP  241

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
              + LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGSDAIGLA
Sbjct  242  NSDGLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCRRLRIMKGSDAIGLA  301

Query  390  PRAKEKSKSRN  358
            PRA EK K+ N
Sbjct  302  PRAMEKCKNWN  312



>ref|XP_010521482.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DE +GK G GAL+VKVSMDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS    
Sbjct  222  DEPEGKSGAGALYVKVSMDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGSHETS  281

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G+  ++E  L+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLA
Sbjct  282  GKGAINEGNLKDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDAIGLA  341

Query  390  PRAKEKSKSRN  358
            PRA EK +SRN
Sbjct  342  PRAMEKCRSRN  352



>ref|XP_008228477.1| PREDICTED: auxin-responsive protein IAA27-like [Prunus mume]
Length=343

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+ +GK   G L+VKVSMDGAPYLRKVDL+TY +Y ELS ALEKMFSCFTIGQC S G 
Sbjct  212  NDDAEGKQESGCLYVKVSMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFTIGQCSSNGI  271

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LS S+L D LHGSE+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+AIGL
Sbjct  272  PERDGLSASRLMDLLHGSEFVLTYEDKDDDWMLVGDVPWKMFTETCRRLRIMKGSEAIGL  331

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  332  APRAVEKCKNRN  343



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            DE +GK G GAL+VKVSMDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS    
Sbjct  222  DEPEGKSGAGALYVKVSMDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGSHETS  281

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G+  ++E  L+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDAIGLA
Sbjct  282  GKGAINEGNLKDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDAIGLA  341

Query  390  PRAKEKSKSRN  358
            PRA EK +SRN
Sbjct  342  PRAMEKCRSRN  352



>ref|XP_009416499.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+  GK G   L+VKVSMDGAPYLRKVDL+TY++Y+ELS ALEKMF+CFTIGQCGS G  
Sbjct  144  DDAKGKQGLECLYVKVSMDGAPYLRKVDLKTYSNYKELSLALEKMFTCFTIGQCGSYGMT  203

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE L+E ++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIG+A
Sbjct  204  GREILTEGRVMDLLLGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGIA  263

Query  390  PRAKEKSKSRN  358
            PRA EKSKSRN
Sbjct  264  PRAMEKSKSRN  274



>ref|XP_007152862.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
 gb|ESW24856.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
Length=307

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  741  DGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRE  562
            D +   G L+VKVSMDGAPYLRKVDL+ + +Y ELSSALEKMF+CFTI QCGS G  GR+
Sbjct  180  DAEAKSGGLYVKVSMDGAPYLRKVDLKIFGTYMELSSALEKMFTCFTISQCGSHGVSGRD  239

Query  561  NLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRA  382
             LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA
Sbjct  240  KLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRA  299

Query  381  KEKSKSRN  358
             EK KSRN
Sbjct  300  MEKCKSRN  307



>gb|ABI36495.1| AUX/IAA27 A [Malus domestica]
Length=115

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -3

Query  705  VSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLH  526
            VSMDGAPYL+KVDL+ Y++YQELSSALEKMF CFT+GQ GS GAPGRE +SESKL+D LH
Sbjct  1    VSMDGAPYLKKVDLKNYSAYQELSSALEKMFRCFTLGQYGSHGAPGRE-ISESKLKDLLH  59

Query  525  GSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  358
            GSEYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  60   GSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLAPRAMEKCRNRN  115



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+V+ K G   L+VKVSMDGAPYLRKVDL+ + +Y+ELSSALEKMFSCFTI Q GS G 
Sbjct  125  NDDVEAKSG--CLYVKVSMDGAPYLRKVDLKIFGTYKELSSALEKMFSCFTISQFGSHGV  182

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+ N+ ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW MFI+SCKRL+IMK S+AIGL
Sbjct  183  FGQGNVCESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSSEAIGL  242

Query  393  APRAKEKSKSRN  358
            APRA EK KSRN
Sbjct  243  APRAMEKCKSRN  254



>gb|AFK45766.1| unknown [Medicago truncatula]
Length=254

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+V+ K G   L+VKVSMDGAPYLRKVDL+ + +Y+ELSSALEKMFSCFTI Q GS G 
Sbjct  125  NDDVEAKSG--CLYVKVSMDGAPYLRKVDLKIFGTYKELSSALEKMFSCFTISQFGSHGV  182

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G+ N+ ES+L DFLHGSEYVLTYEDKDGDWMLVGDVPW MFI+SCKRL+IMK  +AIGL
Sbjct  183  FGQGNVCESRLMDFLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSFEAIGL  242

Query  393  APRAKEKSKSRN  358
            APRA EK KSRN
Sbjct  243  APRAMEKCKSRN  254



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  747  EVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPG  568
            EVDGK G G  FVKVSMDGAPYLRKVD++ Y +Y ELSSALEKMFSCFTIG C S    G
Sbjct  236  EVDGKAGIGVCFVKVSMDGAPYLRKVDIKAYMTYHELSSALEKMFSCFTIGHCTSHMTTG  295

Query  567  RENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAP  388
            RE LS +KL+D +HGSEYVLTY+DKDGDWMLVGDVPW+MF++SC+RL+IMK SDAIGLAP
Sbjct  296  REMLSINKLKDLVHGSEYVLTYKDKDGDWMLVGDVPWEMFVDSCRRLRIMKSSDAIGLAP  355

Query  387  RAKEKSKSRN  358
            RA EK ++R+
Sbjct  356  RAVEKCRNRS  365



>ref|XP_007160318.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
 gb|ESW32312.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
Length=291

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG-  577
            ND+ + +     L+VKVSM+GAPYLRKVDL ++ +Y+ELS ALEKMFSCFTI QCGS G 
Sbjct  159  NDDAEAEAKSECLYVKVSMEGAPYLRKVDLNSFGTYKELSLALEKMFSCFTISQCGSYGV  218

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
            + GRENLSES+L D LHGSEYVLTYED+DGDWMLVGDVPW+MF ESCKRL+IMK S+AIG
Sbjct  219  SSGRENLSESRLMDLLHGSEYVLTYEDRDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIG  278

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK KSRN
Sbjct  279  LAPRAVEKCKSRN  291



>ref|XP_009352507.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=318

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DE +GK G G L+VKVSMDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIG CGS GA
Sbjct  188  DDEAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLELSLALEKMFSCFTIGHCGSHGA  247

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              R+ LSES+L D LHG+EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+A+GL
Sbjct  248  -SRDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAMGL  306

Query  393  APRAKEKSKSRN  358
            APRA +K K+ N
Sbjct  307  APRAMQKCKNSN  318



>ref|XP_009409066.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ DGK G G L+VKVSMDGAPYLRKVDL+TY +Y E S ALEKMFS FTIGQCGS   P
Sbjct  192  EDADGKQGLGCLYVKVSMDGAPYLRKVDLKTYNNYNEFSVALEKMFSGFTIGQCGSHAIP  251

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ LSES+L D L GSEYVLT EDKDGDWMLVGDVPW+MFI+SC+RL+IMKGSDAIGLA
Sbjct  252  SRDGLSESRLMDLLSGSEYVLTCEDKDGDWMLVGDVPWEMFIDSCRRLRIMKGSDAIGLA  311

Query  390  PRAKEKSKSRN  358
            PRA EK K+RN
Sbjct  312  PRAMEKCKNRN  322



>ref|NP_001280937.1| auxin-responsive protein IAA27 [Malus domestica]
 gb|ADL36581.1| ARF domain class transcription factor [Malus domestica]
Length=319

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ +GK G G L+VKVSMDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCGS GA 
Sbjct  190  DDAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGAS  249

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ LSES+L D LHG+EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIGLA
Sbjct  250  -RDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLA  308

Query  390  PRAKEKSKSRN  358
            PRA +K K+ N
Sbjct  309  PRAMQKCKNSN  319



>ref|XP_009336858.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=319

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ +GK G G L+VKVSMDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCGS GA
Sbjct  189  DDDAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGA  248

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              R+ LSES+L D LHG+EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AIGL
Sbjct  249  -SRDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGL  307

Query  393  APRAKEKSKSRN  358
            APRA +K K+ N
Sbjct  308  APRAMQKCKNGN  319



>gb|KJB54240.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
 gb|KJB54245.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
Length=310

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 4/136 (3%)
 Frame = -3

Query  753  NDEVDG----KPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  586
            ND+ DG    K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCG
Sbjct  175  NDDGDGNAEAKLGSGCLYVKVSMDGAPYLRKVDLKIYGSYKELSSALEKMFSCFTIGQCG  234

Query  585  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  406
            S G    + L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK ++
Sbjct  235  SHGVSSGDGLTESRLVDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSTE  294

Query  405  AIGLAPRAKEKSKSRN  358
            AIGLAPRA EK K+R 
Sbjct  295  AIGLAPRAMEKCKNRT  310



>ref|XP_008793077.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Phoenix 
dactylifera]
Length=322

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 4/135 (3%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GKPG G L+VKVSMDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS G P
Sbjct  188  EDTEGKPGTGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGSHGIP  247

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL-  394
             R+ L ES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+AIG+ 
Sbjct  248  SRDGLGESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEAIGIG  307

Query  393  ---APRAKEKSKSRN  358
               +PR  EK KSR+
Sbjct  308  TCKSPRVMEKCKSRS  322



>ref|XP_007024229.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY26851.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=339

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  723  GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESK  544
            G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G P R+ L+ES+
Sbjct  218  GCLYVKVSMDGAPYLRKVDLKTYKNYTELSSALEKMFSCFTIGQCSSHGLPVRDGLTESR  277

Query  543  LRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKS  364
            L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K+
Sbjct  278  LMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKN  337

Query  363  RN  358
            + 
Sbjct  338  QT  339



>gb|KHN41649.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=287

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  756  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  577
            + ++ D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G
Sbjct  155  LKNDTDAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYG  214

Query  576  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  397
               RENLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK  +AIG
Sbjct  215  VSSRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIG  274

Query  396  LAPRAKEKSKSRN  358
            LAPRA EK KSRN
Sbjct  275  LAPRAMEKCKSRN  287



>ref|XP_009406220.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=279

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G   L++KVSMDGAPYLRKVDL+TYA+Y+ELS AL KMF+CFTIGQCG+ G  
Sbjct  149  EDAEGKQGVDCLYIKVSMDGAPYLRKVDLKTYANYKELSLALAKMFTCFTIGQCGAHGMS  208

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             RE L+E ++ D L GSEYVLTYEDKD DWMLVGDVPWDMF +SC+RL+IMKGSDAIG+A
Sbjct  209  SRETLTEGRVMDLLQGSEYVLTYEDKDSDWMLVGDVPWDMFTDSCRRLRIMKGSDAIGIA  268

Query  390  PRAKEKSKSRN  358
            PRA EKSKS+N
Sbjct  269  PRAMEKSKSQN  279



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 6/131 (5%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +EVDGK G GALF+KVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIG      A 
Sbjct  235  EEVDGKLGSGALFIKVSMDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIG------AL  288

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            GRE LSESKL+D L G+EYVLTYEDKDGDWMLVGDVPW+MF+++CKRL+IMK  DAIGLA
Sbjct  289  GREMLSESKLKDLLDGAEYVLTYEDKDGDWMLVGDVPWEMFLDTCKRLRIMKSCDAIGLA  348

Query  390  PRAKEKSKSRN  358
            PRA EKSK++N
Sbjct  349  PRAVEKSKNKN  359



>ref|NP_001239808.1| uncharacterized protein LOC100778529 [Glycine max]
 gb|ACU23444.1| unknown [Glycine max]
Length=287

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G  
Sbjct  157  NDTDAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVS  216

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             RENLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK  +AIGLA
Sbjct  217  SRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIGLA  276

Query  390  PRAKEKSKSRN  358
            PRA EK KSRN
Sbjct  277  PRAMEKCKSRN  287



>ref|XP_009380571.1| PREDICTED: auxin-responsive protein IAA21-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=317

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 117/156 (75%), Gaps = 25/156 (16%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++VDGK G G L+VKVSM+GAPYLRKVDL+TY  Y+ELSSALEKMFSCFTIGQC SQG P
Sbjct  162  EDVDGKLGLGCLYVKVSMEGAPYLRKVDLKTYKDYRELSSALEKMFSCFTIGQCNSQGIP  221

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIM---------  418
             R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IM         
Sbjct  222  SRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGLG  281

Query  417  ----------------KGSDAIGLAPRAKEKSKSRN  358
                            KGSDAIGLAPRA EK KSRN
Sbjct  282  KFRQTEILNNLQSELLKGSDAIGLAPRAMEKCKSRN  317



>ref|XP_006343091.1| PREDICTED: auxin-responsive protein IAA27-like [Solanum tuberosum]
Length=278

 Score =   204 bits (520),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -3

Query  741  DGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRE  562
            +GK G   L+VKVSMDGAPYLRKVD++TY++Y ELSSALEKMFSCF+IGQC S   PG+E
Sbjct  151  EGKTGSSCLYVKVSMDGAPYLRKVDIKTYSNYAELSSALEKMFSCFSIGQCASDRLPGQE  210

Query  561  NLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRA  382
             LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLAPRA
Sbjct  211  KLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLAPRA  270

Query  381  KEKSKSRN  358
              K K++N
Sbjct  271  INKCKNQN  278



>ref|XP_004302884.1| PREDICTED: auxin-responsive protein IAA27-like [Fragaria vesca 
subsp. vesca]
Length=338

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+ +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y ELS ALEKMFSCF IGQC S G 
Sbjct  207  NDDAEGKQGSGCLYVKVSMDGAPYLRKVDLKMYNNYMELSMALEKMFSCFIIGQCSSNGF  266

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P ++ LSES+L D LHGSEYVLT+EDKD DWMLVGDVPW MF E+C++L+IMKGS+AIGL
Sbjct  267  PKKDGLSESRLMDLLHGSEYVLTFEDKDDDWMLVGDVPWGMFTETCRKLRIMKGSEAIGL  326

Query  393  APRAKEKSKSRN  358
            APRA EK ++RN
Sbjct  327  APRAMEKCRNRN  338



>ref|XP_008242568.1| PREDICTED: auxin-responsive protein IAA27 [Prunus mume]
Length=319

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ +GK GPG L+VKVSMDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIGQCGS G 
Sbjct  189  DDDAEGKMGPGCLYVKVSMDGAPYLRKVDLKTYGSYVELSLALEKMFSCFTIGQCGSHGV  248

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              R+ LSES+L D L+G+EYVLTYEDKDGDWMLVGDVPW+MF ++CKR++IMK S+AIGL
Sbjct  249  S-RDGLSESRLMDLLNGAEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRMRIMKSSEAIGL  307

Query  393  APRAKEKSKSRN  358
            APRA +K K  N
Sbjct  308  APRAVQKCKKSN  319



>gb|KHN16618.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=283

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  744  VDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGR  565
             D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G   R
Sbjct  155  ADAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSR  214

Query  564  ENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPR  385
            ENLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPR
Sbjct  215  ENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPR  274

Query  384  AKEKSKSR  361
            A EK KSR
Sbjct  275  AMEKCKSR  282



>gb|KHG27397.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=237

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            N E +G+   G  +VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFT+G C S G 
Sbjct  106  NSEKNGEDAAGCHYVKVSMDGAPYLRKVDLKTYKTYMELSSALEKMFTCFTLGHCSSNGL  165

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI SCKRL+I+KGS+AIGL
Sbjct  166  AVRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFINSCKRLRIVKGSEAIGL  225

Query  393  APRAKEKSKSRN  358
            APRA EK K+++
Sbjct  226  APRAMEKCKNQS  237



>ref|XP_007203891.1| hypothetical protein PRUPE_ppa009134mg [Prunus persica]
 gb|EMJ05090.1| hypothetical protein PRUPE_ppa009134mg [Prunus persica]
Length=305

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +D+ +GK GPG L+VKVSMDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIGQCGS G 
Sbjct  175  DDDAEGKMGPGCLYVKVSMDGAPYLRKVDLKTYGSYVELSLALEKMFSCFTIGQCGSHGV  234

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
              R+ LSES+L D L+G+EYVLTYEDKDGDWMLVGDVPW+MF ++CKR++IMK S+AIGL
Sbjct  235  -SRDGLSESRLMDLLNGAEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRMRIMKSSEAIGL  293

Query  393  APRAKEKSKSRN  358
            APRA +K K  N
Sbjct  294  APRAMQKCKKSN  305



>ref|XP_010098105.1| Auxin-responsive protein IAA27 [Morus notabilis]
 gb|EXB74542.1| Auxin-responsive protein IAA27 [Morus notabilis]
Length=344

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            +E   K G G L+VKVSMDGAPYLRKVDL+T  +Y+ELS ALEKMFSCFTIGQCG+ G P
Sbjct  214  EETQDKSGSGCLYVKVSMDGAPYLRKVDLKTCTNYRELSLALEKMFSCFTIGQCGASGLP  273

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
             R+ L+ES+L D LHGSEYV+TYEDKD DWMLVGDVPWDMF ++C+RL+IMKGS+AIGLA
Sbjct  274  ERKGLTESRLMDLLHGSEYVVTYEDKDEDWMLVGDVPWDMFTDTCRRLRIMKGSEAIGLA  333

Query  390  PRAKEKSKSRN  358
            PRA EK K++N
Sbjct  334  PRAMEKCKNQN  344



>ref|XP_009614298.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=269

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            ++ +GK G   L+VKV MDGAPYLRKVD++TY++Y ELSSALEKMFSCF+IGQC S   P
Sbjct  139  NDAEGKSGSSCLYVKVRMDGAPYLRKVDIKTYSNYGELSSALEKMFSCFSIGQCTSDRLP  198

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G+E LSES L D ++GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGLA
Sbjct  199  GQEELSESHLMDLVNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGLA  258

Query  390  PRAKEKSKSRN  358
            PRAK K K+++
Sbjct  259  PRAKNKCKNQS  269



>ref|XP_008348504.1| PREDICTED: auxin-responsive protein IAA21-like isoform X1 [Malus 
domestica]
Length=322

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+  GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELS ALEKMFSCF IGQC S G 
Sbjct  191  NDDAAGKQGSGCLYVKVSMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFNIGQCSSNGL  250

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LS S+L D L+GSE+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+AIGL
Sbjct  251  PERDGLSASRLMDLLNGSEFVLTYEDKDDDWMLVGDVPWQMFTETCRRLRIMKGSEAIGL  310

Query  393  APRAKEKSKSRN  358
            APRA  K K+RN
Sbjct  311  APRAAGKCKNRN  322



>ref|XP_003534212.1| PREDICTED: auxin-responsive protein IAA27 [Glycine max]
 gb|KHN45622.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  720  ALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKL  541
             L+VKVSMDGAPYLRKVDL+ + +Y ELSSALEKMFSCFTI QCGS G  GR+ L+E++L
Sbjct  187  CLYVKVSMDGAPYLRKVDLKNFGTYMELSSALEKMFSCFTISQCGSHGVCGRDKLTENRL  246

Query  540  RDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSR  361
             D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AIGLAPRA EK KSR
Sbjct  247  MDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAIGLAPRAMEKCKSR  306

Query  360  N  358
            N
Sbjct  307  N  307



>ref|XP_008348505.1| PREDICTED: auxin-responsive protein IAA21-like isoform X2 [Malus 
domestica]
Length=321

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+  GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELS ALEKMFSCF IGQC S G 
Sbjct  190  NDDAAGKQGSGCLYVKVSMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFNIGQCSSNGL  249

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LS S+L D L+GSE+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+AIGL
Sbjct  250  PERDGLSASRLMDLLNGSEFVLTYEDKDDDWMLVGDVPWQMFTETCRRLRIMKGSEAIGL  309

Query  393  APRAKEKSKSRN  358
            APRA  K K+RN
Sbjct  310  APRAAGKCKNRN  321



>ref|XP_006584572.1| PREDICTED: uncharacterized protein LOC100795749 isoform X1 [Glycine 
max]
Length=357

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  741  DGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRE  562
            D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G   RE
Sbjct  230  DAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRE  289

Query  561  NLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRA  382
            NLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AIGLAPRA
Sbjct  290  NLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRA  349

Query  381  KEKSKSR  361
             EK KSR
Sbjct  350  MEKCKSR  356



>ref|XP_009377833.1| PREDICTED: auxin-responsive protein IAA21-like [Pyrus x bretschneideri]
 ref|XP_009346094.1| PREDICTED: auxin-responsive protein IAA21-like [Pyrus x bretschneideri]
Length=331

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+ +GK G G L+VKV MDGAPYLRKVDL+TY +Y ELS ALEKMFSCFTIGQC   G 
Sbjct  200  NDDAEGKQGSGCLYVKVGMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFTIGQCSCNGL  259

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P R+ LS S+L D L+GSE+VLTYED+D DWMLVGDVPW MF E+C+RL+IMKGS+AIGL
Sbjct  260  PERDGLSASRLMDLLNGSEFVLTYEDRDDDWMLVGDVPWQMFTETCRRLRIMKGSEAIGL  319

Query  393  APRAKEKSKSRN  358
            APRA EK K+RN
Sbjct  320  APRAVEKCKNRN  331



>gb|KCW69643.1| hypothetical protein EUGRSUZ_F03050 [Eucalyptus grandis]
Length=340

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 4/131 (3%)
 Frame = -3

Query  750  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  571
            D+ +GK     L+VKVSMDGAPYLRKVDLRTY SY ELS+ALEKMFSCFTIG C S+G  
Sbjct  214  DDAEGK----CLYVKVSMDGAPYLRKVDLRTYGSYSELSTALEKMFSCFTIGHCDSRGPL  269

Query  570  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  391
            G+E+LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK S+AIGLA
Sbjct  270  GQESLSESRLADLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSEAIGLA  329

Query  390  PRAKEKSKSRN  358
            PRA EK KSR+
Sbjct  330  PRATEKCKSRD  340



>ref|NP_001266034.1| IAA6 protein [Solanum lycopersicum]
 gb|AEX00366.1| IAA27 [Solanum lycopersicum]
Length=278

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ND+ +G+ G   L+VKVSMDGAPYLRKVD++TY++Y  LSSALEKMFSCF+IGQC S   
Sbjct  148  NDD-EGRTGSSCLYVKVSMDGAPYLRKVDIKTYSNYAALSSALEKMFSCFSIGQCASDKI  206

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG+E LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGL
Sbjct  207  PGQEKLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGL  266

Query  393  APRAKEKSKSRN  358
            APRA  K K++N
Sbjct  267  APRAINKCKNQN  278



>ref|XP_006584591.1| PREDICTED: uncharacterized protein LOC100804782 isoform X1 [Glycine 
max]
 gb|KHN05349.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=305

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            ++E + K G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQC S+  
Sbjct  174  DNEAEEKSGVGCLYVKVSMDGAPYLRKVDLKTYSNYIELSSALEKMFSCFTIGQCNSRAL  233

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            PG++ LSES  RD + GSEYVLTYEDK+GDWMLVGDVPW MF ESCK+L+IMKGS+AIGL
Sbjct  234  PGKDGLSESAFRDLVDGSEYVLTYEDKEGDWMLVGDVPWKMFTESCKKLRIMKGSEAIGL  293

Query  393  APRAKEKSKSR  361
            APR  EK +S+
Sbjct  294  APRGMEKFRSQ  304



>dbj|BAB10673.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=333

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS GA
Sbjct  205  SDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGA  264

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
             G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAIGL
Sbjct  265  AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL  324



>ref|XP_010547580.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  753  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  574
            NDE DGKPG GALFVKVSMDGAPYLRKVDLR+ ASY+ELSSALEKMF+ FT+GQCGS GA
Sbjct  209  NDEGDGKPGAGALFVKVSMDGAPYLRKVDLRSCASYRELSSALEKMFTTFTLGQCGSHGA  268

Query  573  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  394
            P ++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CKRLKIMK SDAIGL
Sbjct  269  PVKDILRETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKRLKIMKSSDAIGL  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260