BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033O21

Length=696
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613870.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    214   8e-63   Nicotiana tomentosiformis
ref|XP_009777282.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    215   9e-63   Nicotiana sylvestris
ref|XP_009777281.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    215   1e-62   Nicotiana sylvestris
ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like              214   2e-62   Solanum lycopersicum
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...    214   2e-62   Solanum tuberosum [potatoes]
ref|XP_009777280.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    214   4e-62   Nicotiana sylvestris
emb|CDP04938.1|  unnamed protein product                                213   6e-62   Coffea canephora [robusta coffee]
ref|XP_006443191.1|  hypothetical protein CICLE_v10019791mg             212   1e-61   Citrus clementina [clementine]
ref|XP_010261641.1|  PREDICTED: D-xylose-proton symporter-like 2        207   1e-60   Nelumbo nucifera [Indian lotus]
gb|AAF26115.1|AC012328_18  hypothetical protein                         204   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137173.1|  PREDICTED: D-xylose-proton symporter-like 2-...    207   5e-60   Cucumis sativus [cucumbers]
ref|XP_007131530.1|  hypothetical protein PHAVU_011G020700g             207   1e-59   Phaseolus vulgaris [French bean]
gb|KDP21779.1|  hypothetical protein JCGZ_00566                         207   1e-59   Jatropha curcas
emb|CDX92030.1|  BnaC03g33320D                                          206   3e-59   
ref|XP_009382608.1|  PREDICTED: D-xylose-proton symporter-like 2        206   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007029560.1|  Major facilitator superfamily protein              206   3e-59   
gb|ABK95072.1|  unknown                                                 205   6e-59   Populus trichocarpa [western balsam poplar]
emb|CDY43152.1|  BnaA05g32340D                                          204   8e-59   Brassica napus [oilseed rape]
ref|NP_186959.2|  vacuolar glucose transporter 1                        204   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520022.1|  sugar transporter, putative                        204   1e-58   
gb|KJB26764.1|  hypothetical protein B456_004G258400                    204   1e-58   Gossypium raimondii
ref|XP_009119042.1|  PREDICTED: D-xylose-proton symporter-like 1        204   1e-58   Brassica rapa
emb|CDX92028.1|  BnaC03g33300D                                          203   1e-58   
ref|XP_011008112.1|  PREDICTED: D-xylose-proton symporter-like 2        204   2e-58   Populus euphratica
emb|CDY28736.1|  BnaCnng06220D                                          204   2e-58   Brassica napus [oilseed rape]
ref|XP_009130331.1|  PREDICTED: D-xylose-proton symporter-like 1        204   2e-58   Brassica rapa
ref|XP_010489652.1|  PREDICTED: D-xylose-proton symporter-like 1        202   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_007219039.1|  hypothetical protein PRUPE_ppa004602mg             202   4e-58   Prunus persica
gb|ADP37177.1|  putative vacuolar glucose transporter                   201   4e-58   Vitis vinifera
ref|XP_008234574.1|  PREDICTED: D-xylose-proton symporter-like 2        202   5e-58   Prunus mume [ume]
emb|CDY49922.1|  BnaCnng18320D                                          202   5e-58   Brassica napus [oilseed rape]
emb|CDX74227.1|  BnaA03g28200D                                          202   6e-58   
ref|XP_010463755.1|  PREDICTED: D-xylose-proton symporter-like 1        202   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009134719.1|  PREDICTED: D-xylose-proton symporter-like 1        202   7e-58   Brassica rapa
ref|XP_010506301.1|  PREDICTED: D-xylose-proton symporter-like 1        202   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009351838.1|  PREDICTED: D-xylose-proton symporter-like 2        202   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_002873804.1|  sugar transporter family protein                   202   1e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_006590767.1|  PREDICTED: D-xylose-proton symporter-like 2-...    200   1e-57   
ref|XP_006287575.1|  hypothetical protein CARUB_v10000784mg             201   1e-57   
ref|XP_003540611.1|  PREDICTED: D-xylose-proton symporter-like 2-...    201   1e-57   Glycine max [soybeans]
ref|XP_010662115.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    201   1e-57   Vitis vinifera
gb|KHN46451.1|  D-xylose-proton symporter-like 2                        201   1e-57   Glycine soja [wild soybean]
ref|XP_002277076.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    201   1e-57   Vitis vinifera
ref|NP_850835.2|  D-xylose-proton symporter-like 2                      201   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453878.1|  PREDICTED: D-xylose-proton symporter-like 2        201   2e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001065505.1|  Os10g0579200                                       201   2e-57   
ref|XP_004505609.1|  PREDICTED: D-xylose-proton symporter-like 2-...    200   3e-57   Cicer arietinum [garbanzo]
ref|XP_003607412.1|  D-xylose-proton symporter-like protein             200   3e-57   Medicago truncatula
gb|KFK25925.1|  hypothetical protein AALP_AA8G181200                    200   3e-57   Arabis alpina [alpine rockcress]
ref|XP_009361176.1|  PREDICTED: D-xylose-proton symporter-like 2        200   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_006662109.1|  PREDICTED: D-xylose-proton symporter-like 2-...    200   4e-57   Oryza brachyantha
ref|XP_010933396.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    200   5e-57   Elaeis guineensis
gb|KHN05527.1|  D-xylose-proton symporter-like 2                        200   5e-57   Glycine soja [wild soybean]
ref|XP_003537722.1|  PREDICTED: D-xylose-proton symporter-like 2-...    200   5e-57   Glycine max [soybeans]
ref|XP_002884358.1|  sugar transporter family protein                   200   5e-57   
ref|XP_010420407.1|  PREDICTED: D-xylose-proton symporter-like 2        199   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008362818.1|  PREDICTED: D-xylose-proton symporter-like 2        199   7e-57   Malus domestica [apple tree]
gb|KFK37751.1|  hypothetical protein AALP_AA3G025300                    199   1e-56   Arabis alpina [alpine rockcress]
gb|AFK39030.1|  unknown                                                 199   1e-56   Medicago truncatula
dbj|BAJ88105.1|  predicted protein                                      199   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55132.1|  D-xylose-proton symporter-like 2                        199   1e-56   Triticum urartu
ref|XP_011470132.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    197   6e-56   Fragaria vesca subsp. vesca
ref|XP_004307871.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    197   6e-56   Fragaria vesca subsp. vesca
ref|XP_010558647.1|  PREDICTED: D-xylose-proton symporter-like 2        197   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_008791055.1|  PREDICTED: D-xylose-proton symporter-like 2        196   6e-56   
ref|XP_010671130.1|  PREDICTED: D-xylose-proton symporter-like 2        196   2e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU43459.1|  hypothetical protein MIMGU_mgv1a004913mg                195   3e-55   Erythranthe guttata [common monkey flower]
ref|XP_008455658.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    193   3e-55   
ref|XP_008376911.1|  PREDICTED: D-xylose-proton symporter-like 2        195   4e-55   Malus domestica [apple tree]
ref|XP_008644913.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    194   6e-55   Zea mays [maize]
ref|XP_008644912.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    194   6e-55   Zea mays [maize]
ref|XP_010920045.1|  PREDICTED: D-xylose-proton symporter-like 2        194   8e-55   Elaeis guineensis
gb|KDO39943.1|  hypothetical protein CISIN_1g0102391mg                  192   1e-54   Citrus sinensis [apfelsine]
ref|XP_002464862.1|  hypothetical protein SORBIDRAFT_01g027800          194   1e-54   Sorghum bicolor [broomcorn]
gb|AFW67123.1|  hypothetical protein ZEAMMB73_874760                    187   2e-54   
ref|XP_008455657.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    192   3e-54   Cucumis melo [Oriental melon]
ref|XP_003574402.1|  PREDICTED: D-xylose-proton symporter-like 2        192   3e-54   Brachypodium distachyon [annual false brome]
ref|XP_008809219.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    192   3e-54   
gb|KDO39944.1|  hypothetical protein CISIN_1g0102391mg                  192   3e-54   Citrus sinensis [apfelsine]
ref|XP_002463619.1|  hypothetical protein SORBIDRAFT_01g003010          186   5e-54   
ref|XP_006408343.1|  hypothetical protein EUTSA_v10020565mg             191   8e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001173691.1|  Os03g0823200                                       184   4e-53   
ref|XP_010685696.1|  PREDICTED: D-xylose-proton symporter-like 3,...    190   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004309072.1|  PREDICTED: D-xylose-proton symporter-like 2        188   1e-52   Fragaria vesca subsp. vesca
ref|XP_011075803.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    188   1e-52   Sesamum indicum [beniseed]
ref|XP_011075802.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    188   2e-52   
ref|XP_010256836.1|  PREDICTED: D-xylose-proton symporter-like 3,...    187   5e-52   Nelumbo nucifera [Indian lotus]
dbj|BAH19966.1|  AT5G59250                                              184   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008681531.1|  PREDICTED: uncharacterized protein LOC100274...    187   9e-52   
ref|XP_008681530.1|  PREDICTED: uncharacterized protein LOC100274...    187   1e-51   Zea mays [maize]
ref|XP_010106537.1|  D-xylose-proton symporter-like 3                   185   2e-51   
ref|XP_002300123.2|  hypothetical protein POPTR_0001s25100g             186   3e-51   
ref|XP_006279761.1|  hypothetical protein CARUB_v10027739mg             186   3e-51   Capsella rubella
ref|XP_006400240.1|  hypothetical protein EUTSA_v10013319mg             184   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_009126154.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    184   3e-51   Brassica rapa
ref|XP_006651969.1|  PREDICTED: D-xylose-proton symporter-like 3,...    184   3e-51   Oryza brachyantha
ref|XP_009126155.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    184   3e-51   Brassica rapa
emb|CDX85478.1|  BnaA02g03350D                                          184   4e-51   
gb|EEE60202.1|  hypothetical protein OsJ_13164                          184   4e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010454633.1|  PREDICTED: D-xylose-proton symporter-like 3,...    185   6e-51   Camelina sativa [gold-of-pleasure]
emb|CDY54245.1|  BnaC09g53840D                                          184   7e-51   Brassica napus [oilseed rape]
gb|ABK24923.1|  unknown                                                 184   7e-51   Picea sitchensis
ref|XP_009120413.1|  PREDICTED: D-xylose-proton symporter-like 3,...    184   7e-51   Brassica rapa
emb|CDY33006.1|  BnaA10g12120D                                          184   7e-51   Brassica napus [oilseed rape]
gb|AAO18445.1|  putative sugar transporter protein                      184   7e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010535452.1|  PREDICTED: D-xylose-proton symporter-like 3,...    184   7e-51   Tarenaya hassleriana [spider flower]
ref|XP_002866311.1|  hypothetical protein ARALYDRAFT_919128             184   8e-51   Arabidopsis lyrata subsp. lyrata
gb|EMT10196.1|  D-xylose-proton symporter-like protein 2                184   9e-51   
gb|ABF99614.1|  sugar transporter family protein, putative, expre...    184   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007016336.1|  Major facilitator superfamily protein isoform 1    184   1e-50   
ref|XP_010443656.1|  PREDICTED: D-xylose-proton symporter-like 3,...    184   1e-50   Camelina sativa [gold-of-pleasure]
ref|NP_200733.2|  Major facilitator superfamily protein                 184   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KJB26763.1|  hypothetical protein B456_004G258400                    182   1e-50   Gossypium raimondii
dbj|BAE98379.1|  D-xylose-H+ symporter - like protein                   184   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001287653.1|  D-xylose-proton symporter-like 3, chloroplas...    184   1e-50   Solanum lycopersicum
gb|KJB20004.1|  hypothetical protein B456_003G129000                    183   1e-50   Gossypium raimondii
ref|XP_010483521.1|  PREDICTED: D-xylose-proton symporter-like 3,...    184   1e-50   Camelina sativa [gold-of-pleasure]
gb|EEC76432.1|  hypothetical protein OsI_14118                          184   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006342314.1|  PREDICTED: D-xylose-proton symporter-like 3,...    183   2e-50   Solanum tuberosum [potatoes]
gb|KJB20000.1|  hypothetical protein B456_003G129000                    183   2e-50   Gossypium raimondii
ref|XP_006401006.1|  hypothetical protein EUTSA_v10013139mg             183   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_011035266.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   3e-50   Populus euphratica
ref|XP_011035268.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   4e-50   Populus euphratica
ref|XP_006854111.1|  hypothetical protein AMTR_s00048p00147550          181   4e-50   Amborella trichopoda
ref|XP_004981232.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   4e-50   Setaria italica
ref|XP_009779936.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   4e-50   Nicotiana sylvestris
gb|ABB17074.1|  putative sugar transporter                              182   5e-50   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009381068.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY38076.1|  BnaC02g06970D                                          181   7e-50   Brassica napus [oilseed rape]
ref|XP_004170091.1|  PREDICTED: D-xylose-proton symporter-like 2-...    180   7e-50   
ref|XP_009605730.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   7e-50   Nicotiana tomentosiformis
gb|KDP42213.1|  hypothetical protein JCGZ_02943                         181   1e-49   Jatropha curcas
ref|XP_010043498.1|  PREDICTED: D-xylose-proton symporter-like 3,...    181   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010087486.1|  D-xylose-proton symporter-like 2                   180   2e-49   
dbj|BAJ95036.1|  predicted protein                                      180   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002520519.1|  sugar transporter, putative                        179   5e-49   
ref|XP_008777375.1|  PREDICTED: D-xylose-proton symporter-like 3,...    179   6e-49   Phoenix dactylifera
emb|CDP09100.1|  unnamed protein product                                179   7e-49   Coffea canephora [robusta coffee]
ref|XP_010907806.1|  PREDICTED: D-xylose-proton symporter-like 3,...    177   3e-48   Elaeis guineensis
ref|XP_006297488.1|  hypothetical protein CARUB_v10013506mg             176   3e-48   Capsella rubella
ref|XP_003563522.2|  PREDICTED: D-xylose-proton symporter-like 3,...    177   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_007132040.1|  hypothetical protein PHAVU_011G061800g             176   8e-48   Phaseolus vulgaris [French bean]
gb|AFK37407.1|  unknown                                                 176   1e-47   Lotus japonicus
ref|XP_006846330.1|  hypothetical protein AMTR_s00012p00255880          176   1e-47   Amborella trichopoda
gb|KHN21925.1|  D-xylose-proton symporter-like 3, chloroplastic         176   1e-47   Glycine soja [wild soybean]
ref|XP_003537973.1|  PREDICTED: D-xylose-proton symporter-like 3,...    176   1e-47   Glycine max [soybeans]
ref|XP_003539594.1|  PREDICTED: D-xylose-proton symporter-like 3,...    175   2e-47   Glycine max [soybeans]
gb|KHN32151.1|  D-xylose-proton symporter-like 3, chloroplastic         175   2e-47   Glycine soja [wild soybean]
ref|XP_010063233.1|  PREDICTED: D-xylose-proton symporter-like 2        174   3e-47   Eucalyptus grandis [rose gum]
ref|XP_011089518.1|  PREDICTED: D-xylose-proton symporter-like 3,...    174   7e-47   Sesamum indicum [beniseed]
ref|XP_004294661.1|  PREDICTED: D-xylose-proton symporter-like 3,...    172   2e-46   Fragaria vesca subsp. vesca
ref|XP_010492634.1|  PREDICTED: D-xylose-proton symporter-like 2        162   3e-46   Camelina sativa [gold-of-pleasure]
emb|CAN72732.1|  hypothetical protein VITISV_037854                     170   5e-46   Vitis vinifera
gb|EYU45952.1|  hypothetical protein MIMGU_mgv1a003885mg                171   6e-46   Erythranthe guttata [common monkey flower]
gb|EPS59382.1|  hypothetical protein M569_15426                         168   1e-45   Genlisea aurea
ref|XP_004983521.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    169   2e-45   
ref|XP_008384924.1|  PREDICTED: D-xylose-proton symporter-like 3,...    169   4e-45   
ref|XP_008349595.1|  PREDICTED: D-xylose-proton symporter-like 3,...    169   4e-45   
ref|XP_006424896.1|  hypothetical protein CICLE_v10028127mg             166   1e-44   
gb|KDO66622.1|  hypothetical protein CISIN_1g008624mg                   166   1e-44   Citrus sinensis [apfelsine]
ref|XP_009375941.1|  PREDICTED: D-xylose-proton symporter-like 3,...    167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_002982112.1|  hypothetical protein SELMODRAFT_115745             166   1e-44   
gb|KDO66620.1|  hypothetical protein CISIN_1g008624mg                   166   1e-44   Citrus sinensis [apfelsine]
ref|XP_008222111.1|  PREDICTED: D-xylose-proton symporter-like 3,...    166   2e-44   Prunus mume [ume]
ref|XP_010535453.1|  PREDICTED: D-xylose-proton symporter-like 3,...    166   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_008222102.1|  PREDICTED: D-xylose-proton symporter-like 3,...    166   4e-44   Prunus mume [ume]
gb|EPS60345.1|  hypothetical protein M569_14457                         156   4e-44   Genlisea aurea
ref|XP_002992213.1|  hypothetical protein SELMODRAFT_134982             164   5e-44   
ref|XP_007207311.1|  hypothetical protein PRUPE_ppa003611mg             166   5e-44   Prunus persica
ref|XP_006488378.1|  PREDICTED: D-xylose-proton symporter-like 3,...    166   6e-44   Citrus sinensis [apfelsine]
ref|XP_006424897.1|  hypothetical protein CICLE_v10028127mg             165   6e-44   Citrus clementina [clementine]
gb|KDO66619.1|  hypothetical protein CISIN_1g008624mg                   166   6e-44   Citrus sinensis [apfelsine]
gb|KDO66618.1|  hypothetical protein CISIN_1g008624mg                   165   7e-44   Citrus sinensis [apfelsine]
ref|XP_006488379.1|  PREDICTED: D-xylose-proton symporter-like 3,...    165   7e-44   
gb|KHG28803.1|  hypothetical protein F383_00413                         165   1e-43   Gossypium arboreum [tree cotton]
ref|XP_008457451.1|  PREDICTED: D-xylose-proton symporter-like 3,...    164   2e-43   Cucumis melo [Oriental melon]
ref|XP_004145283.1|  PREDICTED: D-xylose-proton symporter-like 3,...    164   3e-43   
emb|CBI16087.3|  unnamed protein product                                162   5e-43   Vitis vinifera
ref|XP_002280634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    162   8e-43   Vitis vinifera
ref|NP_001141928.1|  uncharacterized protein LOC100274077               150   7e-42   
ref|XP_001773171.1|  predicted protein                                  156   4e-41   
ref|XP_007016337.1|  Major facilitator superfamily protein isoform 2    156   9e-41   
ref|XP_002991559.1|  hypothetical protein SELMODRAFT_133784             152   3e-40   
ref|XP_001760396.1|  predicted protein                                  155   5e-40   
emb|CAN83894.1|  hypothetical protein VITISV_039113                     148   1e-37   Vitis vinifera
ref|XP_004173923.1|  PREDICTED: D-xylose-proton symporter-like 3,...    139   4e-37   
ref|NP_001190323.1|  D-xylose-proton symporter-like 2                   140   3e-35   
ref|XP_010933397.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    139   6e-35   
ref|XP_006424895.1|  hypothetical protein CICLE_v10028127mg             137   5e-34   
gb|KDO66623.1|  hypothetical protein CISIN_1g008624mg                   137   8e-34   Citrus sinensis [apfelsine]
ref|XP_005845570.1|  hypothetical protein CHLNCDRAFT_25635              133   1e-32   Chlorella variabilis
ref|XP_011400947.1|  D-xylose-proton symporter-like 3, chloroplastic    123   6e-29   Auxenochlorella protothecoides
ref|XP_005645204.1|  hypothetical protein COCSUDRAFT_67173              109   1e-23   Coccomyxa subellipsoidea C-169
ref|XP_005708849.1|  MFS transporter, SP family, sugar:H+ symporter     105   3e-22   Galdieria sulphuraria
ref|XP_001416926.1|  MFS family transporter: sugar (galactose/glu...    102   1e-21   Ostreococcus lucimarinus CCE9901
ref|XP_003062688.1|  major facilitator superfamily                      101   3e-21   Micromonas pusilla CCMP1545
gb|KIZ01781.1|  hypothetical protein MNEG_6180                          101   5e-21   Monoraphidium neglectum
gb|KDO39945.1|  hypothetical protein CISIN_1g0102391mg                  100   5e-21   Citrus sinensis [apfelsine]
ref|XP_006443190.1|  hypothetical protein CICLE_v10019791mg             100   6e-21   
ref|XP_005831465.1|  hypothetical protein GUITHDRAFT_109605           97.4    5e-20   Guillardia theta CCMP2712
gb|EWM26836.1|  d-xylose-proton symporter-like protein                99.0    5e-20   Nannochloropsis gaditana
gb|KEH30181.1|  monosaccharide-H+ symporter                           91.3    7e-20   Medicago truncatula
emb|CEF97100.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcompl...  97.4    9e-20   Ostreococcus tauri
emb|CBJ33077.1|  conserved unknown protein                            95.5    5e-19   Ectocarpus siliculosus
ref|WP_013644894.1|  major facilitator transporter                    94.4    8e-19   Methanobacterium lacus
ref|WP_022247679.1|  sugar transporter                                94.0    1e-18   
ref|XP_002501745.1|  sugar transporter                                94.4    1e-18   Micromonas commoda
ref|XP_007510995.1|  predicted protein                                93.2    4e-18   Bathycoccus prasinos
ref|NP_197203.1|  D-xylose-proton symporter-like 2                    91.7    5e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KDD76485.1|  sugar transporter                                     92.0    1e-17   Helicosporidium sp. ATCC 50920
ref|XP_005783754.1|  hypothetical protein EMIHUDRAFT_232111           90.1    3e-17   Emiliania huxleyi CCMP1516
ref|WP_022187653.1|  sugar transporter                                89.7    3e-17   
gb|EKD53804.1|  hypothetical protein ACD_60C00149G0003                89.0    7e-17   uncultured bacterium
ref|XP_002179486.1|  TRD4                                             86.7    5e-16   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_025318950.1|  major facilitator transporter                    86.3    5e-16   Granulibacter bethesdensis
gb|ACJ18943.1|  D-xylose-proton symporter                             85.1    1e-15   Coxiella burnetii CbuG_Q212
gb|ACJ19821.1|  D-xylose-proton symporter                             85.1    1e-15   Coxiella burnetii CbuK_Q154
ref|WP_022021988.1|  sugar transporter                                85.1    1e-15   
ref|WP_011631971.1|  major facilitator transporter                    85.1    1e-15   Granulibacter bethesdensis
ref|WP_025286678.1|  major facilitator transporter                    85.1    1e-15   Granulibacter bethesdensis
ref|WP_005772424.1|  major facilitator transporter                    85.1    1e-15   Coxiella burnetii
ref|WP_005769170.1|  major facilitator transporter                    85.1    2e-15   Coxiella burnetii
ref|WP_011997243.1|  major facilitator transporter                    85.1    2e-15   Coxiella burnetii
ref|WP_032138490.1|  major facilitator transporter                    84.7    2e-15   Coxiella burnetii
ref|WP_025320564.1|  major facilitator transporter                    84.7    2e-15   Granulibacter bethesdensis
ref|WP_022196350.1|  putative metabolite transport protein ywtG       84.3    3e-15   
ref|WP_022486233.1|  sugar transporter                                83.6    4e-15   
ref|WP_022491563.1|  metabolite transport protein                     82.0    6e-15   
ref|WP_022006956.1|  d-xylose-proton symporter                        82.8    9e-15   
ref|WP_007429069.1|  MFS transporter                                  82.8    9e-15   Paenibacillus sp. Aloe-11
ref|WP_024816367.1|  major facilitator transporter                    82.4    1e-14   Methylopila sp. 73B
ref|XP_009036253.1|  general sugar transporter                        82.4    1e-14   Aureococcus anophagefferens
ref|WP_016821403.1|  MULTISPECIES: MFS transporter                    82.4    1e-14   Paenibacillus
ref|WP_019686308.1|  MFS transporter                                  82.0    1e-14   Paenibacillus polymyxa
ref|WP_044786399.1|  MFS transporter                                  82.0    1e-14   Paenibacillus
ref|WP_025675784.1|  MFS transporter                                  82.0    1e-14   Paenibacillus
ref|WP_013369675.1|  MFS transporter                                  82.0    2e-14   Paenibacillus
ref|WP_014280112.1|  MFS transporter                                  81.6    2e-14   Paenibacillus terrae
ref|WP_023987284.1|  MFS transporter                                  81.6    2e-14   Paenibacillus
ref|WP_025722405.1|  MFS transporter                                  81.6    2e-14   Paenibacillus polymyxa
ref|WP_028543212.1|  MFS transporter                                  81.6    2e-14   Paenibacillus
ref|WP_029516079.1|  MFS transporter                                  81.6    2e-14   Paenibacillus polymyxa
ref|WP_010638886.1|  major facilitator transporter                    80.9    3e-14   
ref|WP_018661922.1|  major facilitator transporter                    81.3    3e-14   Bacillus acidiproducens
ref|WP_037344745.1|  major facilitator transporter                    81.3    3e-14   
ref|WP_024895141.1|  major facilitator transporter                    80.9    4e-14   Acidithiobacillus
ref|WP_036621919.1|  MFS transporter                                  80.5    5e-14   Paenibacillus macerans
ref|WP_034935483.1|  hypothetical protein                             80.5    6e-14   Erwinia mallotivora
ref|WP_007424295.1|  MULTISPECIES: major facilitator transporter      79.7    7e-14   Acidiphilium
ref|XP_001959931.1|  GF13114                                          80.9    8e-14   
ref|WP_026439736.1|  major facilitator transporter                    79.7    8e-14   
ref|XP_002006426.1|  GI18572                                          80.9    8e-14   
sp|B3MG58.2|TRET1_DROAN  RecName: Full=Facilitated trehalose tran...  80.9    8e-14   Drosophila ananassae
ref|WP_035187416.1|  major facilitator transporter                    79.7    9e-14   Acidiphilium sp. JA12-A1
ref|WP_013309023.1|  MFS transporter                                  79.7    9e-14   Paenibacillus polymyxa
ref|WP_021863576.1|  sugar transporter                                79.7    9e-14   
sp|B4KR05.2|TRET1_DROMO  RecName: Full=Facilitated trehalose tran...  80.5    9e-14   Drosophila mojavensis
ref|WP_029311639.1|  major facilitator transporter                    79.3    1e-13   Acidiphilium
ref|WP_008494377.1|  major facilitator transporter                    79.0    1e-13   
ref|WP_036719265.1|  MFS transporter                                  79.0    2e-13   
ref|XP_001986495.1|  GH21392                                          79.7    2e-13   Drosophila grimshawi
ref|WP_017577029.1|  hypothetical protein                             78.6    2e-13   Nocardiopsis kunsanensis
gb|KJB20003.1|  hypothetical protein B456_003G129000                  78.6    2e-13   Gossypium raimondii
ref|WP_041339107.1|  major facilitator transporter                    78.6    2e-13   Rubrobacter radiotolerans
ref|WP_020429182.1|  hypothetical protein                             76.3    2e-13   
ref|XP_001744797.1|  hypothetical protein                             78.2    2e-13   Monosiga brevicollis MX1
ref|XP_002185301.1|  predicted protein                                78.6    3e-13   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_011207983.1|  PREDICTED: facilitated trehalose transporter...  79.0    3e-13   Bactrocera dorsalis [papaya fruit fly]
ref|WP_043707797.1|  major facilitator transporter                    78.2    3e-13   Weissella cibaria
ref|WP_010374961.1|  major facilitator transporter                    78.2    3e-13   Weissella cibaria
ref|WP_020222463.1|  hypothetical protein                             77.4    3e-13   
gb|EKE01224.1|  hypothetical protein ACD_21C00189G0006                77.8    3e-13   uncultured bacterium
ref|XP_002050122.1|  GJ20366                                          79.0    3e-13   
ref|WP_004915014.1|  major facilitator transporter                    77.8    3e-13   Leuconostoc
ref|XP_009779937.1|  PREDICTED: D-xylose-proton symporter-like 3,...  77.8    4e-13   Nicotiana sylvestris
ref|WP_031572590.1|  major facilitator transporter                    77.8    4e-13   Acidithiobacillus thiooxidans
sp|B4LPX5.2|TRET1_DROVI  RecName: Full=Facilitated trehalose tran...  78.6    4e-13   Drosophila virilis
ref|WP_017611217.1|  hypothetical protein                             77.8    4e-13   Nocardiopsis xinjiangensis
ref|WP_010641003.1|  major facilitator transporter                    77.8    4e-13   Acidithiobacillus thiooxidans
ref|WP_024893136.1|  major facilitator transporter                    77.8    4e-13   
ref|XP_005174792.1|  PREDICTED: facilitated trehalose transporter...  78.6    4e-13   
ref|WP_036593689.1|  sugar transporter                                77.8    4e-13   
ref|WP_014866604.1|  major facilitator transporter                    77.8    4e-13   
ref|XP_009605737.1|  PREDICTED: D-xylose-proton symporter-like 3,...  77.8    4e-13   
ref|WP_018699802.1|  hypothetical protein                             77.8    4e-13   
ref|WP_036581666.1|  MFS transporter                                  77.4    5e-13   
ref|XP_002016109.1|  GL11419                                          78.2    5e-13   
ref|WP_020089467.1|  major facilitator transporter                    77.4    5e-13   
ref|XP_001360559.2|  GA15593                                          78.2    5e-13   
sp|Q291H8.3|TRET1_DROPS  RecName: Full=Facilitated trehalose tran...  78.2    5e-13   
sp|B4GAP7.2|TRET1_DROPE  RecName: Full=Facilitated trehalose tran...  78.2    5e-13   
ref|XP_011182307.1|  PREDICTED: facilitated trehalose transporter...  78.2    5e-13   
ref|WP_009951262.1|  major facilitator transporter                    77.4    6e-13   
ref|WP_013942808.1|  putative metabolite transport protein ywtG       77.0    6e-13   
ref|XP_005730654.1|  PREDICTED: solute carrier family 2, facilita...  77.0    7e-13   
ref|WP_021780471.1|  arabinose-proton symporter                       77.0    7e-13   
ref|WP_012537116.1|  major facilitator transporter                    77.0    7e-13   
ref|XP_009037217.1|  hypothetical protein AURANDRAFT_26890            77.4    8e-13   
ref|XP_004555795.1|  PREDICTED: solute carrier family 2, facilita...  77.0    8e-13   
ref|XP_005938721.1|  PREDICTED: solute carrier family 2, facilita...  77.0    8e-13   
ref|XP_002066107.1|  GK22112                                          77.8    8e-13   
ref|WP_013924234.1|  major facilitator transporter                    76.6    8e-13   
ref|WP_040615275.1|  major facilitator transporter                    76.6    9e-13   
ref|WP_010282438.1|  major facilitator transporter                    76.6    9e-13   
gb|EDP46643.1|  D-xylose-proton symporter                             76.6    9e-13   
ref|WP_039793159.1|  MFS transporter                                  76.6    9e-13   
gb|EOA08513.1|  MFS transporter, sugar porter (SP) family             74.7    1e-12   
ref|XP_009032417.1|  hypothetical protein AURANDRAFT_18763            76.6    1e-12   
ref|WP_010347529.1|  MFS transporter                                  76.6    1e-12   
ref|WP_036745963.1|  major facilitator transporter                    76.3    1e-12   
emb|CAG09092.1|  unnamed protein product                              76.3    1e-12   
gb|EFN70680.1|  Sugar transporter ERD6-like 6                         76.3    1e-12   
gb|EFB42172.1|  hypothetical protein pah_c014o100                     76.3    1e-12   
gb|KFB50766.1|  AGAP005563-PA-like protein                            77.0    1e-12   
ref|WP_035532302.1|  major facilitator transporter                    76.3    2e-12   
ref|WP_007980793.1|  major facilitator transporter                    75.9    2e-12   
ref|WP_033510598.1|  hypothetical protein                             75.9    2e-12   
ref|WP_006053328.1|  major facilitator transporter                    75.9    2e-12   
ref|WP_018754345.1|  MFS transporter                                  75.9    2e-12   
ref|WP_003666501.1|  major facilitator transporter                    75.9    2e-12   
ref|WP_019234073.1|  hypothetical protein                             75.9    2e-12   
gb|AHG00573.1|  major facilitator transporter                         75.9    2e-12   
gb|ABS66075.1|  sugar transporter                                     75.9    2e-12   
ref|XP_004537406.1|  PREDICTED: facilitated trehalose transporter...  76.3    2e-12   
gb|KFI68426.1|  MFS, D-xylose:H+ symporter                            75.9    2e-12   
ref|WP_017261050.1|  major facilitator transporter                    75.5    2e-12   
ref|WP_021946815.1|  d-xylose-proton symporter                        75.5    2e-12   
ref|WP_041576361.1|  sugar transporter                                75.5    2e-12   
ref|WP_043236249.1|  sugar transporter                                75.5    2e-12   
ref|WP_039838550.1|  MFS transporter                                  75.5    2e-12   
gb|EMZ36099.1|  sugar porter (SP) family MFS transporter              75.5    2e-12   
ref|WP_014096118.1|  major facilitator transporter                    75.5    2e-12   
ref|WP_043735154.1|  major facilitator transporter                    75.5    2e-12   
ref|WP_021037475.1|  D-xylose-proton symporter                        75.5    2e-12   
gb|KDE57191.1|  major facilitator transporter                         75.5    2e-12   
ref|XP_003971733.1|  PREDICTED: solute carrier family 2, facilita...  75.5    3e-12   
ref|XP_002033422.1|  GM21298                                          76.3    3e-12   
ref|WP_019251315.1|  major facilitator transporter                    75.5    3e-12   
ref|WP_026684983.1|  major facilitator transporter                    75.1    3e-12   
ref|WP_025849336.1|  MFS transporter                                  75.5    3e-12   
gb|EKE10022.1|  sugar transporter                                     72.0    3e-12   
ref|WP_034640102.1|  major facilitator transporter                    75.1    3e-12   
ref|WP_044215183.1|  MULTISPECIES: major facilitator transporter      75.1    3e-12   
ref|WP_042531766.1|  major facilitator transporter                    75.1    3e-12   
ref|XP_003444557.1|  PREDICTED: solute carrier family 2, facilita...  75.1    3e-12   
ref|WP_003551797.1|  major facilitator transporter                    75.1    3e-12   
ref|XP_001976043.1|  GG20213                                          75.9    3e-12   
emb|CDR33502.1|  putative D-xylose-proton symporter                   75.1    4e-12   
ref|WP_044351036.1|  hypothetical protein                             74.7    4e-12   
ref|WP_041017256.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_031564035.1|  hypothetical protein                             74.7    4e-12   
ref|WP_008841561.1|  sugar transporter                                74.7    4e-12   
ref|WP_026962475.1|  MFS transporter                                  74.7    4e-12   
gb|EGI63390.1|  Sugar transporter ERD6-like 6                         75.1    4e-12   
ref|WP_002832561.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_002829469.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_042748938.1|  major facilitator transporter                    74.7    4e-12   
ref|WP_004166330.1|  major facilitator transporter                    74.7    5e-12   
ref|WP_024747157.1|  major facilitator transporter                    74.7    5e-12   
ref|WP_004594713.1|  metabolite transport protein                     74.7    5e-12   
ref|XP_006797805.1|  PREDICTED: solute carrier family 2, facilita...  74.3    5e-12   
ref|WP_003557282.1|  MULTISPECIES: major facilitator transporter      74.3    5e-12   
ref|WP_035166342.1|  major facilitator transporter                    74.3    5e-12   
ref|XP_011252868.1|  PREDICTED: facilitated trehalose transporter...  74.7    6e-12   
ref|WP_027699342.1|  major facilitator transporter                    74.3    6e-12   
gb|EFZ19814.1|  hypothetical protein SINV_07234                       74.3    6e-12   
ref|XP_011057654.1|  PREDICTED: facilitated trehalose transporter...  74.7    6e-12   
ref|XP_011057655.1|  PREDICTED: facilitated trehalose transporter...  74.7    6e-12   
ref|WP_005642200.1|  major facilitator transporter                    74.3    7e-12   
ref|WP_004517544.1|  metabolite transport protein                     73.9    7e-12   
ref|WP_008311910.1|  metabolite transport protein                     73.9    7e-12   
ref|WP_036685129.1|  MFS transporter                                  73.9    8e-12   
gb|AJF27556.1|  major facilitator transporter                         73.9    8e-12   
ref|XP_010748836.1|  PREDICTED: solute carrier family 2, facilita...  73.9    8e-12   
ref|WP_013238482.1|  major facilitator transporter                    73.9    8e-12   
ref|WP_014031120.1|  major facilitator transporter                    73.9    8e-12   
ref|WP_023163452.1|  sugar transporter                                73.6    9e-12   
ref|WP_020500425.1|  hypothetical protein                             73.6    9e-12   
ref|XP_001959932.1|  GF13115                                          73.9    9e-12   
ref|WP_005533104.1|  metabolite transport protein                     73.6    9e-12   
ref|WP_011222534.1|  major facilitator transporter                    73.6    1e-11   
ref|WP_029344056.1|  major facilitator transporter                    73.6    1e-11   
ref|WP_007693086.1|  sugar transporter                                70.5    1e-11   
ref|WP_004869267.1|  major facilitator transporter                    73.6    1e-11   
ref|WP_033900986.1|  major facilitator transporter                    73.6    1e-11   
gb|AAX92638.1|  glucose transporter 8                                 73.6    1e-11   
ref|WP_004965853.1|  MULTISPECIES: metabolite transport protein       73.6    1e-11   
ref|WP_015426662.1|  D-xylose proton-symporter                        73.6    1e-11   
ref|WP_032946960.1|  major facilitator transporter                    73.6    1e-11   
gb|EKD46018.1|  hypothetical protein ACD_69C00046G0001                73.6    1e-11   
ref|WP_028555263.1|  MFS transporter                                  73.6    1e-11   
ref|WP_040364358.1|  major facilitator transporter                    73.6    1e-11   
ref|WP_012898121.1|  major facilitator transporter                    73.6    1e-11   
ref|WP_037546042.1|  hypothetical protein                             73.6    1e-11   
gb|EHD13189.1|  sugar porter family MFS transporter                   73.6    1e-11   
emb|CDG05332.1|  D-xylose proton-symporter                            73.2    1e-11   
ref|WP_004560096.1|  major facilitator transporter                    73.6    1e-11   
ref|WP_037346870.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_044009698.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_036634707.1|  MFS transporter                                  73.2    1e-11   
ref|XP_011429027.1|  PREDICTED: solute carrier family 2, facilita...  73.6    1e-11   
ref|WP_034338388.1|  major facilitator transporter                    73.2    1e-11   
gb|ABJ63352.1|  D-xylose proton-symporter                             72.8    1e-11   
ref|WP_015842962.1|  MFS transporter                                  73.2    1e-11   
ref|WP_015473104.1|  D-xylose-proton symporter                        72.8    2e-11   
ref|XP_004992344.1|  hypothetical protein PTSG_06943                  73.2    2e-11   
gb|KIO96884.1|  D-xylose proton-symporter XylT                        72.8    2e-11   
ref|WP_024855255.1|  major facilitator transporter                    72.8    2e-11   
ref|WP_021742415.1|  MFS transporter, SP family                       72.8    2e-11   
gb|AJA80278.1|  major facilitator transporter                         72.8    2e-11   
ref|XP_008584145.1|  PREDICTED: solute carrier family 2, facilita...  71.2    2e-11   
sp|O52733.1|XYLT_LACBR  RecName: Full=D-xylose-proton symporter; ...  72.8    2e-11   
ref|WP_024525904.1|  major facilitator transporter                    72.8    2e-11   
gb|EHJ74643.1|  facilitated trehalose transporter Tret1               73.2    2e-11   
gb|KIO94517.1|  D-xylose proton-symporter XylT                        72.8    2e-11   
ref|WP_025731032.1|  major facilitator transporter                    72.8    2e-11   
ref|WP_008415726.1|  major facilitator transporter                    72.8    2e-11   
ref|WP_043022080.1|  major facilitator transporter                    72.8    2e-11   
ref|XP_009043387.1|  general solute carrier protein                   70.1    2e-11   
ref|WP_022743508.1|  D-xylose-proton symporter XylT                   72.4    2e-11   
gb|KFM72443.1|  Solute carrier family 2, facilitated glucose tran...  70.5    2e-11   
ref|XP_008301674.1|  PREDICTED: solute carrier family 2, facilita...  72.8    2e-11   
ref|WP_020448594.1|  D-xylose-proton symporter                        72.4    2e-11   
ref|WP_019764279.1|  sugar transporter                                72.4    3e-11   
ref|WP_020089470.1|  major facilitator transporter                    72.4    3e-11   
ref|XP_006625953.1|  PREDICTED: solute carrier family 2, facilita...  72.4    3e-11   
ref|XP_011156939.1|  PREDICTED: facilitated trehalose transporter...  72.8    3e-11   
ref|XP_008584146.1|  PREDICTED: solute carrier family 2, facilita...  71.2    3e-11   
ref|XP_002606343.1|  hypothetical protein BRAFLDRAFT_67586            72.4    3e-11   
ref|WP_026243089.1|  MULTISPECIES: sugar transporter                  72.4    3e-11   
ref|WP_006185197.1|  sugar transporter                                72.4    3e-11   
ref|WP_035944149.1|  major facilitator transporter                    72.0    3e-11   
ref|WP_035356541.1|  sugar transporter                                72.0    3e-11   
gb|KIZ46811.1|  MFS sugar transporter                                 72.0    3e-11   
ref|WP_015584353.1|  sugar transporter                                72.0    3e-11   
ref|WP_043250808.1|  sugar transporter                                72.0    3e-11   
ref|WP_030334206.1|  sugar transporter                                72.0    3e-11   
ref|WP_032724722.1|  MFS sugar transporter                            72.0    3e-11   
ref|WP_040290625.1|  major facilitator transporter                    72.0    3e-11   
ref|WP_025693763.1|  MFS transporter                                  72.0    4e-11   
ref|WP_012169786.1|  sugar transporter                                72.0    4e-11   
ref|WP_032717438.1|  MFS sugar transporter                            72.0    4e-11   
ref|WP_028551479.1|  MFS transporter                                  71.6    4e-11   
dbj|BAI83415.1|  sugar transporter 1                                  72.0    4e-11   
ref|XP_011156938.1|  PREDICTED: facilitated trehalose transporter...  72.0    4e-11   
ref|WP_044346672.1|  MFS sugar transporter                            71.6    4e-11   
ref|WP_006129538.1|  MULTISPECIES: sugar transporter                  71.6    4e-11   
ref|XP_010737643.1|  PREDICTED: solute carrier family 2, facilita...  72.0    4e-11   
gb|EJY54599.1|  sugar transporter                                     71.6    4e-11   
ref|WP_033395728.1|  MFS transporter                                  71.6    5e-11   
ref|WP_038600163.1|  major facilitator transporter                    71.6    5e-11   
ref|WP_026882379.1|  major facilitator transporter                    71.6    5e-11   
ref|WP_006110627.1|  sugar transporter                                71.6    5e-11   
ref|WP_006826745.1|  sugar transporter                                71.6    5e-11   
ref|WP_015321733.1|  MFS transporter, sugar porter family             71.2    6e-11   
ref|WP_036714445.1|  MFS transporter                                  71.2    6e-11   
ref|WP_031053894.1|  sugar transporter                                71.2    6e-11   
ref|WP_030114681.1|  MULTISPECIES: sugar transporter                  71.2    6e-11   
ref|WP_030187050.1|  MULTISPECIES: sugar transporter                  71.2    6e-11   
ref|WP_004861850.1|  sugar porter (SP) family MFS transporter         71.2    6e-11   
gb|KHF32401.1|  Arabinose-proton symporter                            71.2    6e-11   
ref|WP_018520641.1|  MULTISPECIES: sugar transporter                  71.2    7e-11   
ref|WP_030207796.1|  sugar transporter                                71.2    7e-11   
ref|WP_034711981.1|  major facilitator transporter                    70.9    7e-11   
ref|WP_025702459.1|  MFS transporter                                  70.9    7e-11   
ref|XP_001600172.1|  PREDICTED: facilitated trehalose transporter...  70.9    7e-11   
ref|WP_013879135.1|  major facilitator transporter                    70.9    8e-11   
ref|WP_003715948.1|  major facilitator transporter                    70.9    8e-11   
ref|WP_005119931.1|  sugar (and other) transporter family protein     69.3    8e-11   
ref|XP_011152468.1|  PREDICTED: facilitated trehalose transporter...  71.2    8e-11   
ref|XP_005812518.1|  PREDICTED: solute carrier family 2, facilita...  70.9    8e-11   
ref|WP_015764165.1|  major facilitator transporter                    70.9    9e-11   
gb|EIQ55161.1|  sugar (and other) transporter family protein          68.9    9e-11   
gb|EFP73175.1|  D-xylose-proton symporter                             68.9    9e-11   
gb|EQX91462.1|  D-xylose-proton symporter                             69.3    9e-11   
ref|XP_003974733.1|  PREDICTED: solute carrier family 2, facilita...  70.9    9e-11   
ref|WP_014106469.1|  D-galactose transporter                          70.9    9e-11   
ref|WP_026475378.1|  major facilitator transporter                    70.9    9e-11   
ref|WP_020529689.1|  hypothetical protein                             70.9    9e-11   
gb|EHO53142.1|  hypothetical protein HMPREF9104_00707                 67.8    9e-11   
ref|XP_005914413.1|  PREDICTED: solute carrier family 2, facilita...  70.9    1e-10   
ref|XP_010793763.1|  PREDICTED: solute carrier family 2, facilita...  70.9    1e-10   
ref|XP_006812575.1|  PREDICTED: solute carrier family 2, facilita...  70.9    1e-10   
ref|XP_004541992.1|  PREDICTED: solute carrier family 2, facilita...  70.9    1e-10   
ref|WP_025333995.1|  MFS transporter                                  70.5    1e-10   
ref|XP_008335627.1|  PREDICTED: solute carrier family 2, facilita...  70.9    1e-10   
ref|XP_010743358.1|  PREDICTED: solute carrier family 2, facilita...  70.9    1e-10   
ref|WP_020694258.1|  hypothetical protein                             70.5    1e-10   
gb|AIF54149.1|  sugar transporter                                     70.5    1e-10   
ref|WP_022078476.1|  sugar transporter                                70.5    1e-10   
ref|WP_038674510.1|  major facilitator transporter                    70.5    1e-10   
ref|XP_011152467.1|  PREDICTED: facilitated trehalose transporter...  70.9    1e-10   
ref|WP_041585888.1|  sugar transporter                                70.5    1e-10   
ref|WP_025689045.1|  MFS transporter                                  70.5    1e-10   
ref|WP_038700702.1|  MFS transporter                                  70.5    1e-10   
ref|WP_040470988.1|  hypothetical protein                             67.8    1e-10   
gb|EGW79604.1|  arabinose-proton symporter                            69.7    1e-10   
ref|WP_012944770.1|  major facilitator transporter                    70.5    1e-10   
gb|EGJ82535.1|  arabinose-proton symporter                            69.7    1e-10   
gb|EFW61830.1|  D-xylose proton-symporter XylE                        68.6    1e-10   



>ref|XP_009613870.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Nicotiana tomentosiformis]
Length=462

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGLILFQQITGQPSVLYYAAKIFQDAGF+AAADATRASIFL LLKLIMTGVAVVVVD+LG
Sbjct  269  AGLILFQQITGQPSVLYYAAKIFQDAGFSAAADATRASIFLALLKLIMTGVAVVVVDKLG  328

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  329  RRPLLLGGVSGIAISLFLLGSYYTYLGNVPAVAVSALLLYVGCYQLSFGPIGWLMISEIF  388

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLRVRGRGLSI+VLVNFG NALV F+FSP++ L+GAG VFFIFG IAV++++F+FFIIPE
Sbjct  389  PLRVRGRGLSISVLVNFGANALVAFSFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPE  448

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAKYL
Sbjct  449  TKGLTLEEIEAKYL  462



>ref|XP_009777282.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009777283.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
Length=498

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGLILFQQITGQPSVLYYAAKIFQDAGF+AAADATRAS+FL LLKLIMTGVAVVVVD+LG
Sbjct  305  AGLILFQQITGQPSVLYYAAKIFQDAGFSAAADATRASVFLALLKLIMTGVAVVVVDKLG  364

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  365  RRPLLLGGVSGIAISLFLLGSYYTYLGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIF  424

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLRVRGRGLSI+VLVNFG NALV FAFSP++ L+GAG VFFIFG IAV++++F+FFIIPE
Sbjct  425  PLRVRGRGLSISVLVNFGANALVAFAFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPE  484

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAKYL
Sbjct  485  TKGLTLEEIEAKYL  498



>ref|XP_009777281.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGLILFQQITGQPSVLYYAAKIFQDAGF+AAADATRAS+FL LLKLIMTGVAVVVVD+LG
Sbjct  315  AGLILFQQITGQPSVLYYAAKIFQDAGFSAAADATRASVFLALLKLIMTGVAVVVVDKLG  374

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  375  RRPLLLGGVSGIAISLFLLGSYYTYLGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIF  434

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLRVRGRGLSI+VLVNFG NALV FAFSP++ L+GAG VFFIFG IAV++++F+FFIIPE
Sbjct  435  PLRVRGRGLSISVLVNFGANALVAFAFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPE  494

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAKYL
Sbjct  495  TKGLTLEEIEAKYL  508



>ref|NP_001288106.1| D-xylose-proton symporter-like 2-like [Solanum lycopersicum]
 dbj|BAO96239.1| vacuolar glucose transporter 2 [Solanum lycopersicum]
Length=503

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGLILFQQITGQPSVLYYAAKIFQDAGF+AAADATRAS+FL LLKLIMT VAVVVVD+LG
Sbjct  310  AGLILFQQITGQPSVLYYAAKIFQDAGFSAAADATRASVFLALLKLIMTAVAVVVVDKLG  369

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGIA++LFLLGSYYTFL +VP VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  370  RRPLLLGGVSGIAMSLFLLGSYYTFLGDVPAVAVTALLLYVGCYQLSFGPIGWLMISEIF  429

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLRVRGRGLSI VLVNFG NALV FAFSP+++L+GAG VFFIFG IAV++++F+FFIIPE
Sbjct  430  PLRVRGRGLSITVLVNFGANALVAFAFSPLQDLLGAGTVFFIFGGIAVLSLVFIFFIIPE  489

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAKYL
Sbjct  490  TKGLTLEEIEAKYL  503



>ref|XP_006347568.1| PREDICTED: D-xylose-proton symporter-like 2-like [Solanum tuberosum]
Length=503

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGLILFQQITGQPSVLYYAAKIFQDAGF+AAADATRAS+FL LLKLIMT VAVVV+D+LG
Sbjct  310  AGLILFQQITGQPSVLYYAAKIFQDAGFSAAADATRASVFLALLKLIMTAVAVVVIDKLG  369

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGIA++LFLLGSYYTFL +VP VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  370  RRPLLLGGVSGIAMSLFLLGSYYTFLGDVPAVAVTALLLYVGCYQLSFGPIGWLMISEIF  429

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLRVRGRGLSI VLVNFG NALV FAFSP+++L+GAG VFFIFG IAV++++F+FFIIPE
Sbjct  430  PLRVRGRGLSITVLVNFGANALVAFAFSPLQDLLGAGTVFFIFGGIAVLSLVFIFFIIPE  489

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAKYL
Sbjct  490  TKGLTLEEIEAKYL  503



>ref|XP_009777280.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Nicotiana 
sylvestris]
Length=555

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGLILFQQITGQPSVLYYAAKIFQDAGF+AAADATRAS+FL LLKLIMTGVAVVVVD+LG
Sbjct  362  AGLILFQQITGQPSVLYYAAKIFQDAGFSAAADATRASVFLALLKLIMTGVAVVVVDKLG  421

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  422  RRPLLLGGVSGIAISLFLLGSYYTYLGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIF  481

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLRVRGRGLSI+VLVNFG NALV FAFSP++ L+GAG VFFIFG IAV++++F+FFIIPE
Sbjct  482  PLRVRGRGLSISVLVNFGANALVAFAFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPE  541

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAKYL
Sbjct  542  TKGLTLEEIEAKYL  555



>emb|CDP04938.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IF+ AGF+AA+DAT ASIFL LLKLIMT VAV+V+DR+G
Sbjct  321  AGLVLFQQITGQPSVLYYAATIFETAGFSAASDATTASIFLALLKLIMTAVAVLVIDRVG  380

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYYTFLD+VP VAV+ LLLYVGCYQLSFGPIGWLMISEIF
Sbjct  381  RRPLLLGGVSGMVISLFLLGSYYTFLDDVPAVAVVGLLLYVGCYQLSFGPIGWLMISEIF  440

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRGLSIAVLVNFG NALVTFAFSP+++LVGAG VFFIFG IAV++VIF+FF++PE
Sbjct  441  PLRSRGRGLSIAVLVNFGANALVTFAFSPLEDLVGAGVVFFIFGGIAVLSVIFIFFVVPE  500

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  501  TKGLTLEEIEAKLL  514



>ref|XP_006443191.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 ref|XP_006478911.1| PREDICTED: D-xylose-proton symporter-like 2-like [Citrus sinensis]
 gb|ESR56431.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=506

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLG
Sbjct  313  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLG  372

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  373  RRPLLLGGVSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVF  432

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLS+AVLVNFG NALVTFAFSP+K+L+GAG +F+ FGVIAV+++ F+FFI+PE
Sbjct  433  PLRLRGRGLSVAVLVNFGANALVTFAFSPLKDLLGAGILFYAFGVIAVLSLAFIFFIVPE  492

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  493  TKGLTLEEIEAKCL  506



>ref|XP_010261641.1| PREDICTED: D-xylose-proton symporter-like 2, partial [Nelumbo 
nucifera]
Length=429

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I + AGF+AA+DATR SI LGLLKLIMTG+AV+VVD+LG
Sbjct  236  AGLVLFQQITGQPSVLYYAATILKSAGFSAASDATRVSILLGLLKLIMTGIAVLVVDKLG  295

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLL +YYTFL+N P VAV+ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  296  RRPLLLGGVSGIVISLFLLAAYYTFLNNAPFVAVVALLLYVGCYQLSFGPIGWLMISEIF  355

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP++ L+GAG +F +FGVI+V++++F+FFI+PE
Sbjct  356  PLRLRGRGLSIAVLVNFASNALVTFAFSPLESLIGAGMLFVVFGVISVLSLLFIFFIVPE  415

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIEAK L
Sbjct  416  TKGLSLEEIEAKIL  429



>gb|AAF26115.1|AC012328_18 hypothetical protein [Arabidopsis thaliana]
Length=342

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LGLLKL+MTGV+V+V+DR+GR
Sbjct  150  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGVSVIVIDRVGR  209

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLL GVSG+ ++LFLLGSYY F  NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  210  RPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  269

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI VV++ F+++I+PET
Sbjct  270  LKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFFIYYIVPET  329

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  330  KGLTLEEIEAKCL  342



>ref|XP_004137173.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cucumis sativus]
 gb|KGN53693.1| hypothetical protein Csa_4G106860 [Cucumis sativus]
Length=502

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LGLLKLIMTG AV+VVDRLG
Sbjct  309  AGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLGLLKLIMTGAAVLVVDRLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+F
Sbjct  369  RRPLLLGGVSGITISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFIFGV+A+++++F+FFI+PE
Sbjct  429  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFIFGVVAILSLVFIFFIVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEA+ L
Sbjct  489  TKGLTLEEIEARCL  502



>ref|XP_007131530.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
 gb|ESW03524.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
Length=498

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LG
Sbjct  305  AGLVLFQQITGQPSVLYYAASIFQSAGFSGASDATRVSILLGAFKLIMTGVAVVVVDKLG  364

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY FLDN P VAV+ LLLYVGCYQ+SFGPIGWLMI+EIF
Sbjct  365  RRPLLLGGVSGMVISLFLLGSYYVFLDNAPVVAVVGLLLYVGCYQISFGPIGWLMIAEIF  424

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGL IAVLVNFG NALVTFAFSP+KEL+GAG +F+IF VIAV ++ F++ ++PE
Sbjct  425  PLRLRGRGLGIAVLVNFGANALVTFAFSPLKELLGAGILFYIFCVIAVASLAFIYLVVPE  484

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  485  TKGLTLEEIEAKCL  498



>gb|KDP21779.1| hypothetical protein JCGZ_00566 [Jatropha curcas]
Length=501

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LGLLKLIMTG+AV+VVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSILLGLLKLIMTGIAVLVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY FLDN P VAV ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  368  RRPLLLGGVSGMVISLFLLGSYYLFLDNAPFVAVAALLLYVGCYQLSFGPIGWLMISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K  +GAG +F+ FGVI +++++F+FFI+PE
Sbjct  428  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKAWLGAGILFYAFGVIGILSLLFIFFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>emb|CDX92030.1| BnaC03g33320D [Brassica napus]
Length=502

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LG+LKL+MTGVA+VV+D+LGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGILKLVMTGVAIVVIDKLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFP
Sbjct  370  RPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSPMKEL+GAG +F  FG I V+++ F++FI+PET
Sbjct  430  LKLRGRGISIAVLVNFGTNALVTFAFSPMKELLGAGVLFCGFGAICVLSLFFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_009382608.1| PREDICTED: D-xylose-proton symporter-like 2 [Musa acuminata subsp. 
malaccensis]
Length=498

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DATR SI LGLLKLIMTGVAV+VVDRLG
Sbjct  305  AGLVFFQQVTGQPSVLYYAATILQSAGFSAASDATRVSILLGLLKLIMTGVAVLVVDRLG  364

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL SYYT L+++P VAVIALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  365  RRPLLIGGVSGIAISLFLLSSYYTLLNSLPSVAVIALLLYVGCYQLSFGPIGWLMISEIF  424

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIA+ +++F+FFI+PE
Sbjct  425  PLRLRGRGLSIAVLVNFASNALVTFAFSPLETLVGTGVLFAGFGVIAISSLLFIFFIVPE  484

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  485  TKGLTLEEIEAKIL  498



>ref|XP_007029560.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY10062.1| Major facilitator superfamily protein [Theobroma cacao]
Length=501

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LGLLKLIMTG AVVVVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSILLGLLKLIMTGAAVVVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ V+LFLLGSYY FLD+VP +AV ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  368  RRPLLLGGVSGMVVSLFLLGSYYLFLDDVPAIAVAALLLYVGCYQLSFGPIGWLMISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRGLSIAVLVNFG NALVTFAFSP++  +GAG VF++FGVIA+++++F+FFI+PE
Sbjct  428  PLRHRGRGLSIAVLVNFGANALVTFAFSPLEAWLGAGIVFYVFGVIAMLSLLFIFFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>gb|ABK95072.1| unknown [Populus trichocarpa]
Length=502

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL KLIMTG AV+VVDRLG
Sbjct  309  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLFKLIMTGTAVLVVDRLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY FLDN P VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  369  RRPLLLGGVSGMVISLFLLGSYYIFLDNAPVVAVAALLLYVGCYQLSFGPIGWLMISEIF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGL IAVLVNFG NALVTF FSP+K L+GAG +F+ FGVIAVV+++F+FFI+PE
Sbjct  429  PLRLRGRGLGIAVLVNFGANALVTFTFSPLKALLGAGILFYAFGVIAVVSLLFIFFIVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  489  TKGLTLEEIEAKCL  502



>emb|CDY43152.1| BnaA05g32340D [Brassica napus]
Length=504

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL+MTGVAV+V+DRLGR
Sbjct  312  GLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLVMTGVAVIVIDRLGR  371

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  372  RPLLLGGVSGMMISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFP  431

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI VV++ F++FI+PET
Sbjct  432  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSLFFIYFIVPET  491

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  492  KGLTLEEIEAKCL  504



>ref|NP_186959.2| vacuolar glucose transporter 1 [Arabidopsis thaliana]
 sp|Q8L6Z8.1|XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1 [Arabidopsis thaliana]
 gb|AAM98195.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56818.1| At3g03090 [Arabidopsis thaliana]
 gb|AEE73900.1| vacuolar glucose transporter 1 [Arabidopsis thaliana]
Length=503

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LGLLKL+MTGV+V+V+DR+GR
Sbjct  311  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGVSVIVIDRVGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLL GVSG+ ++LFLLGSYY F  NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  371  RPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI VV++ F+++I+PET
Sbjct  431  LKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFFIYYIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>ref|XP_002520022.1| sugar transporter, putative [Ricinus communis]
 gb|EEF42346.1| sugar transporter, putative [Ricinus communis]
Length=502

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL++FQQITGQPSVLYYA  IFQ AGF+AA+DATR SI LGLLKLIMTG AVV VDRLG
Sbjct  309  AGLVIFQQITGQPSVLYYAGSIFQSAGFSAASDATRVSILLGLLKLIMTGGAVVAVDRLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLL GVSG+A++LFLLGSYY FL++VP VAV+ALLLYVGCYQ SFGPIGWLMISEIF
Sbjct  369  RRPLLLTGVSGMAISLFLLGSYYRFLNDVPAVAVVALLLYVGCYQFSFGPIGWLMISEIF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGR L IAVLVNFG NA+VTFAFSP+K L+GAG +F+ FGVI+VV+++F+FF++PE
Sbjct  429  PLRLRGRALGIAVLVNFGANAIVTFAFSPLKALIGAGILFYGFGVISVVSLLFIFFVVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  489  TKGLTLEEIEAKCL  502



>gb|KJB26764.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=501

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGLLKLIMTGVAVVVVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLLKLIMTGVAVVVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY FLD++  +AV+ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  368  RRPLLLGGVSGMVISLFLLGSYYLFLDDLAAIAVVALLLYVGCYQLSFGPIGWLMISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLS+AVLVNFG NALVTFAFSP+K  +GAG VF++FGVIAV++++F+FFI+PE
Sbjct  428  PLRLRGRGLSVAVLVNFGANALVTFAFSPLKAWLGAGIVFYVFGVIAVLSLVFIFFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIE K L
Sbjct  488  TKGLTLEEIEVKCL  501



>ref|XP_009119042.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
 emb|CDY23466.1| BnaC04g49940D [Brassica napus]
Length=503

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL+MTGVAV+V+D+LGR
Sbjct  311  GLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLVMTGVAVIVIDKLGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL GGVSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  371  RPLLFGGVSGMVISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL GAG +FF FGVI V+++ F++FI+PET
Sbjct  431  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELFGAGVLFFGFGVICVLSLFFIYFIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>emb|CDX92028.1| BnaC03g33300D [Brassica napus]
Length=480

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL MTGVAV+V+D+LGR
Sbjct  288  GLVLFQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLAMTGVAVIVIDKLGR  347

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFP
Sbjct  348  RPLLLGGVSGMVLSLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFP  407

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI V+++ F++FI+PET
Sbjct  408  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVLSLFFIYFIVPET  467

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  468  KGLTLEEIEAKCL  480



>ref|XP_011008112.1| PREDICTED: D-xylose-proton symporter-like 2 [Populus euphratica]
Length=502

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI +GL KLIMTG+AV+VVDRLG
Sbjct  309  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILIGLFKLIMTGIAVLVVDRLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY FLD+ P VAV ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  369  RRPLLLGGVSGMVISLFLLGSYYIFLDDAPVVAVAALLLYVGCYQLSFGPIGWLMISEIF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGL IAVLVNFG NALVTF FSP+K L+GAG +F++F  IAVV+++F+FFI+PE
Sbjct  429  PLRLRGRGLGIAVLVNFGANALVTFTFSPLKALLGAGILFYVFAAIAVVSLLFIFFIVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  489  TKGLTLEEIEAKCL  502



>emb|CDY28736.1| BnaCnng06220D [Brassica napus]
Length=503

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL+MTGVAV+V+DRLGR
Sbjct  311  GLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLVMTGVAVIVIDRLGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F   VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  371  RPLLLGGVSGMMISLFLLGSYYIFYTTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI VV++ F++FI+PET
Sbjct  431  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSLFFIYFIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>ref|XP_009130331.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=504

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL+MTGVAV+V+DRLGR
Sbjct  312  GLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLVMTGVAVIVIDRLGR  371

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  372  RPLLLGGVSGMMISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFP  431

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI VV++ F++FI+PET
Sbjct  432  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSLFFIYFIVPET  491

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIE+K L
Sbjct  492  KGLTLEEIESKCL  504



>ref|XP_010489652.1| PREDICTED: D-xylose-proton symporter-like 1, partial [Camelina 
sativa]
Length=469

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LGLLKL+MTGV+V+V+DRLGR
Sbjct  277  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGVSVIVIDRLGR  336

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  337  RPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  396

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI V+++ F++FI+PET
Sbjct  397  LKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICVLSLFFIYFIVPET  456

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  457  KGLTLEEIEAKCL  469



>ref|XP_007219039.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
 gb|EMJ20238.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
Length=500

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLG
Sbjct  307  AGLVLFQQITGQPSVLYYAASIFQSAGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLG  366

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  367  RRPLLLGGVSGMVISLFLLGSYYLFFDNAPIAAVVALLLYVGCYQLSFGPIGWLMISEIF  426

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTFAFSP+K L+GAG +F+ FG IAV +++F+FFI+PE
Sbjct  427  PLRLRGRGLSIAVLVNFAANALVTFAFSPLKVLLGAGILFYAFGAIAVASLVFIFFIVPE  486

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  487  TKGLTLEEIEAKCL  500



>gb|ADP37177.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=453

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I + AGF+ A+DATR SI +GLLKLIMT VAV+VVD++GR
Sbjct  261  GLVLFQQITGQPSVLYYAASILESAGFSGASDATRVSILVGLLKLIMTAVAVLVVDKVGR  320

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  321  RPLLLGGVSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFP  380

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LRVRGRGLSIAVLVNFG NA+VTF+FSP+K L+GAG +F+ FGVIAV++++F+FF IPET
Sbjct  381  LRVRGRGLSIAVLVNFGANAIVTFSFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPET  440

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIEAK L
Sbjct  441  KGLSLEEIEAKLL  453



>ref|XP_008234574.1| PREDICTED: D-xylose-proton symporter-like 2 [Prunus mume]
Length=500

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLG
Sbjct  307  AGLVLFQQITGQPSVLYYAASIFQSAGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLG  366

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  367  RRPLLLGGVSGMVISLFLLGSYYLFFDNAPVAAVVALLLYVGCYQLSFGPIGWLMISEIF  426

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTFAFSP+K L+GAG +F++FG IAV +++F+FFI+PE
Sbjct  427  PLRLRGRGLSIAVLVNFAANALVTFAFSPLKVLLGAGILFYVFGAIAVASLVFIFFIVPE  486

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  487  TKGLTLEEIEAKCL  500



>emb|CDY49922.1| BnaCnng18320D [Brassica napus]
Length=503

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL+MTG AV+V+D+LGR
Sbjct  311  GLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLVMTGAAVIVIDKLGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL GGVSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  371  RPLLFGGVSGMVISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL GAG +FF FGVI V+++ F++FI+PET
Sbjct  431  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELFGAGVLFFGFGVICVLSLFFIYFIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>emb|CDX74227.1| BnaA03g28200D [Brassica napus]
Length=483

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL MTGVA++V+D+LGR
Sbjct  291  GLVLFQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLAMTGVAIIVIDKLGR  350

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFL+GSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFP
Sbjct  351  RPLLLGGVSGMVLSLFLMGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFP  410

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PET
Sbjct  411  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGILFCVFGVICVLSLFFIYFIVPET  470

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  471  KGLTLEEIEAKCL  483



>ref|XP_010463755.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=498

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LGLLKL+MTGV+V+V+DRLGR
Sbjct  306  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGVSVIVIDRLGR  365

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  366  RPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  425

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI V+++ F++FI+PET
Sbjct  426  LKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICVLSLFFIYFIVPET  485

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  486  KGLTLEEIEAKCL  498



>ref|XP_009134719.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=502

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL MTGVA++V+D+LGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLAMTGVAIIVIDKLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFL+GSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFP
Sbjct  370  RPLLLGGVSGMVLSLFLMGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PET
Sbjct  430  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGILFCVFGVICVLSLFFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_010506301.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=502

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LGLLKL+MTGV+V+V+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGVSVIVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI V+++ F++FI+PET
Sbjct  430  LKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICVLSLFFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_009351838.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG  KLIMTG AV+VVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASIFQSAGFSEASDATRVSILLGAFKLIMTGAAVLVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGV+G+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQ+SFGPIGWLMISEIF
Sbjct  368  RRPLLLGGVTGMVISLFLLGSYYLFFDNAPVAAVVALLLYVGCYQISFGPIGWLMISEIF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTFAFSP+K L+GAG +F++FG IAV +++F+FFI+PE
Sbjct  428  PLRLRGRGLSIAVLVNFAANALVTFAFSPLKALLGAGILFYVFGAIAVASLVFIFFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>ref|XP_002873804.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50063.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVSGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PET
Sbjct  430  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFIFFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_006590767.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X2 [Glycine 
max]
Length=435

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            +GL+LFQQITGQPSVLYYA  IFQ AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LG
Sbjct  242  SGLVLFQQITGQPSVLYYAGSIFQSAGFSGASDATRVSILLGFFKLIMTGVAVVVVDKLG  301

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LF LGSYY FLDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIF
Sbjct  302  RRPLLLGGVSGIVISLFFLGSYYIFLDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIF  361

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K L+GAG +F+ F VIAV +++F++F+IPE
Sbjct  362  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPE  421

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  422  TKGLTLEEIEAKCL  435



>ref|XP_006287575.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
 gb|EOA20473.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
Length=502

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PET
Sbjct  430  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLLFIFFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_003540611.1| PREDICTED: D-xylose-proton symporter-like 2-like [Glycine max]
Length=497

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYA  IFQ AGF+ A+DATR SI LG+ KLIMTGVAVVVVD+LG
Sbjct  304  AGLVLFQQITGQPSVLYYAGSIFQSAGFSGASDATRVSILLGVFKLIMTGVAVVVVDKLG  363

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LF LGSYY FLDN P VAV+ LLLYVG YQ+SFGPIGWLMI+EIF
Sbjct  364  RRPLLLGGVSGIVISLFFLGSYYIFLDNTPVVAVVGLLLYVGSYQISFGPIGWLMIAEIF  423

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K L+GAG +F+ FGVIAV +++F++ +IPE
Sbjct  424  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFGVIAVTSLVFIYLVIPE  483

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  484  TKGLTLEEIEAKCL  497



>ref|XP_010662115.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Vitis 
vinifera]
Length=493

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I + AGF+ A+DATR SI +GLLKLIMT VAV+VVD++GR
Sbjct  301  GLVLFQQITGQPSVLYYAASILESAGFSGASDATRVSILVGLLKLIMTAVAVLVVDKVGR  360

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  361  RPLLLGGVSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFP  420

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LRVRGRGLSIAVLVNFG NA+VTF+FSP+K L+GAG +F+ FGVIAV++++F+FF IPET
Sbjct  421  LRVRGRGLSIAVLVNFGANAIVTFSFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPET  480

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIEAK L
Sbjct  481  KGLSLEEIEAKLL  493



>gb|KHN46451.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=497

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYA  IFQ AGF+ A+DATR SI LG+ KLIMTGVAVVVVD+LG
Sbjct  304  AGLVLFQQITGQPSVLYYAGSIFQSAGFSGASDATRVSILLGVFKLIMTGVAVVVVDKLG  363

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LF LGSYY FLDN P VAV+ LLLYVG YQ+SFGPIGWLMI+EIF
Sbjct  364  RRPLLLGGVSGIVISLFFLGSYYIFLDNTPVVAVVGLLLYVGSYQISFGPIGWLMIAEIF  423

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K L+GAG +F+ FGVIAV +++F++ +IPE
Sbjct  424  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFGVIAVTSLVFIYLVIPE  483

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  484  TKGLTLEEIEAKCL  497



>ref|XP_002277076.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Vitis 
vinifera]
 emb|CBI26530.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I + AGF+ A+DATR SI +GLLKLIMT VAV+VVD++GR
Sbjct  308  GLVLFQQITGQPSVLYYAASILESAGFSGASDATRVSILVGLLKLIMTAVAVLVVDKVGR  367

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  368  RPLLLGGVSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFP  427

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LRVRGRGLSIAVLVNFG NA+VTF+FSP+K L+GAG +F+ FGVIAV++++F+FF IPET
Sbjct  428  LRVRGRGLSIAVLVNFGANAIVTFSFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPET  487

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIEAK L
Sbjct  488  KGLSLEEIEAKLL  500



>ref|NP_850835.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 ref|NP_850836.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 sp|Q6AWX0.1|XYLL2_ARATH RecName: Full=D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AAT85724.1| At5g17010 [Arabidopsis thaliana]
 dbj|BAF00329.1| sugar transporter like protein [Arabidopsis thaliana]
 gb|AED92369.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92370.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=503

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  311  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  371  RPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PET
Sbjct  431  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFIFFIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>ref|XP_010453878.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453879.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453880.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453881.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NA+VTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PET
Sbjct  430  LKLRGRGLSLAVLVNFGANAIVTFAFSPLKELLGAGILFCAFGVICVLSLVFIFFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|NP_001065505.1| Os10g0579200 [Oryza sativa Japonica Group]
 gb|AAG46179.1|AC018727_31 putative sugar transporter protein [Oryza sativa Japonica Group]
 gb|AAP55176.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27342.1| Os10g0579200 [Oryza sativa Japonica Group]
 dbj|BAG95336.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67505.1| hypothetical protein OsI_34793 [Oryza sativa Indica Group]
 gb|EEE51468.1| hypothetical protein OsJ_32598 [Oryza sativa Japonica Group]
Length=502

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA I Q AGF+ A+DATR S+ LGLLKLIMTGVAV+VVDRLG
Sbjct  310  CGLVFFQQVTGQPSVLYYAATILQSAGFSGASDATRVSVLLGLLKLIMTGVAVLVVDRLG  369

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIAV+LFLL SYYT L + P VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  370  RRPLLIGGVSGIAVSLFLLSSYYTLLKDAPYVAVIALLLYVGCYQLSFGPIGWLMISEVF  429

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV +++F+FFI+PE
Sbjct  430  PLRLRGRGLSIAVLVNFASNALVTFAFSPLEDLIGTGILFSAFGVIAVASLVFIFFIVPE  489

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEA 
Sbjct  490  TKGLTLEEIEAS  501



>ref|XP_004505609.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cicer arietinum]
Length=502

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+ A+DATR SI LG+ KLIMTGVAVVVVDR+G
Sbjct  309  AGLVLFQQITGQPSVLYYAASILQSAGFSLASDATRVSILLGVFKLIMTGVAVVVVDRIG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIF
Sbjct  369  RRPLLLGGVSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTFAFSP+K+L+GAG +F+IF  IAV +++F++FI+PE
Sbjct  429  PLRLRGRGLSIAVLVNFTANALVTFAFSPLKDLLGAGILFYIFCAIAVASLVFIYFIVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  489  TKGLTLEEIEAKCL  502



>ref|XP_003607412.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 ref|XP_003607415.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 gb|AES89609.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=501

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+ AADATR SI LG+ KLIMTGVAVVVVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASILQSAGFSLAADATRVSILLGVFKLIMTGVAVVVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIF
Sbjct  368  RRPLLLGGVSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RG+GLSIAVLVNF  NALVTFAFSP+K+L+GAG +F+IF  IAV +++F++FI+PE
Sbjct  428  PLRLRGKGLSIAVLVNFAANALVTFAFSPLKDLLGAGILFYIFSAIAVASLVFIYFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>gb|KFK25925.1| hypothetical protein AALP_AA8G181200 [Arabis alpina]
Length=504

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTG+AVVV+DRLGR
Sbjct  312  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGIAVVVIDRLGR  371

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  372  RPLLLGGVGGMVVSLFLLGSYYIFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  431

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLSIAVLVNFG NA+VTF+FSP+KEL+GAG +FF FGVI V++++F+FFI+PET
Sbjct  432  LKLRGRGLSIAVLVNFGANAIVTFSFSPLKELLGAGILFFGFGVICVLSLVFIFFIVPET  491

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  492  KGLTLEEIEAKCL  504



>ref|XP_009361176.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASIFQSAGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGV+G+ ++LFLLGSYY F D+ P  AV+AL+LYVGCYQ+SFGPIGWLMISEIF
Sbjct  368  RRPLLLGGVTGMVISLFLLGSYYLFFDDAPVAAVVALMLYVGCYQISFGPIGWLMISEIF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTFAFSP+K L+GAG +F++FGVIAV +++F+FFI+PE
Sbjct  428  PLRLRGRGLSIAVLVNFAANALVTFAFSPLKALLGAGILFYVFGVIAVASLLFIFFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>ref|XP_006662109.1| PREDICTED: D-xylose-proton symporter-like 2-like [Oryza brachyantha]
Length=500

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA I Q AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLG
Sbjct  308  CGLVFFQQVTGQPSVLYYAATILQSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIAV+LFLL SYYT L + P VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  368  RRPLLIGGVSGIAVSLFLLSSYYTLLKDAPYVAVIALLLYVGCYQLSFGPIGWLMISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV +++F+F I+PE
Sbjct  428  PLRLRGRGLSIAVLVNFASNALVTFAFSPLEDLIGTGILFCGFGVIAVASLVFIFCIVPE  487

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEA 
Sbjct  488  TKGLTLEEIEAS  499



>ref|XP_010933396.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DATR S+ LGLLKL+MTG+AV+VVDR+G
Sbjct  308  AGLVFFQQVTGQPSVLYYAATILQTAGFSAASDATRVSVLLGLLKLVMTGIAVLVVDRVG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGI ++LFLL SYYT L + P VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  368  RRPLLIGGVSGIVISLFLLSSYYTLLKDSPFVAVIALLLYVGCYQLSFGPIGWLMISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIAV +++F+FF++PE
Sbjct  428  PLRLRGRGLSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGVIAVASLLFIFFVVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKIL  501



>gb|KHN05527.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=501

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            +GL+LFQQITGQPSVLYYA  IFQ AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LG
Sbjct  308  SGLVLFQQITGQPSVLYYAGSIFQSAGFSGASDATRVSILLGFFKLIMTGVAVVVVDKLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LF LGSYY FLDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIF
Sbjct  368  RRPLLLGGVSGIVISLFFLGSYYIFLDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K L+GAG +F+ F VIAV +++F++F+IPE
Sbjct  428  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>ref|XP_003537722.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X1 [Glycine 
max]
Length=501

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            +GL+LFQQITGQPSVLYYA  IFQ AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LG
Sbjct  308  SGLVLFQQITGQPSVLYYAGSIFQSAGFSGASDATRVSILLGFFKLIMTGVAVVVVDKLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LF LGSYY FLDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIF
Sbjct  368  RRPLLLGGVSGIVISLFFLGSYYIFLDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K L+GAG +F+ F VIAV +++F++F+IPE
Sbjct  428  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>ref|XP_002884358.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60617.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LGLLKL+MTG++V+V+DR+GR
Sbjct  309  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGLSVIVIDRVGR  368

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY F   VP VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  369  RPLLLGGVSGMVISLFLLGSYYMFYKTVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  428

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI VV++ F+++I+PET
Sbjct  429  LKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFFIYYIVPET  488

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  489  KGLTLEEIEAKCL  501



>ref|XP_010420407.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420408.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420410.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420411.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWL+ISEIFP
Sbjct  370  RPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLIISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V+++ F+FFI+PET
Sbjct  430  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLFFIFFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_008362818.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG  KLIMTG AV++VDRLGR
Sbjct  309  GLVLFQQITGQPSVLYYAASIFQSAGFSEASDATRVSILLGAFKLIMTGAAVLLVDRLGR  368

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV+G+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQ+SFGPIGWLMISEIFP
Sbjct  369  RPLLLGGVTGMVISLFLLGSYYLFFDNAPVAAVVALLLYVGCYQISFGPIGWLMISEIFP  428

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGLSIAVLVNF  NALVTFAFSP+K L+GAG +F+ FG IAV +++F+FFI+PET
Sbjct  429  LRLRGRGLSIAVLVNFAANALVTFAFSPLKALLGAGILFYGFGAIAVASLVFIFFIVPET  488

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  489  KGLTLEEIEAKCL  501



>gb|KFK37751.1| hypothetical protein AALP_AA3G025300 [Arabis alpina]
Length=503

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF AAADATR SI LG+LKL MTGVAVVV+D+LGR
Sbjct  311  GLVLFQQITGQPSVLYYAPSILQTAGFDAAADATRISILLGVLKLAMTGVAVVVIDKLGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ +ALFLLGSYY F   VP VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  371  RPLLLGGVSGMVIALFLLGSYYIFYHTVPAVAVGALLLYVGCYQISFGPISWLMLSEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRG+S+AVLVNFGTNALVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PET
Sbjct  431  LRLRGRGISLAVLVNFGTNALVTFAFSPLKELLGAGVLFCVFGVICVLSLFFIYFIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>gb|AFK39030.1| unknown [Medicago truncatula]
Length=501

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+ AADATR SI LG+ KLIMTGVAVVVVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASILQSAGFSLAADATRVSILLGVFKLIMTGVAVVVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIF
Sbjct  368  RRPLLLGGVSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RG+GLSIAV VNF  NALVTFAFSP+K+L+GAG +F+IF  IAV +++F++FI+PE
Sbjct  428  PLRLRGKGLSIAVFVNFAANALVTFAFSPLKDLLGAGILFYIFSAIAVASLVFIYFIVPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKCL  501



>dbj|BAJ88105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LGLLKLIMTGVAV+VVD+LG
Sbjct  303  CGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDKLG  362

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIAV+LFLL SYYT     P VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  363  RRPLLIGGVSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVGCYQLSFGPIGWLMISEVF  422

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F I+PE
Sbjct  423  PLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIAVASLAFIFCIVPE  482

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEAK
Sbjct  483  TKGLTLEEIEAK  494



>gb|EMS55132.1| D-xylose-proton symporter-like 2 [Triticum urartu]
Length=495

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LGLLKLIMTGVAV+VVD+LG
Sbjct  303  CGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDKLG  362

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIAV+LFLL SYYT     P VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  363  RRPLLIGGVSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVGCYQLSFGPIGWLMISEVF  422

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F I+PE
Sbjct  423  PLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIAVASLAFIFCIVPE  482

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEAK
Sbjct  483  TKGLTLEEIEAK  494



>ref|XP_011470132.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=495

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LGL KL+MTGVAV+VVDRLG
Sbjct  302  AGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSIVLGLFKLVMTGVAVLVVDRLG  361

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLL GVSG+ ++LFLLGSYY F D+ P VAVIALL YVGCYQ SFGPIGWLMISEIF
Sbjct  362  RRPLLLTGVSGMVISLFLLGSYYLFFDDTPAVAVIALLAYVGCYQFSFGPIGWLMISEIF  421

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTF+FSP++  +GAG VF+IFG IAV +++F+FFI+PE
Sbjct  422  PLRLRGRGLSIAVLVNFAANALVTFSFSPLEAWLGAGIVFYIFGAIAVASLVFIFFIVPE  481

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIE K
Sbjct  482  TKGLTLEEIETK  493



>ref|XP_004307871.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LGL KL+MTGVAV+VVDRLG
Sbjct  304  AGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSIVLGLFKLVMTGVAVLVVDRLG  363

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLL GVSG+ ++LFLLGSYY F D+ P VAVIALL YVGCYQ SFGPIGWLMISEIF
Sbjct  364  RRPLLLTGVSGMVISLFLLGSYYLFFDDTPAVAVIALLAYVGCYQFSFGPIGWLMISEIF  423

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF  NALVTF+FSP++  +GAG VF+IFG IAV +++F+FFI+PE
Sbjct  424  PLRLRGRGLSIAVLVNFAANALVTFSFSPLEAWLGAGIVFYIFGAIAVASLVFIFFIVPE  483

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIE K
Sbjct  484  TKGLTLEEIETK  495



>ref|XP_010558647.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
 ref|XP_010558648.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
Length=501

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADAT AS+ LG+LKLIMTGVAVVV+D+LGR
Sbjct  309  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATSASVLLGILKLIMTGVAVVVIDKLGR  368

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ V+LFLLGSYY F  +   VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  369  RPLLLGGVSGMGVSLFLLGSYYIFFGDASSVAVVALLLYVGCYQLSFGPIGWLMISEIFP  428

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLSIAVLVNFG NALVTFAFSP+KE++GAG +F+ FGVI +++++F+FFI+PET
Sbjct  429  LKLRGRGLSIAVLVNFGANALVTFAFSPLKEMLGAGILFYGFGVICLLSLLFIFFIVPET  488

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  489  KGLTLEEIEAKCL  501



>ref|XP_008791055.1| PREDICTED: D-xylose-proton symporter-like 2 [Phoenix dactylifera]
Length=475

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DA   SI LGLLKL+M G AVV VDRLG
Sbjct  282  AGLVFFQQVTGQPSVLYYAATILQSAGFSAASDAIHVSILLGLLKLVMAGTAVVAVDRLG  341

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVS IA++LFLL SYYT L++ P VAVIALLLYVGCYQLSFGPIGWL+ISE+F
Sbjct  342  RRPLLIGGVSWIAISLFLLSSYYTLLNDSPFVAVIALLLYVGCYQLSFGPIGWLLISEVF  401

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGR LSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIAV A++F+FF+IPE
Sbjct  402  PLRLRGRALSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGVIAVGALLFIFFVIPE  461

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  462  TKGLTLEEIEAKIL  475



>ref|XP_010671130.1| PREDICTED: D-xylose-proton symporter-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYAA I + AGF+AA+DATR SI LG  KLIMTGVAV+VVD+LG
Sbjct  310  CGLVLFQQITGQPSVLYYAASILKSAGFSAASDATRVSILLGFFKLIMTGVAVLVVDKLG  369

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++L  LG+YYTFL + P +AV+ LLLYVGCYQLS+GPIGWLMISEIF
Sbjct  370  RRPLLLGGVSGMVISLLFLGAYYTFLGDAPAIAVVGLLLYVGCYQLSYGPIGWLMISEIF  429

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG VFF+FG IAV++++F+FFIIPE
Sbjct  430  PLRMRGRGISLAVLMNFGANALVTFAFSPLKDLIGAGAVFFMFGGIAVLSLVFIFFIIPE  489

Query  154  TKGLTLEEIEA  122
            TKGLTLEEIEA
Sbjct  490  TKGLTLEEIEA  500



>gb|EYU43459.1| hypothetical protein MIMGU_mgv1a004913mg [Erythranthe guttata]
Length=504

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA IFQ AGF+AA+DAT+ SI LGLLKLIMTGVAV+VVDRLGR
Sbjct  312  GLVLFQQITGQPSVLYYAATIFQSAGFSAASDATKVSILLGLLKLIMTGVAVLVVDRLGR  371

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGIAV+LFLLGSYYT+L ++P VAV+ALL+YVGCYQLSFGPIGWLMISEIFP
Sbjct  372  RPLLLGGVSGIAVSLFLLGSYYTYLGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEIFP  431

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGLSIAVL+NFG NALVTFAFSP+KEL+GAG +FFIFG IA++++IF+FFIIPET
Sbjct  432  LRLRGRGLSIAVLINFGANALVTFAFSPLKELLGAGILFFIFGGIAILSLIFIFFIIPET  491

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  492  KGLTLEEIEAKLL  504



>ref|XP_008455658.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Cucumis 
melo]
Length=408

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LGLLKL+MTG AV+VVDRLG
Sbjct  215  AGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLGLLKLLMTGAAVLVVDRLG  274

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGV GI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+F
Sbjct  275  RRPLLLGGVFGIVISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVF  334

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFIFGV+A+++++F+FFI+PE
Sbjct  335  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFIFGVVAILSLVFIFFIVPE  394

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEA+ L
Sbjct  395  TKGLTLEEIEARCL  408



>ref|XP_008376911.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA IFQ AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLGR
Sbjct  309  GLVLFQQITGQPSVLYYAASIFQSAGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLGR  368

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV+G+ ++LFLLGSYY F D+ P  AV+ALLLYVGCYQ+SFGPIGWLMISE+FP
Sbjct  369  RPLLLGGVTGMVISLFLLGSYYLFFDDAPVAAVVALLLYVGCYQISFGPIGWLMISEVFP  428

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGL IAVLVNF  NALVTFAFSP+K L+GAG +F+ FGVIAV ++ F+FFI+PET
Sbjct  429  LRLRGRGLGIAVLVNFAANALVTFAFSPLKALLGAGILFYAFGVIAVASLFFIFFIVPET  488

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEA  L
Sbjct  489  KGLTLEEIEANCL  501



>ref|XP_008644913.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Zea mays]
 gb|AFW69044.1| hypothetical protein ZEAMMB73_344214 [Zea mays]
Length=517

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLG
Sbjct  325  CGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLG  384

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGI VALFLL SYYT L +   VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  385  RRPLLIGGVSGITVALFLLSSYYTLLKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVF  444

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGL +AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F+I+PE
Sbjct  445  PLRLRGRGLGVAVLVNFASNALVTFAFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPE  504

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEA 
Sbjct  505  TKGLTLEEIEAS  516



>ref|XP_008644912.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Zea mays]
Length=518

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLG
Sbjct  326  CGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLG  385

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGI VALFLL SYYT L +   VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  386  RRPLLIGGVSGITVALFLLSSYYTLLKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVF  445

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGL +AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F+I+PE
Sbjct  446  PLRLRGRGLGVAVLVNFASNALVTFAFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPE  505

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEA 
Sbjct  506  TKGLTLEEIEAS  517



>ref|XP_010920045.1| PREDICTED: D-xylose-proton symporter-like 2 [Elaeis guineensis]
Length=501

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DA R SI LGLLK++M G AV V+DRLG
Sbjct  308  AGLVFFQQVTGQPSVLYYAATILQSAGFSAASDAIRVSILLGLLKVVMAGTAVPVIDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVS I ++LFLL SYYT L++ P VAVIALLLYVGCYQLSFGPIGWL+ISE+F
Sbjct  368  RRPLLIGGVSWIVISLFLLSSYYTLLNDSPFVAVIALLLYVGCYQLSFGPIGWLLISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP++ LVG G +F  FG+IAV A++F+FF+IPE
Sbjct  428  PLRLRGRGLSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGIIAVAALLFIFFVIPE  487

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  488  TKGLTLEEIEAKIL  501



>gb|KDO39943.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=453

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLG
Sbjct  279  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLG  338

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  339  RRPLLLGGVSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVF  398

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAG  224
            PLR+RGRGLS+AVLVNFG NALVTFAFSP+K+L+GAG
Sbjct  399  PLRLRGRGLSVAVLVNFGANALVTFAFSPLKDLLGAG  435



>ref|XP_002464862.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
 gb|EER91860.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
Length=511

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LG+LKLIMTGVAV+VVDRLG
Sbjct  319  CGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLGVLKLIMTGVAVLVVDRLG  378

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGI VALFLL SYYT L +   VAVIALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  379  RRPLLIGGVSGITVALFLLSSYYTLLKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVF  438

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGL +AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F+I+PE
Sbjct  439  PLRLRGRGLGVAVLVNFASNALVTFAFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPE  498

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEA 
Sbjct  499  TKGLTLEEIEAS  510



>gb|AFW67123.1| hypothetical protein ZEAMMB73_874760 [Zea mays]
Length=295

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA + +I +GL KL+MTGVAV  VD +GR
Sbjct  102  GLVLFQQITGQPSVLYYAASILQTAGFSAASDAAKVAILIGLFKLLMTGVAVFKVDDVGR  161

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  162  RPLLIGGVGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFP  221

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PET
Sbjct  222  LRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPET  281

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  282  KGLSLEEIESKIL  294



>ref|XP_008455657.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Cucumis 
melo]
Length=502

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LGLLKL+MTG AV+VVDRLG
Sbjct  309  AGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLGLLKLLMTGAAVLVVDRLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGV GI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+F
Sbjct  369  RRPLLLGGVFGIVISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFIFGV+A+++++F+FFI+PE
Sbjct  429  PLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFIFGVVAILSLVFIFFIVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEA+ L
Sbjct  489  TKGLTLEEIEARCL  502



>ref|XP_003574402.1| PREDICTED: D-xylose-proton symporter-like 2 [Brachypodium distachyon]
Length=503

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLG
Sbjct  311  CGLVFFQQVTGQPSVLYYAATIFQTAGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLG  370

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIAVALFLL SYYT       VAVIALLLYVG YQLSFGPIGWLMISE+F
Sbjct  371  RRPLLIGGVSGIAVALFLLSSYYTLFKGASYVAVIALLLYVGSYQLSFGPIGWLMISEVF  430

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIA+ ++ F+  I+PE
Sbjct  431  PLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIALASLGFILCIVPE  490

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEAK
Sbjct  491  TKGLTLEEIEAK  502



>ref|XP_008809219.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Phoenix dactylifera]
Length=502

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DATR S+ LGLLKL+MTG+AV+VVDR+G
Sbjct  309  AGLVFFQQVTGQPSVLYYAATILQSAGFSAASDATRVSVLLGLLKLVMTGIAVLVVDRVG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGI ++LFLL SYYT   +   VAVIALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  369  RRPLLIGGVSGIVISLFLLSSYYTLFKDSAFVAVIALLLYVGCYQLSFGPIGWLMISEIF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTF+FSP++ LVG G +F  FGVIAV +++F+FF++PE
Sbjct  429  PLRLRGRGLSIAVLVNFASNALVTFSFSPLEALVGTGILFAGFGVIAVASLVFIFFVVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLE+IE K L
Sbjct  489  TKGLTLEDIETKIL  502



>gb|KDO39944.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=487

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLG
Sbjct  313  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLG  372

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  373  RRPLLLGGVSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVF  432

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAG  224
            PLR+RGRGLS+AVLVNFG NALVTFAFSP+K+L+GAG
Sbjct  433  PLRLRGRGLSVAVLVNFGANALVTFAFSPLKDLLGAG  469



>ref|XP_002463619.1| hypothetical protein SORBIDRAFT_01g003010 [Sorghum bicolor]
 gb|EER90617.1| hypothetical protein SORBIDRAFT_01g003010 [Sorghum bicolor]
Length=259

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AG++AA+DA + +I +GL KL+MTGVAV  VD +GR
Sbjct  66   GLVLFQQITGQPSVLYYAASILQTAGYSAASDAAKVAILIGLFKLLMTGVAVFKVDDVGR  125

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  LD  P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  126  RPLLIGGVGGIALSLFLLAAYYKILDGFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFP  185

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KE +G  N+FF+FGVIAV++++FV  ++PET
Sbjct  186  LRTRGRGISLAVLTNFGSNALVTFAFSPLKEFLGPANIFFLFGVIAVLSLVFVILVVPET  245

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  246  KGLSLEEIESKIL  258



>ref|XP_006408343.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
 gb|ESQ49796.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
Length=502

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKL+MTGVAV+V+D+LGR
Sbjct  310  GLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLGLLKLLMTGVAVIVIDKLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ V+LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVSGMVVSLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI V+++ F++FI+PET
Sbjct  430  LKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFSGFGVICVLSLFFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|NP_001173691.1| Os03g0823200 [Oryza sativa Japonica Group]
 dbj|BAH92419.1| Os03g0823200, partial [Oryza sativa Japonica Group]
Length=303

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL KL+MTGVAV  VD LGR
Sbjct  110  GLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGLFKLLMTGVAVFKVDDLGR  169

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  170  RPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  229

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PET
Sbjct  230  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPET  289

Query  151  KGLTLEEIEAKYLT  110
            KGLTLEEIE+K L 
Sbjct  290  KGLTLEEIESKLLK  303



>ref|XP_010685696.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=565

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA +I Q AGF+AA+DATR S+ +GL K +MTGVAV+ VD LGR
Sbjct  372  GLVLFQQITGQPSVLYYAGQILQSAGFSAASDATRVSVLIGLFKFVMTGVAVLKVDDLGR  431

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            +PLL+GGVSGI VALFLL +YY FL  +P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  432  KPLLIGGVSGITVALFLLAAYYKFLGGLPFVAVAALLLYVGSYQISFGPISWLMVSEIFP  491

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KEL+GA N+F +FGVIA+++++FV  ++PET
Sbjct  492  LRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGADNLFLLFGVIALLSLVFVLTLVPET  551

Query  151  KGLTLEEIEAK  119
            KGL+LEEIEAK
Sbjct  552  KGLSLEEIEAK  562



>ref|XP_004309072.1| PREDICTED: D-xylose-proton symporter-like 2 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AAADATR SI LGL KL+MTG AV+VVDR G
Sbjct  305  AGLVLFQQITGQPSVLYYAASILQSAGFSAAADATRVSILLGLFKLVMTGSAVLVVDRFG  364

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LF+LGSYY FL+  P VA IALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  365  RRPLLLGGVSGMVISLFMLGSYYLFLNEAPAVAAIALLLYVGCYQLSFGPIGWLMISEIF  424

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RG+GLSI VLVNF  NALVT AFSP+K  +GAG +F++FG IAV ++ F+FFI+PE
Sbjct  425  PLRFRGQGLSIGVLVNFAANALVTLAFSPLKAWLGAGLLFYVFGAIAVASLAFIFFIVPE  484

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE + L
Sbjct  485  TKGLSLEEIEEQCL  498



>ref|XP_011075803.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Sesamum 
indicum]
Length=502

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA IFQ AGF+AA+DAT+ SI LGL KLIMTGVAV+ VDRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAATIFQSAGFSAASDATKVSILLGLWKLIMTGVAVLAVDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGI ++LFLLGSYYT+L ++P VAV+ALL+YVGCYQLSFGPIGWLMISE+FP
Sbjct  370  RPLLLGGVSGIVISLFLLGSYYTYLGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEVFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGLSIAVLVNF  NALVTFAFSP++EL+GAG +FF FG IAV+++IF+FFIIPET
Sbjct  430  LRLRGRGLSIAVLVNFAANALVTFAFSPLRELLGAGILFFSFGGIAVLSLIFIFFIIPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKLL  502



>ref|XP_011075802.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Sesamum 
indicum]
Length=524

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA IFQ AGF+AA+DAT+ SI LGL KLIMTGVAV+ VDRLGR
Sbjct  332  GLVLFQQITGQPSVLYYAATIFQSAGFSAASDATKVSILLGLWKLIMTGVAVLAVDRLGR  391

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGI ++LFLLGSYYT+L ++P VAV+ALL+YVGCYQLSFGPIGWLMISE+FP
Sbjct  392  RPLLLGGVSGIVISLFLLGSYYTYLGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEVFP  451

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGLSIAVLVNF  NALVTFAFSP++EL+GAG +FF FG IAV+++IF+FFIIPET
Sbjct  452  LRLRGRGLSIAVLVNFAANALVTFAFSPLRELLGAGILFFSFGGIAVLSLIFIFFIIPET  511

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  512  KGLTLEEIEAKLL  524



>ref|XP_010256836.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Nelumbo 
nucifera]
Length=568

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G  KL+MTGVAV+ VD LG
Sbjct  374  GGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGTFKLLMTGVAVLKVDDLG  433

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  434  RRPLLIGGVSGIALSLFLLTAYYKFLGGFPIVAVAALLLYVGCYQISFGPISWLMVSEIF  493

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRGLS+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++F    +PE
Sbjct  494  PLRTRGRGLSLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGIALLSLLFAIVFVPE  553

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  554  TKGLSLEEIESKIL  567



>dbj|BAH19966.1| AT5G59250 [Arabidopsis thaliana]
Length=415

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  221  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  280

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  281  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  340

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  341  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPE  400

Query  154  TKGLTLEEIEAKYLT  110
            TKGL+LEEIE+K L 
Sbjct  401  TKGLSLEEIESKILK  415



>ref|XP_008681531.1| PREDICTED: uncharacterized protein LOC100274077 isoform X2 [Zea 
mays]
Length=559

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA + +I +GL KL+MTGVAV  VD +GR
Sbjct  366  GLVLFQQITGQPSVLYYAASILQTAGFSAASDAAKVAILIGLFKLLMTGVAVFKVDDVGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PET
Sbjct  486  LRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPET  545

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  546  KGLSLEEIESKIL  558



>ref|XP_008681530.1| PREDICTED: uncharacterized protein LOC100274077 isoform X1 [Zea 
mays]
Length=586

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA + +I +GL KL+MTGVAV  VD +GR
Sbjct  393  GLVLFQQITGQPSVLYYAASILQTAGFSAASDAAKVAILIGLFKLLMTGVAVFKVDDVGR  452

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  453  RPLLIGGVGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFP  512

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PET
Sbjct  513  LRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPET  572

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  573  KGLSLEEIESKIL  585



>ref|XP_010106537.1| D-xylose-proton symporter-like 3 [Morus notabilis]
 gb|EXC10713.1| D-xylose-proton symporter-like 3 [Morus notabilis]
Length=500

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL KL+MT +AV+ VD LG
Sbjct  306  GGLVLFQQITGQPSVLYYAGSILQSAGFSAASDATRVSVIIGLFKLVMTWIAVLKVDDLG  365

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIAV+L LL +YY FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  366  RRPLLIGGVSGIAVSLLLLSAYYKFLGGYPLVAVASLLLYVGCYQISFGPISWLMVSEIF  425

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA ++++FV   +PE
Sbjct  426  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLVFGVIAFLSLLFVVLYVPE  485

Query  154  TKGLTLEEIEAKYLT  110
            TKGL+LEEIE+K L 
Sbjct  486  TKGLSLEEIESKILK  500



>ref|XP_002300123.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
 gb|EEE84928.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
Length=559

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL MT +AV+ VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKLAMTWIAVLKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+SIAVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV  I+PET
Sbjct  486  LRTRGRGISIAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVVIVPET  545

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  546  KGLSLEEIESKILK  559



>ref|XP_006279761.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
 gb|EOA12659.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
Length=559

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  364  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  423

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  424  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  483

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+V+++FV  ++PE
Sbjct  484  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGIALVSLLFVILVVPE  543

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  544  TKGLSLEEIESKIL  557



>ref|XP_006400240.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
 gb|ESQ41693.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
Length=502

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AA DAT+ SI LGLLKLIMTGVAVVV+D+LG
Sbjct  309  GGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATKVSILLGLLKLIMTGVAVVVIDKLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  369  RRPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL++RGRGLSIAVLVNFG NALVTFAFSP++EL+GAG +FF FGVI V++++F+FFI+PE
Sbjct  429  PLKLRGRGLSIAVLVNFGANALVTFAFSPLEELLGAGILFFGFGVICVLSLLFIFFIVPE  488

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  489  TKGLTLEEIEAKCL  502



>ref|XP_009126154.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  313  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  372

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  373  RPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  432

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PET
Sbjct  433  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPET  492

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  493  KGLTLEEIEAKCL  505



>ref|XP_006651969.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Oryza brachyantha]
Length=473

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL KL+MTGVAV  VD LGR
Sbjct  280  GLVLFQQITGQPSVLYYATYILQTAGFAAASDAAKVSILIGLFKLLMTGVAVFKVDDLGR  339

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  340  RPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  399

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PET
Sbjct  400  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFILFGAISLLSLVFVILKVPET  459

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIE+K L
Sbjct  460  KGLTLEEIESKIL  472



>ref|XP_009126155.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Brassica 
rapa]
Length=502

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PET
Sbjct  430  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>emb|CDX85478.1| BnaA02g03350D [Brassica napus]
Length=505

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  313  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  372

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  373  RPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  432

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PET
Sbjct  433  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPET  492

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  493  KGLTLEEIEAKCL  505



>gb|EEE60202.1| hypothetical protein OsJ_13164 [Oryza sativa Japonica Group]
Length=488

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL KL+MTGVAV  VD LGR
Sbjct  295  GLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGLFKLLMTGVAVFKVDDLGR  354

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  355  RPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  414

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PET
Sbjct  415  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPET  474

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIE+K L
Sbjct  475  KGLTLEEIESKLL  487



>ref|XP_010454633.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR S+ +G+ KL+MT VAV  VD LG
Sbjct  365  GGLVLFQQITGQPSVLYYAGSILQTAGFSAATDATRVSVIIGVFKLLMTWVAVAKVDDLG  424

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  425  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  484

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NALVTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  485  PLRTRGRGISLAVLTNFGSNALVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPE  544

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  545  TKGLSLEEIESKIL  558



>emb|CDY54245.1| BnaC09g53840D [Brassica napus]
Length=559

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PET
Sbjct  486  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVVLVVPET  545

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  546  KGLSLEEIESKIL  558



>gb|ABK24923.1| unknown [Picea sitchensis]
Length=521

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR S+ LG+ KL+MTG+AV+ VD+LGR
Sbjct  328  GLVLFQQITGQPSVLYYAATILQSAGFSAASDATRVSVILGVFKLLMTGIAVLKVDQLGR  387

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI ++LFLL +YY+FL+  P VAV+ALL YV CYQ+SFGPI WLM+SEIFP
Sbjct  388  RPLLIGGVSGIVLSLFLLAAYYSFLNGTPIVAVLALLFYVSCYQVSFGPISWLMVSEIFP  447

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVLVNF +NALVTF+FSP++EL+GA  +F  FGVIA+++++FV F +PET
Sbjct  448  LRTRGRGISVAVLVNFASNALVTFSFSPLQELLGASMLFVTFGVIALLSLLFVIFYVPET  507

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  508  KGLSLEEIESKIL  520



>ref|XP_009120413.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brassica 
rapa]
Length=555

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  361  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  420

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  421  RRPLLIGGVSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  480

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  481  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVVLVVPE  540

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  541  TKGLSLEEIESKIL  554



>emb|CDY33006.1| BnaA10g12120D [Brassica napus]
Length=555

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  361  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  420

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  421  RRPLLIGGVSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  480

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  481  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVVLVVPE  540

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  541  TKGLSLEEIESKIL  554



>gb|AAO18445.1| putative sugar transporter protein [Oryza sativa Japonica Group]
Length=525

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL KL+MTGVAV  VD LGR
Sbjct  332  GLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGLFKLLMTGVAVFKVDDLGR  391

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  392  RPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  451

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PET
Sbjct  452  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPET  511

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIE+K L
Sbjct  512  KGLTLEEIESKLL  524



>ref|XP_010535452.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=557

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AV  VD +GR
Sbjct  364  GLVLFQQITGQPSVLYYAGSILQSAGFSAAADATRVSVIVGLFKLLMTWIAVAKVDDIGR  423

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  424  RPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  483

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA VTFAFSP+KEL+GA N+F +FG +A+V+++FV  I+PET
Sbjct  484  LRTRGKGISLAVLTNFGSNAAVTFAFSPLKELLGAENLFLLFGAVALVSLLFVILIVPET  543

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  544  KGLSLEEIESKILK  557



>ref|XP_002866311.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42570.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  365  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  424

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  425  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  484

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  485  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPE  544

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  545  TKGLSLEEIESKIL  558



>gb|EMT10196.1| D-xylose-proton symporter-like protein 2 [Aegilops tauschii]
Length=524

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 166/221 (75%), Gaps = 29/221 (13%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaa-----------------------------a  602
             GL+ FQQ+TGQPSVLYYAA IFQ                                   A
Sbjct  303  CGLVFFQQVTGQPSVLYYAATIFQVLILLHMKLFNSSMPLSGVKVAISSIRVGSAGFSGA  362

Query  601  adatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPP  422
            +DATR SI LGLLKLIMTGVAV+VVD+LGRRPLL+GGVSGIAV+LFLL SYYT     P 
Sbjct  363  SDATRVSILLGLLKLIMTGVAVLVVDKLGRRPLLIGGVSGIAVSLFLLSSYYTLFTGAPY  422

Query  421  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  242
            VAVIALLLYVGCYQLSFGPIGWLMISE+FPL++RGRGLS+AVLVNF +NALVTFAFSP++
Sbjct  423  VAVIALLLYVGCYQLSFGPIGWLMISEVFPLKLRGRGLSVAVLVNFASNALVTFAFSPLE  482

Query  241  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  119
            +L+G G +F  FGVIAV ++ F+F I+PETKGLTLEEIEAK
Sbjct  483  DLIGTGVLFASFGVIAVASLAFIFCIVPETKGLTLEEIEAK  523



>gb|ABF99614.1| sugar transporter family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=545

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL KL+MTGVAV  VD LGR
Sbjct  352  GLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGLFKLLMTGVAVFKVDDLGR  411

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  412  RPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  471

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PET
Sbjct  472  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPET  531

Query  151  KGLTLEEIEAKYLT  110
            KGLTLEEIE+K L 
Sbjct  532  KGLTLEEIESKLLK  545



>ref|XP_007016336.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY33955.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=561

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AVV VD LGR
Sbjct  368  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVLVGLFKLLMTWIAVVKVDDLGR  427

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  428  RPLLIGGVGGIALSLFLLSAYYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  487

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+ +++FV   +PET
Sbjct  488  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLVFGAIALSSLLFVVLYVPET  547

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  548  KGLSLEEIESKILK  561



>ref|XP_010443656.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  364  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  423

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  424  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  483

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  484  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPE  543

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  544  TKGLSLEEIESKIL  557



>ref|NP_200733.2| Major facilitator superfamily protein [Arabidopsis thaliana]
 sp|Q0WWW9.2|XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09770.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AAU05477.1| At5g59250 [Arabidopsis thaliana]
 gb|AAV85693.1| At5g59250 [Arabidopsis thaliana]
 gb|AED97162.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=558

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  364  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  423

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  424  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  483

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  484  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPE  543

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  544  TKGLSLEEIESKIL  557



>gb|KJB26763.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=460

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGLLKLIMTGVAVVVVDRLG
Sbjct  308  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLLKLIMTGVAVVVVDRLG  367

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSG+ ++LFLLGSYY FLD++  +AV+ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  368  RRPLLLGGVSGMVISLFLLGSYYLFLDDLAAIAVVALLLYVGCYQLSFGPIGWLMISEVF  427

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKEL  236
            PLR+RGRGLS+AVLVNFG NALVTFAFSP+K L
Sbjct  428  PLRLRGRGLSVAVLVNFGANALVTFAFSPLKVL  460



>dbj|BAE98379.1| D-xylose-H+ symporter - like protein [Arabidopsis thaliana]
Length=558

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  364  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  423

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  424  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  483

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  484  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPE  543

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  544  TKGLSLEEIESKIL  557



>ref|NP_001287653.1| D-xylose-proton symporter-like 3, chloroplastic-like [Solanum 
lycopersicum]
 ref|XP_004235087.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
 dbj|BAO96238.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
 dbj|BAQ03806.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
Length=545

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K +MT VAV+  D LG
Sbjct  351  GGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKSLMTAVAVLKADDLG  410

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  411  RRPLLIGGVSGIALSLFLLSAYYKFLGSYPFVAVSALLLYVGCYQISFGPISWLMVSEIF  470

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PE
Sbjct  471  PLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALLSLVFVVTSVPE  530

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIE+K L
Sbjct  531  TKGLTLEEIESKIL  544



>gb|KJB20004.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=541

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AV  VD LGR
Sbjct  348  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKLLMTWIAVAKVDDLGR  407

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  408  RPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQISFGPISWLMVSEIFP  467

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PET
Sbjct  468  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALISLLFVALYVPET  527

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  528  KGLSLEEIESKLLK  541



>ref|XP_010483521.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=560

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  365  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  424

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  425  RRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIF  484

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV  ++PE
Sbjct  485  PLRTRGRGISLAVLANFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALISLLFVILVVPE  544

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  545  TKGLSLEEIESKIL  558



>gb|EEC76432.1| hypothetical protein OsI_14118 [Oryza sativa Indica Group]
Length=579

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL KL+MTGVAV  VD LGR
Sbjct  386  GLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGLFKLLMTGVAVFKVDDLGR  445

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  446  RPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  505

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PET
Sbjct  506  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPET  565

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIE+K L
Sbjct  566  KGLTLEEIESKLL  578



>ref|XP_006342314.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Solanum tuberosum]
Length=545

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K +MT VAV+  D LG
Sbjct  351  GGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKSLMTAVAVLKADDLG  410

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  411  RRPLLIGGVSGIALSLFLLSAYYKFLGSYPFVAVSALLLYVGCYQISFGPISWLMVSEIF  470

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PE
Sbjct  471  PLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALLSLVFVVTSVPE  530

Query  154  TKGLTLEEIEAKYLT  110
            TKGLTLEEIE+K L 
Sbjct  531  TKGLTLEEIESKILK  545



>gb|KJB20000.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
 gb|KJB20001.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=561

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AV  VD LGR
Sbjct  368  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKLLMTWIAVAKVDDLGR  427

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  428  RPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQISFGPISWLMVSEIFP  487

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PET
Sbjct  488  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALISLLFVALYVPET  547

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  548  KGLSLEEIESKLLK  561



>ref|XP_006401006.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
 gb|ESQ42459.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
Length=558

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT VAV  VD LG
Sbjct  364  GGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVDDLG  423

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  424  RRPLLIGGVSGIALSLFLLSAYYKFLGGYPLVAVGALLLYVGCYQISFGPISWLMVSEIF  483

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PE
Sbjct  484  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVILVVPE  543

Query  154  TKGLTLEEIEAK  119
            TKGL+LEEIE+K
Sbjct  544  TKGLSLEEIESK  555



>ref|XP_011035266.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Populus euphratica]
Length=557

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL MT +AV+ VD LGR
Sbjct  364  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKLAMTWIAVLKVDDLGR  423

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  424  RPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  483

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+G  N+F +FG IA+++++FV  I+PET
Sbjct  484  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGVENLFLLFGAIALLSLLFVVVIVPET  543

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  544  KGLSLEEIESKILK  557



>ref|XP_011035268.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Populus euphratica]
Length=555

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL MT +AV+ VD LGR
Sbjct  362  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKLAMTWIAVLKVDDLGR  421

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  422  RPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  481

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+G  N+F +FG IA+++++FV  I+PET
Sbjct  482  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGVENLFLLFGAIALLSLLFVVVIVPET  541

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  542  KGLSLEEIESKILK  555



>ref|XP_006854111.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
 gb|ERN15578.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
Length=505

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+  QQITGQPSVLYYAA IFQ  GF+AA+DATR SI LG+LKLI TGVAV+VVDR+G
Sbjct  312  AGLVFLQQITGQPSVLYYAATIFQSVGFSAASDATRVSILLGILKLITTGVAVIVVDRVG  371

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI +ALFLL +YYTFL ++P VAV+ALLLYVGCYQLSFGPIGWLMISEIF
Sbjct  372  RRPLLLGGVSGIVIALFLLAAYYTFLSSLPVVAVVALLLYVGCYQLSFGPIGWLMISEIF  431

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RG+GLSIAVLVNF +NALV FAFSP+K L+GAG +F  FGVIA++A++F+FF +PE
Sbjct  432  PLRFRGKGLSIAVLVNFASNALVAFAFSPLKALLGAGLLFAAFGVIAILALLFIFFYVPE  491

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  492  TKGLSLEEIESKIL  505



>ref|XP_004981232.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=563

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA R +I +GL KL+MTGVAV+ VD LGR
Sbjct  370  GLVLFQQITGQPSVLYYAASILQTAGFSAASDAARVAILIGLFKLLMTGVAVLKVDDLGR  429

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  430  RPLLIGGVGGIALSLFLLAAYYKILNNSPFVAVGALLLYVGAYQVSFGPISWLMVSEIFP  489

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+FF+FG IAV++++FV   +PET
Sbjct  490  LRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPENIFFLFGAIAVLSLVFVILNVPET  549

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  550  KGLSLEEIESKIL  562



>ref|XP_009779936.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=552

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K +MT VAV+  D LGR
Sbjct  359  GLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKSLMTAVAVLKADDLGR  418

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  419  RPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  478

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV   +PET
Sbjct  479  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAIALLSLLFVVTSVPET  538

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  539  KGLSLEEIESKIL  551



>gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=552

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K +MT VAV+  D LGR
Sbjct  359  GLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKSLMTAVAVLKADDLGR  418

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  419  RPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  478

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV   +PET
Sbjct  479  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAIALLSLLFVVTSVPET  538

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  539  KGLSLEEIESKIL  551



>ref|XP_009381068.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DA R S+ +GL KL+MTG+AV+ VD LGR
Sbjct  364  GLVLFQQITGQPSVLYYATSILQSAGFSAASDAARVSVVIGLFKLLMTGIAVLKVDNLGR  423

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GI ++LFLL +YY  L ++P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  424  RPLLIGGVGGIVLSLFLLAAYYNVLGSLPLVAVGALLLYVGSYQVSFGPISWLMVSEIFP  483

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+F +FG IA++++ FVFF +PET
Sbjct  484  LRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFLLFGAIALLSLAFVFFYVPET  543

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIEAK L 
Sbjct  544  KGLSLEEIEAKILN  557



>emb|CDY38076.1| BnaC02g06970D [Brassica napus]
Length=502

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVL+NF  NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PET
Sbjct  430  LKLRGRGLSLAVLLNFSANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_004170091.1| PREDICTED: D-xylose-proton symporter-like 2-like, partial [Cucumis 
sativus]
Length=459

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LGLLKLIMTG AV+VVDRLG
Sbjct  309  AGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLGLLKLIMTGAAVLVVDRLG  368

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLLLGGVSGI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+F
Sbjct  369  RRPLLLGGVSGITISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVF  428

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  242
            PLR+RGRGLSIAVLVNFG NALVTFAFSP+K
Sbjct  429  PLRLRGRGLSIAVLVNFGANALVTFAFSPLK  459



>ref|XP_009605730.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=547

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K +MT VAV+  D LGR
Sbjct  354  GLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGVFKSLMTAVAVLKADDLGR  413

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  414  RPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  473

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV   +PET
Sbjct  474  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAIALLSLLFVITSVPET  533

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  534  KGLSLEEIESKIL  546



>gb|KDP42213.1| hypothetical protein JCGZ_02943 [Jatropha curcas]
Length=559

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR S+ +GL KL+MT +AV+ VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGPILQSAGFSAATDATRVSVIIGLFKLVMTWIAVLKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  L   P VAV+ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVGGIALSLFLLSAYYKVLGGFPFVAVVALLLYVGSYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++F  F +PET
Sbjct  486  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFVLFGAIALLSLLFTIFFVPET  545

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K+L
Sbjct  546  KGLSLEEIESKFL  558



>ref|XP_010043498.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW85511.1| hypothetical protein EUGRSUZ_B02309 [Eucalyptus grandis]
Length=570

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT VAV+ VD LGR
Sbjct  377  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKLLMTSVAVLKVDDLGR  436

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV+GI ++L  L SYY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  437  RPLLIGGVAGIVISLLFLSSYYKFLGEFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  496

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+ EL+GA NVF +FGVIA+++++FV  ++PET
Sbjct  497  LRTRGRGISLAVLTNFGSNAIVTFAFSPLTELLGAENVFLLFGVIALLSLLFVVLLVPET  556

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  557  KGLSLEEIESKILK  570



>ref|XP_010087486.1| D-xylose-proton symporter-like 2 [Morus notabilis]
 gb|EXB29167.1| D-xylose-proton symporter-like 2 [Morus notabilis]
Length=518

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA+ IFQ AGF+AA+DATR SI LGLLKLIMTG AV++VDRLGR
Sbjct  326  GLVLFQQITGQPSVLYYASSIFQTAGFSAASDATRVSILLGLLKLIMTGAAVLLVDRLGR  385

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ ++LFLLGSYY FL NV  VAV+ALLLYVGCYQLSFGPIGWLMISE+FP
Sbjct  386  RPLLLGGVSGMVISLFLLGSYYLFLGNVWVVAVVALLLYVGCYQLSFGPIGWLMISEVFP  445

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGLSIAVLVNFG NALVTFAFSP++ L+GAG +F++FGVIAVV++ F+FF++PET
Sbjct  446  LRLRGRGLSIAVLVNFGANALVTFAFSPLEALLGAGILFYVFGVIAVVSLGFIFFVVPET  505

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEA  L
Sbjct  506  KGLTLEEIEANCL  518



>dbj|BAJ95036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF AA+DA + SI +GL K +MTGVAV+ VD LGR
Sbjct  327  GLVLFQQITGQPSVLYYATSILQTAGFTAASDAAKVSILIGLFKFVMTGVAVLKVDDLGR  386

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPL++GGVSGI VALFLL +YY  L   P VAV ALLLYVGCYQLSFGPI WLM+SEIFP
Sbjct  387  RPLMIGGVSGITVALFLLAAYYKALSGFPFVAVGALLLYVGCYQLSFGPISWLMVSEIFP  446

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG G+S+AVL NFG+NALVTFAFSP++  +G  NVF +F  I+++A++FV   +PET
Sbjct  447  LRTRGCGISLAVLTNFGSNALVTFAFSPLQGYLGPANVFLLFAAISLLALLFVILNVPET  506

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  507  KGLSLEEIESKIL  519



>ref|XP_002520519.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41932.1| sugar transporter, putative [Ricinus communis]
Length=505

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AV+ VD LGR
Sbjct  312  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVIIGLFKLVMTWIAVLKVDDLGR  371

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY  L   P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  372  RPLLIGGVGGIALSLFLLSAYYKVLGGFPVVAVAALLLYVGSYQISFGPISWLMVSEIFP  431

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA++A++F    +PET
Sbjct  432  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLALLFAIVYVPET  491

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  492  KGLSLEEIESKILK  505



>ref|XP_008777375.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008777383.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
Length=564

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA R S+ +G+ KL+MTG+AV+ VD LGR
Sbjct  371  GLVLFQQITGQPSVLYYAASILQSAGFSAASDAARVSVVIGIFKLLMTGIAVLKVDNLGR  430

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI ++LFLL +YY FL   P VAV ALLLYVG YQ+SFGPI WL++SEIFP
Sbjct  431  RPLLIGGVSGIVLSLFLLAAYYKFLGGFPLVAVGALLLYVGSYQVSFGPISWLVVSEIFP  490

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA VTFAFSP+KEL+G  N+F IFG +A+++++FV F +PET
Sbjct  491  LRTRGRGISLAVLTNFGSNAFVTFAFSPLKELLGPDNLFLIFGAVALLSLLFVLFYVPET  550

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIEAK L 
Sbjct  551  KGLSLEEIEAKILK  564



>emb|CDP09100.1| unnamed protein product [Coffea canephora]
Length=567

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAA+DATR S+ +G  KL+MTG+AV+ VD LGR
Sbjct  374  GLVLFQQITGQPSVLYYAGPILQTAGFAAASDATRLSVVIGTFKLVMTGIAVLKVDDLGR  433

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY FL   P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  434  RPLLIGGVGGIALSLLLLWAYYKFLGGYPLVAVAALLLYVGSYQVSFGPISWLMVSEIFP  493

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++F    +PET
Sbjct  494  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAANLFLLFGAIALLSLVFAVVYVPET  553

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  554  KGLSLEEIESKIL  566



>ref|XP_010907806.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
 ref|XP_010907807.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
Length=564

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA R S+ +G+ KL+MTG+AV+ VD LGR
Sbjct  371  GLVLFQQITGQPSVLYYAASILQSAGFSAASDAARVSVVIGIFKLLMTGIAVLKVDNLGR  430

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GI ++LFLL +YY  L   P VAV ALLLYVG YQ+SFGPI WL++SEIFP
Sbjct  431  RPLLIGGVVGIVLSLFLLAAYYKILGGFPLVAVGALLLYVGSYQVSFGPISWLVVSEIFP  490

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+F +FG IA+++++F+ F +PET
Sbjct  491  LRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPDNLFLLFGAIALLSLLFILFYVPET  550

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIEAK L 
Sbjct  551  KGLSLEEIEAKILK  564



>ref|XP_006297488.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
 gb|EOA30386.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
Length=502

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG+LKL+MTGV+V+V+DRLGR
Sbjct  310  GLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGVLKLVMTGVSVIVIDRLGR  369

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ V+LFLLGSYY F +  P VAV ALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  370  RPLLLGGVSGMVVSLFLLGSYYIFYNTAPAVAVAALLLYVGCYQLSFGPIGWLMISEIFP  429

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI ++++ F++FI+PET
Sbjct  430  LKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICLLSLFFIYFIVPET  489

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  490  KGLTLEEIEAKCL  502



>ref|XP_003563522.2| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brachypodium 
distachyon]
Length=568

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DA + SI +GL K +MTGVAV  VD LGR
Sbjct  375  GLVLFQQITGQPSVLYYATSILQTAGFSAASDAAKVSILIGLFKFVMTGVAVFKVDDLGR  434

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI VALFLL +YY  L   P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  435  RPLLIGGVSGITVALFLLAAYYKILSGFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFP  494

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NALVTFAFSP++  +G  N+F +FG I+++A++FV   +PET
Sbjct  495  LRTRGRGISLAVLTNFGSNALVTFAFSPLQGYLGPANIFLLFGAISLLALVFVILNVPET  554

Query  151  KGLTLEEIEAKYL  113
            KGL+LE+IE+K L
Sbjct  555  KGLSLEDIESKIL  567



>ref|XP_007132040.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
 gb|ESW04034.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
Length=558

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+LFQQITGQPSVLYYA +I Q AGF+AA+DAT+ S+ +G  KL+MT VAV+ VD LG
Sbjct  364  GGLVLFQQITGQPSVLYYAGQILQSAGFSAASDATKVSVVIGFFKLLMTWVAVLKVDDLG  423

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  424  RRPLLIGGVSGIALSLVLLSAYYKFLGGFPFVAVGALLLYVGCYQISFGPISWLMVSEIF  483

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            P+R RG+G+S+AVL NF +NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV F +PE
Sbjct  484  PIRTRGKGISLAVLTNFASNAVVTFAFSPLKELLGAENLFLLFGAIAILSLLFVIFSVPE  543

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LE+IE+K L
Sbjct  544  TKGLSLEDIESKIL  557



>gb|AFK37407.1| unknown [Lotus japonicus]
Length=563

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL MT VAV+ VD LGR
Sbjct  370  GLVLFQQITGQPSVLYYAGSILQSAGFSAASDATKVSVVIGLFKLQMTWVAVLKVDDLGR  429

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSGI ++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE FP
Sbjct  430  RPLLIAGVSGIGLSLGLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSETFP  489

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            +R RGRG+S+AVL NF +NA+VTFAFSP+KEL+GA N+F +FG I++VA++FV F +PET
Sbjct  490  IRTRGRGISLAVLTNFASNAVVTFAFSPLKELLGAENLFLLFGAISLVALLFVIFSVPET  549

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  550  KGLSLEEIESKIL  562



>ref|XP_006846330.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
 gb|ERN08005.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
Length=570

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQITGQPSVLYYAA I Q    AA+  A   ++ +G+ KL+MTG+AV  VD LGR
Sbjct  378  GLVFFQQITGQPSVLYYAATILQCRISAASDAARV-AVIIGIFKLLMTGIAVAKVDSLGR  436

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI  +LFLL +YY  L   P  AV+ALLLYV CYQ+SFGPI WLM+SEIFP
Sbjct  437  RPLLIGGVSGIVFSLFLLAAYYKILQGFPVAAVVALLLYVSCYQISFGPISWLMVSEIFP  496

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L  RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV F +PET
Sbjct  497  LHTRGRGISLAVLANFGSNAIVTFAFSPLKELLGAANLFALFGGIAMLSLLFVIFYVPET  556

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  557  KGLSLEEIESKVL  569



>gb|KHN21925.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=552

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL+MT +AV+ VD LGR
Sbjct  359  GLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKLLMTWIAVLKVDDLGR  418

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FP
Sbjct  419  RPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFP  478

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA+++++F+ F +PET
Sbjct  479  LRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIAILSLLFIIFSVPET  538

Query  151  KGLTLEEIEAKYL  113
            KGL+LE+IE+K L
Sbjct  539  KGLSLEDIESKIL  551



>ref|XP_003537973.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Glycine max]
Length=552

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL+MT +AV+ VD LGR
Sbjct  359  GLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKLLMTWIAVLKVDDLGR  418

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FP
Sbjct  419  RPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFP  478

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA+++++F+ F +PET
Sbjct  479  LRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIAILSLLFIIFSVPET  538

Query  151  KGLTLEEIEAKYL  113
            KGL+LE+IE+K L
Sbjct  539  KGLSLEDIESKIL  551



>ref|XP_003539594.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006592182.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=560

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL+MT +AV+ VD LGR
Sbjct  367  GLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKLLMTWIAVLKVDDLGR  426

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FP
Sbjct  427  RPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFP  486

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA ++++F+ F +PET
Sbjct  487  LRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIATLSLLFIIFSVPET  546

Query  151  KGLTLEEIEAKYL  113
            KG++LE+IE+K L
Sbjct  547  KGMSLEDIESKIL  559



>gb|KHN32151.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=560

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL+MT +AV+ VD LGR
Sbjct  367  GLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKLLMTWIAVLKVDDLGR  426

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FP
Sbjct  427  RPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFP  486

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA ++++F+ F +PET
Sbjct  487  LRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIATLSLLFIIFSVPET  546

Query  151  KGLTLEEIEAKYL  113
            KG++LE+IE+K L
Sbjct  547  KGMSLEDIESKIL  559



>ref|XP_010063233.1| PREDICTED: D-xylose-proton symporter-like 2 [Eucalyptus grandis]
 gb|KCW90943.1| hypothetical protein EUGRSUZ_A02968 [Eucalyptus grandis]
Length=503

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            G++LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGLLKLIMTGVAV+VVDR+GR
Sbjct  311  GVVLFQQITGQPSVLYYAATILQSAGFSAASDATRVSILLGLLKLIMTGVAVLVVDRVGR  370

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSG+ V+L LLGSYY FLD+VP  AV+ LLLYVGCYQ+SFGPIGWL+ISEIFP
Sbjct  371  RPLLLGGVSGMFVSLLLLGSYYLFLDDVPAAAVVGLLLYVGCYQVSFGPIGWLLISEIFP  430

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+RGRGLS+AVLVNFG NALVT AFSP+ +L+G+G +F+ FGVI +VA++F+FFI+PET
Sbjct  431  LRLRGRGLSMAVLVNFGANALVTLAFSPLVDLLGSGLLFYGFGVITLVALLFIFFIVPET  490

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  491  KGLTLEEIEAKCL  503



>ref|XP_011089518.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Sesamum 
indicum]
Length=558

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADAT+ S+ +G+ KL+MTGVAV+ VD LGR
Sbjct  365  GLVLFQQITGQPSVLYYAGPILQTAGFSAAADATKLSVVVGVFKLLMTGVAVLKVDDLGR  424

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV+G+A +L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  425  RPLLIGGVAGLAFSLLLLSAYYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  484

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IAV++++FV   +PET
Sbjct  485  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIAVLSLVFVVTSVPET  544

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  545  KGLSLEEIESKIL  557



>ref|XP_004294661.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADAT+ S+ +GL K +MTGVAV+ VD LGR
Sbjct  365  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATKVSVIIGLFKFVMTGVAVLKVDDLGR  424

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +YY FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  425  RPLLILGVSGLALSLFLLSAYYKFLGGFPLVAVASLLLYVGCYQISFGPISWLMVSEIFP  484

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NALVTFAFSP+KE +GA N+F +FG IA+++++FV  I+PET
Sbjct  485  LRTRGKGISLAVLTNFGSNALVTFAFSPLKEALGADNLFLLFGAIALISLLFVVLIVPET  544

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  545  KGLSLEEIESKLL  557



>ref|XP_010492634.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=147

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  481  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  302
            + V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRGLS+
Sbjct  25   MVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGLSL  84

Query  301  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  122
            AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V+++ F+FFI+PETKGL+LEEIEA
Sbjct  85   AVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLFFIFFIVPETKGLSLEEIEA  144

Query  121  KYL  113
            K L
Sbjct  145  KCL  147



>emb|CAN72732.1| hypothetical protein VITISV_037854 [Vitis vinifera]
Length=458

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 156/193 (81%), Gaps = 11/193 (6%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I +D+              +GLLKLIMT VAV+VVD++GR
Sbjct  277  GLVLFQQITGQPSVLYYAASILEDSQEHLMQHVY--RYLVGLLKLIMTAVAVLVVDKVGR  334

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGVSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFP
Sbjct  335  RPLLLGGVSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFP  394

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LRVRGRGLSIAVLVNFG NA+          L+GAG +F+ FGVIAV++++F+FF IPET
Sbjct  395  LRVRGRGLSIAVLVNFGANAIA---------LLGAGVLFYGFGVIAVLSLLFIFFFIPET  445

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIEAK L
Sbjct  446  KGLSLEEIEAKLL  458



>gb|EYU45952.1| hypothetical protein MIMGU_mgv1a003885mg [Erythranthe guttata]
Length=558

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGFAAAADAT+ S+ +G+ KL+MTGVAV+ VD LGR
Sbjct  365  GLVLFQQITGQPSVLYYAGPILQSAGFAAAADATKLSVVIGVFKLLMTGVAVLKVDDLGR  424

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV G+A +L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  425  RPLLIGGVGGLAFSLLLLSAYYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  484

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S++VL NFG+NALVTFAF P+KEL+GA N+F +FG IA++A++FV  I+PET
Sbjct  485  LRTRGKGISLSVLTNFGSNALVTFAFFPLKELLGADNLFLLFGAIALLALVFVVLIVPET  544

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIE+K L
Sbjct  545  KGLTLEEIESKIL  557



>gb|EPS59382.1| hypothetical protein M569_15426, partial [Genlisea aurea]
Length=411

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYAA I Q AGF+AAADAT+ S+ +G+ KLIMTG+AV+ VD LGR
Sbjct  218  GLVLFQQITGQPSVLYYAAPILQTAGFSAAADATKLSVVVGVFKLIMTGIAVLKVDDLGR  277

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A +L LL +YY FL   P VAV ALLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  278  RPLLIIGVSGLAFSLLLLSAYYKFLGAFPFVAVAALLLYVGSYQISFGPISWLMVSEIFP  337

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTF+FSP+KEL+GA N+F +FG I++++++FV   +PET
Sbjct  338  LRTRGKGISLAVLTNFASNAVVTFSFSPLKELLGAENLFLLFGGISLLSLVFVVLFVPET  397

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K+L
Sbjct  398  KGLSLEEIESKFL  410



>ref|XP_004983521.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2-like [Setaria italica]
Length=515

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 165/192 (86%), Gaps = 2/192 (1%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLG
Sbjct  325  CGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLG  384

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGVSGI   LFLL S     ++   VAV ALLLYVGCYQLSFGPIGWLMISE+F
Sbjct  385  RRPLLIGGVSGITF-LFLL-SLLHITEDASYVAVXALLLYVGCYQLSFGPIGWLMISEVF  442

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV +++F+F+IIPE
Sbjct  443  PLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGLLFCGFGVIAVASLVFIFWIIPE  502

Query  154  TKGLTLEEIEAK  119
            TKGLTLEEIEA 
Sbjct  503  TKGLTLEEIEAS  514



>ref|XP_008384924.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K +MTGVAV+ VD LGR
Sbjct  370  GLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKFLMTGVAVLKVDDLGR  429

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  430  RPLLIVGVSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQISFGPISWLMVSEIFP  489

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA++++IFV  I+PET
Sbjct  490  LRTRGKGISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAIALLSLIFVVLIVPET  549

Query  151  KGLTLEEIEAK  119
            KGLTLEEIE+K
Sbjct  550  KGLTLEEIESK  560



>ref|XP_008349595.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K +MTGVAV+ VD LGR
Sbjct  370  GLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKFLMTGVAVLKVDDLGR  429

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  430  RPLLIVGVSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQISFGPISWLMVSEIFP  489

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA++++IFV  I+PET
Sbjct  490  LRTRGKGISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAIALLSLIFVVLIVPET  549

Query  151  KGLTLEEIEAK  119
            KGLTLEEIE+K
Sbjct  550  KGLTLEEIESK  560



>ref|XP_006424896.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38136.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=443

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  250  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  309

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  310  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  369

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  370  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  429

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  430  KGLSLEEIESKILK  443



>gb|KDO66622.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=436

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  243  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  302

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  303  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  362

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  363  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  422

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  423  KGLSLEEIESKIL  435



>ref|XP_009375941.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Pyrus 
x bretschneideri]
Length=563

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K +MTGVAV+ VD LGR
Sbjct  370  GLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKFLMTGVAVLKVDDLGR  429

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  430  RPLLIVGVSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQISFGPISWLMVSEIFP  489

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA++++IFV  I+PET
Sbjct  490  LRTRGKGISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAIALLSLIFVVLIVPET  549

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE+K
Sbjct  550  KGLSLEEIESK  560



>ref|XP_002982112.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
 gb|EFJ16780.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
Length=470

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQ+TGQPSVLYYAA I Q AGFAAA DATR S+ LG+ KLIMTGVAV  VD+LGR
Sbjct  274  GLVFFQQVTGQPSVLYYAATILQSAGFAAATDATRVSVLLGVFKLIMTGVAVFNVDKLGR  333

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI V+LF+L S++ F   +  +AVIALLLYVGCYQ+SFGPI WLMISEIFP
Sbjct  334  RPLLIGGVSGIVVSLFMLASFFVFGKGLSFLAVIALLLYVGCYQISFGPISWLMISEIFP  393

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGR LSI+ LVNF  NALV  A+SP++EL+GA   F  FGVI +VA++F+   +PET
Sbjct  394  LRTRGRALSISTLVNFAANALVALAYSPLQELLGAPLTFVGFGVIGIVALVFIVSTVPET  453

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE +
Sbjct  454  KGLSLEEIEQQ  464



>gb|KDO66620.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
 gb|KDO66621.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=443

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  250  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  309

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  310  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  369

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  370  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  429

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  430  KGLSLEEIESKIL  442



>ref|XP_008222111.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Prunus mume]
Length=521

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K +MTG+AV+ VD LGR
Sbjct  328  GLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKFVMTGIAVLKVDDLGR  387

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  388  RPLLIVGVSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQISFGPISWLMVSEIFP  447

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVIA+++++FV  ++PET
Sbjct  448  LRTRGKGISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVIALLSLLFVVLLVPET  507

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE+K
Sbjct  508  KGLSLEEIESK  518



>ref|XP_010535453.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=531

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AV  VD +GR
Sbjct  364  GLVLFQQITGQPSVLYYAGSILQSAGFSAAADATRVSVIVGLFKLLMTWIAVAKVDDIGR  423

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  424  RPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  483

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGN  221
            LR RG+G+S+AVL NFG+NA VTFAFSP+KEL+GA N
Sbjct  484  LRTRGKGISLAVLTNFGSNAAVTFAFSPLKELLGAEN  520



>ref|XP_008222102.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Prunus mume]
Length=562

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K +MTG+AV+ VD LGR
Sbjct  369  GLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKFVMTGIAVLKVDDLGR  428

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  429  RPLLIVGVSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQISFGPISWLMVSEIFP  488

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVIA+++++FV  ++PET
Sbjct  489  LRTRGKGISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVIALLSLLFVVLLVPET  548

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE+K
Sbjct  549  KGLSLEEIESK  559



>gb|EPS60345.1| hypothetical protein M569_14457, partial [Genlisea aurea]
Length=153

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  574  LGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLY  395
            L  ++L++TGVAV+ VDRLGRRPLLLGGVSGI V+LFLLGSYY F D  P +AV ALL+Y
Sbjct  2    LCCVQLVLTGVAVLFVDRLGRRPLLLGGVSGIVVSLFLLGSYYAFFDQAPGLAVFALLVY  61

Query  394  VGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvf  215
            VG YQ+SFGPIGWLMISEIFPL +RGRGLSI VLVNFG NA+VT AFSP++ELVGAG VF
Sbjct  62   VGSYQVSFGPIGWLMISEIFPLCLRGRGLSIVVLVNFGANAVVTLAFSPLQELVGAGAVF  121

Query  214  fifgviavvavifvffiIPETKGLTLEEIEAK  119
            F FGV+AV+++ F+F ++PETKGLTLEEIEAK
Sbjct  122  FAFGVVAVLSLAFIFSVVPETKGLTLEEIEAK  153



>ref|XP_002992213.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
 gb|EFJ06710.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
Length=470

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQ+TGQPSVLYYAA I Q AGFAAA DATR S+ LG+ KL+MTGVAV  VD+LGR
Sbjct  274  GLVFFQQVTGQPSVLYYAATILQSAGFAAATDATRVSVLLGVFKLVMTGVAVFNVDKLGR  333

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI V+LF+L +++ F   +  +AVIALLLYVGCYQ+SFGPI WLMISEIFP
Sbjct  334  RPLLIGGVSGIVVSLFMLAAFFVFGKGLSFLAVIALLLYVGCYQISFGPISWLMISEIFP  393

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGR LSI+ LVNF  NALV  A+SP++EL+GA   F  FGVI +VA++F+   +PET
Sbjct  394  LRTRGRALSISTLVNFAANALVALAYSPLQELLGAPLTFVGFGVIGIVALVFIVSTVPET  453

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE +
Sbjct  454  KGLSLEEIEQQ  464



>ref|XP_007207311.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
 gb|EMJ08510.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
Length=562

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K +MTG+AV+ VD LGR
Sbjct  369  GLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKFVMTGIAVLKVDELGR  428

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+ GVSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  429  RPLLIVGVSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQVSFGPISWLMVSEIFP  488

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVIA+++++FV  ++PET
Sbjct  489  LRTRGKGISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVIALLSLLFVVLLVPET  548

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE+K
Sbjct  549  KGLSLEEIESK  559



>ref|XP_006488378.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=559

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  486  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  545

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  546  KGLSLEEIESKIL  558



>ref|XP_006424897.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38137.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=553

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  360  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  419

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  420  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  479

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  480  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  539

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  540  KGLSLEEIESKIL  552



>gb|KDO66619.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  486  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  545

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  546  KGLSLEEIESKIL  558



>gb|KDO66618.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=553

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  360  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  419

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  420  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  479

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  480  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  539

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  540  KGLSLEEIESKIL  552



>ref|XP_006488379.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=553

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  360  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  419

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  420  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  479

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PET
Sbjct  480  LRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPET  539

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  540  KGLSLEEIESKIL  552



>gb|KHG28803.1| hypothetical protein F383_00413 [Gossypium arboreum]
Length=559

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AV  VD LGR
Sbjct  368  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKLLMTWIAVAKVDDLGR  427

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY FL   P VAV ALLLY+     SFGPI WLM+SEIFP
Sbjct  428  RPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYI-----SFGPISWLMVSEIFP  482

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PET
Sbjct  483  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGIALISLLFVALYVPET  542

Query  151  KGLTLEEIEAKYLT  110
            KGL+LEEIE+K L 
Sbjct  543  KGLSLEEIESKILK  556



>ref|XP_008457451.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Cucumis 
melo]
Length=585

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q+AGFAAA DATR S+ +G+ KL+MT VAV+ VD LGR
Sbjct  392  GLVLFQQITGQPSVLYYAGPILQNAGFAAATDATRVSVVIGVFKLLMTWVAVLKVDDLGR  451

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  452  RPLLIGGVSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGCYQISFGPISWLMVSEIFP  511

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PET
Sbjct  512  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVLQVPET  571

Query  151  KGLTLEEIEAKYL  113
            KGL+LE+IE+K L
Sbjct  572  KGLSLEDIESKIL  584



>ref|XP_004145283.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004153144.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65747.1| hypothetical protein Csa_1G524690 [Cucumis sativus]
Length=585

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q+AGFAAA DATR S+ +G+ KL+MT VAV+ VD LGR
Sbjct  392  GLVLFQQITGQPSVLYYAGPILQNAGFAAATDATRVSVVIGVFKLLMTWVAVLKVDDLGR  451

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  452  RPLLIGGVSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGCYQISFGPISWLMVSEIFP  511

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PET
Sbjct  512  LRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVLKVPET  571

Query  151  KGLTLEEIEAKYL  113
            KGL+LE+IE+K L
Sbjct  572  KGLSLEDIESKIL  584



>emb|CBI16087.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
             GL+L QQITGQPSVLY+A  I Q AGF+AA+DATR S+ +G  KL+MTG+AV+ VD +G
Sbjct  313  GGLVLSQQITGQPSVLYFAGSILQTAGFSAASDATRVSVLIGFFKLLMTGIAVLKVDDIG  372

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            RRPLL+GGV G+A++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIF
Sbjct  373  RRPLLIGGVGGLALSLLLLSAYYKFLGGFPVVAVAALLLYVGCYQISFGPISWLMVSEIF  432

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR RGRG+S+AVL NFG+NA+VTFAFSP++EL+GA N+F +FG+IA+++++FV   +PE
Sbjct  433  PLRTRGRGISLAVLTNFGSNAIVTFAFSPLEELLGAENLFLLFGIIALLSLLFVIVYVPE  492

Query  154  TKGLTLEEIEAKYL  113
            TKGL+LEEIE+K L
Sbjct  493  TKGLSLEEIESKIL  506



>ref|XP_002280634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Vitis 
vinifera]
 gb|ADP37178.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=561

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLY+A  I Q AGF+AA+DATR S+ +G  KL+MTG+AV+ VD +GR
Sbjct  368  GLVLSQQITGQPSVLYFAGSILQTAGFSAASDATRVSVLIGFFKLLMTGIAVLKVDDIGR  427

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV G+A++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  428  RPLLIGGVGGLALSLLLLSAYYKFLGGFPVVAVAALLLYVGCYQISFGPISWLMVSEIFP  487

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP++EL+GA N+F +FG+IA+++++FV   +PET
Sbjct  488  LRTRGRGISLAVLTNFGSNAIVTFAFSPLEELLGAENLFLLFGIIALLSLLFVIVYVPET  547

Query  151  KGLTLEEIEAKYL  113
            KGL+LEEIE+K L
Sbjct  548  KGLSLEEIESKIL  560



>ref|NP_001141928.1| uncharacterized protein LOC100274077 [Zea mays]
 gb|ACF87321.1| unknown [Zea mays]
Length=148

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  481  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  302
            IA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG+S+
Sbjct  25   IALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRGISL  84

Query  301  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  122
            AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PETKGL+LEEIE+
Sbjct  85   AVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEEIES  144

Query  121  KYL  113
            K L
Sbjct  145  KIL  147



>ref|XP_001773171.1| predicted protein [Physcomitrella patens]
 gb|EDQ62024.1| predicted protein, partial [Physcomitrella patens]
Length=464

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQ TGQPSVLYYAA I Q AGF+ A+DAT+ ++ LG+ KLIMT +AV+ VD+LGR
Sbjct  273  GLVFFQQFTGQPSVLYYAATILQTAGFSVASDATKLAVLLGIFKLIMTALAVLNVDKLGR  332

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV+GI ++L  L +Y++FL + P +AV +LLLYVGCYQ+SFGPI WL++SE+FP
Sbjct  333  RPLLLGGVTGITLSLVTLAAYFSFLKDYPYLAVGSLLLYVGCYQISFGPISWLVVSEVFP  392

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGR LS+  L+NFG+NA+V  AF+P+++LVG    F IFG++++ A++F+F  +PET
Sbjct  393  LRTRGRALSMTTLINFGSNAVVALAFAPLQDLVGESYTFVIFGIVSLFALVFIFTSVPET  452

Query  151  KGLTLEEIEAK  119
            KGLTLE+I AK
Sbjct  453  KGLTLEQITAK  463



>ref|XP_007016337.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY33956.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=493

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL+MT +AVV VD LGR
Sbjct  344  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVLVGLFKLLMTWIAVVKVDDLGR  403

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  404  RPLLIGGVGGIALSLFLLSAYYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFP  463

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMK  242
            LR RG+G+S+AVL NFG+NA+VTFAFSP+K
Sbjct  464  LRTRGKGISLAVLTNFGSNAIVTFAFSPLK  493



>ref|XP_002991559.1| hypothetical protein SELMODRAFT_133784, partial [Selaginella 
moellendorffii]
 gb|EFJ07313.1| hypothetical protein SELMODRAFT_133784, partial [Selaginella 
moellendorffii]
Length=378

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 151/191 (79%), Gaps = 3/191 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQ+TG   VLYYAA I Q AGFA A DATR S+ LG+ KLIMTGVAV  VD+LGR
Sbjct  185  GLVFFQQVTG---VLYYAATILQSAGFAVATDATRVSVLLGVFKLIMTGVAVFNVDKLGR  241

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGVSGI V+LF+L +++ F   +  +AVIALLLYVGCYQ+SFGPI WLMISEIFP
Sbjct  242  RPLLIGGVSGIVVSLFMLAAFFVFGKGLSFLAVIALLLYVGCYQISFGPISWLMISEIFP  301

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGR LSI+ LVNF  NALV  A+SP++EL+GA   F  FGVI +VA++F+   +PET
Sbjct  302  LRTRGRALSISTLVNFAANALVALAYSPLQELLGAPLTFVGFGVIGIVALVFIVSTVPET  361

Query  151  KGLTLEEIEAK  119
            KGL+LEEIE +
Sbjct  362  KGLSLEEIEQQ  372



>ref|XP_001760396.1| predicted protein [Physcomitrella patens]
 gb|EDQ74787.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQ TGQPSVLYYAA I Q AGFAAA+DATR ++ LG  KLIMT VAV+ VD+LGR
Sbjct  390  GLVAFQQFTGQPSVLYYAAPILQSAGFAAASDATRLAVLLGFFKLIMTAVAVLNVDKLGR  449

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLLLGGV+GI ++L  L +Y++FL + P +AV +LLLYVG YQ+SFGPI WLM+SEIFP
Sbjct  450  RPLLLGGVAGITISLATLAAYFSFLQDYPYLAVGSLLLYVGSYQISFGPISWLMVSEIFP  509

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGR L +  LVNFG+NALV  AF+P+++LVG    F IFG+I  +A+ F++  +PET
Sbjct  510  LRTRGRALGVTTLVNFGSNALVALAFAPLQDLVGESYTFVIFGIIGTLALTFIYTSVPET  569

Query  151  KGLTLEEIEAK  119
            KGL+LE+I AK
Sbjct  570  KGLSLEQISAK  580



>emb|CAN83894.1| hypothetical protein VITISV_039113 [Vitis vinifera]
Length=606

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+L QQITGQPSVLY+A  I Q AGF+AA+DATR S+ +G  KL+MTG+AV+ VD +GR
Sbjct  384  GLVLSQQITGQPSVLYFAGSILQTAGFSAASDATRVSVLIGFFKLLMTGIAVLKVDDIGR  443

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV G+A++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  444  RPLLIGGVGGLALSLLLLSAYYKFLGGFPVVAVAALLLYVGCYQISFGPISWLMVSEIFP  503

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR RGRG+S+AVL NFG+NA+VTFAFSP++EL+GA N+F +FG+IA+++++FV   +PET
Sbjct  504  LRTRGRGISLAVLTNFGSNAIVTFAFSPLEELLGAENLFLLFGIIALLSLLFVIVYVPET  563

Query  151  KGLTL  137
            KG+ +
Sbjct  564  KGIAI  568



>ref|XP_004173923.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like, 
partial [Cucumis sativus]
Length=171

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  583  SIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIAL  404
            S+ +G+ KL+MT VAV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV AL
Sbjct  14   SVVIGVFKLLMTWVAVLKVDDLGRRPLLIGGVSGIALSLLLLSAYYKFLGGFPIVAVGAL  73

Query  403  LLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAG  224
            LLYVGCYQ+SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA 
Sbjct  74   LLYVGCYQISFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAE  133

Query  223  NvffifgviavvavifvffiIPETKGLTLEEIEAKYL  113
            N+F +FG IA+++++FV   +PETKGL+LE+IE+K L
Sbjct  134  NLFLLFGAIALLSLLFVVLKVPETKGLSLEDIESKIL  170



>ref|NP_001190323.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92372.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=470

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 135/193 (70%), Gaps = 33/193 (17%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGLLKLIMTGVA         
Sbjct  311  GLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGVA---------  361

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
                        V +  LG          P+ +  +   +     SFGPIGWLMISEIFP
Sbjct  362  -----------VVVIDRLGRR--------PLLLGGVGGML-----SFGPIGWLMISEIFP  397

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            L++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PET
Sbjct  398  LKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFIFFIVPET  457

Query  151  KGLTLEEIEAKYL  113
            KGLTLEEIEAK L
Sbjct  458  KGLTLEEIEAKCL  470



>ref|XP_010933397.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Elaeis 
guineensis]
Length=468

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 135/194 (70%), Gaps = 33/194 (17%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DATR S+ LGLLKL+MTG+AV+V     
Sbjct  308  AGLVFFQQVTGQPSVLYYAATILQTAGFSAASDATRVSVLLGLLKLVMTGIAVLV-----  362

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
                                        V  V    LL+      LSFGPIGWLMISE+F
Sbjct  363  ----------------------------VDRVGRRPLLIGGVSGILSFGPIGWLMISEVF  394

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PLR+RGRGLSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIAV +++F+FF++PE
Sbjct  395  PLRLRGRGLSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGVIAVASLLFIFFVVPE  454

Query  154  TKGLTLEEIEAKYL  113
            TKGLTLEEIEAK L
Sbjct  455  TKGLTLEEIEAKIL  468



>ref|XP_006424895.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38135.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=534

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMK  242
            LR RGRG+S+AVL NFG+NA+VTFAFSP+K
Sbjct  486  LRTRGRGISLAVLTNFGSNAIVTFAFSPLK  515



>gb|KDO66623.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL+MT +AV  VD LGR
Sbjct  366  GLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGR  425

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            RPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP
Sbjct  426  RPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFP  485

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMK  242
            LR RGRG+S+AVL NFG+NA+VTFAFSP+K
Sbjct  486  LRTRGRGISLAVLTNFGSNAIVTFAFSPLK  515



>ref|XP_005845570.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
 gb|EFN53468.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
Length=502

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 137/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L+LFQQITGQPSVLYYAAKIFQ AGFA A +AT  S+ LG  KLIMTG+AV  VD  GRR
Sbjct  310  LMLFQQITGQPSVLYYAAKIFQAAGFAGAEEATGVSLVLGFFKLIMTGIAVATVDSWGRR  369

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
            PLLL GVSGI ++L  LG+     D V    ++ALLLYVGCYQLSFGPI WL+  E+FPL
Sbjct  370  PLLLYGVSGIVLSLLALGTAQVARDMVAWTNLVALLLYVGCYQLSFGPISWLLCGEVFPL  429

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            +VRG+ +++A L NFG+N LV+ A   + E  G    +F F  I V AV+ +  I+PETK
Sbjct  430  KVRGQAIALATLTNFGSNFLVSLALPTITESFGPAATYFTFAAIGVGAVVTIHAIVPETK  489

Query  148  GLTLEEIEAKY  116
            G TLEEIEA +
Sbjct  490  GKTLEEIEALW  500



>ref|XP_011400947.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27940.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
Length=529

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQ+TGQPSVLYYAA IFQ AGF ++  AT  S+ LGL KL+MTGVAV  VDRLG
Sbjct  323  AGLMLFQQVTGQPSVLYYAASIFQAAGFQSSGQATGVSLGLGLFKLVMTGVAVATVDRLG  382

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPIGWLM  350
            RRPLLL GVSG+  AL  L         + P       + ALL+YVGCYQ+SFGPI WL+
Sbjct  383  RRPLLLWGVSGLVGALLCLALASGGALPIDPGLVAWTNLAALLVYVGCYQVSFGPISWLI  442

Query  349  ISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvf  170
            +SEIFPL+VRG+ +++A L NF +N  V+ A   ++E +G    + +F V+ V +++ ++
Sbjct  443  VSEIFPLKVRGQAMALATLTNFSSNFAVSLALPSVRESIGPSATYLVFAVVGVASLVTIY  502

Query  169  fiIPETKGLTLEEIEAKYL  113
             I+PETKG TLEEIEA ++
Sbjct  503  NIVPETKGKTLEEIEALWM  521



>ref|XP_005645204.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20660.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
Length=564

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 129/191 (68%), Gaps = 7/191 (4%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L+LFQQITGQPSVLYYAA+IF+ AGF A  DAT  S+ LGL KL+MTGVAV+ VD +GRR
Sbjct  372  LMLFQQITGQPSVLYYAAEIFEKAGFGAGKDATGVSVLLGLFKLLMTGVAVLSVDSVGRR  431

Query  508  plllggvsGIAVALFLLGSYYTFLD--NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIF  335
            PLLLGGV  +  AL  LG     L        +VIALL+YV     SFGPI WL++ EIF
Sbjct  432  PLLLGGVGAMVGALLALGGSQLLLSGGTATWTSVIALLMYV-----SFGPISWLIVGEIF  486

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL VRG   ++A + NFG+N LV+     ++E  G G  +  F  I VVA+  +F I+PE
Sbjct  487  PLAVRGPASALATITNFGSNFLVSLVLPSVQEAFGPGGTYLAFAGIGVVALATIFAIVPE  546

Query  154  TKGLTLEEIEA  122
            TKG TLEEIEA
Sbjct  547  TKGKTLEEIEA  557



>ref|XP_005708849.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
 gb|EME32329.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
Length=592

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 129/193 (67%), Gaps = 9/193 (5%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L+ FQQITGQPSVLY+A ++F+D G    A     ++ LG+ KLIMT V+ ++VD++GRR
Sbjct  403  LVTFQQITGQPSVLYFANRLFEDTGLGFVA-----AVGLGIWKLIMTIVSSILVDKVGRR  457

Query  508  plllggvsGIAVALFLLGSYYTFLDNVP---PVAVIALLLYVGCYQLSFGPIGWLMISEI  338
            PLLL G +GI V LF+L   ++    V    P+ V+ +  YVG YQ+ FGPI WL++SEI
Sbjct  458  PLLLIGSTGITVTLFVLAWLFSGNGEVSLQIPI-VLGIFCYVGSYQIGFGPITWLVLSEI  516

Query  337  FPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIP  158
            FPLRVR   L+I  L+NFG N +VT  F   +E  G   +F  F +I + ++ F++  + 
Sbjct  517  FPLRVRSASLAIGTLINFGMNLMVTSTFEWEREWFGTSGLFLQFALIGLFSIWFIYEKVV  576

Query  157  ETKGLTLEEIEAK  119
            ETKGLTLEEIEAK
Sbjct  577  ETKGLTLEEIEAK  589



>ref|XP_001416926.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95219.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
Length=530

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 125/196 (64%), Gaps = 5/196 (3%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            ++LFQQ TGQPSVLYYA + F+ AG++    A   S+ LG+ KL MTG+AV  VD LGRR
Sbjct  335  VVLFQQFTGQPSVLYYATQTFEAAGWSVEDAANV-SVILGIWKLFMTGIAVSKVDSLGRR  393

Query  508  plllggvsGIAVALFLLGSYYT----FLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            PLLLGG+S I   LF L +  T            +V A+ LYVG YQLSFGPI WL++ E
Sbjct  394  PLLLGGISIITACLFALAALNTPGEVQTTAQAQASVAAIFLYVGAYQLSFGPIAWLLVGE  453

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            +FP +VR   + +A L NFG+N LV+     ++E VG    +  F  + V+A+  ++F +
Sbjct  454  VFPSKVRSAAVGLATLSNFGSNFLVSLFLPTVQETVGLRGTYLGFASVGVLALASIYFTV  513

Query  160  PETKGLTLEEIEAKYL  113
             ET+G TLEEIEA+ +
Sbjct  514  VETRGKTLEEIEAELM  529



>ref|XP_003062688.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH53507.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=510

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 126/198 (64%), Gaps = 9/198 (5%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            ++LFQQITGQPSVLYYA ++F  AGF A+  A   S+ LG+ KL+MTG AV  VD +GRR
Sbjct  311  VVLFQQITGQPSVLYYAEQVFIAAGFDASEGAGV-SVILGVFKLVMTGFAVKYVDSVGRR  369

Query  508  plllggvsGIAVALFLLGSYYTFLD--------NVPPVAVIALLLYVGCYQLSFGPIGWL  353
            PLLLGGV+ + +A   LG+    L         N   ++V+A+  YVG YQ+SFGPI WL
Sbjct  370  PLLLGGVAAMMLATVALGACSDALATGDPADSLNTARLSVLAIFAYVGAYQVSFGPIAWL  429

Query  352  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  173
            ++ EIFP RVR   +  A L NF +N LV      M    G    ++IF V+ V+A+  +
Sbjct  430  LVGEIFPQRVRSAAVGTATLTNFASNYLVALYLPTMIASYGQAGTYYIFSVMGVIALASI  489

Query  172  ffiIPETKGLTLEEIEAK  119
            +  +PETKG +LEEIEA+
Sbjct  490  YLTVPETKGKSLEEIEAE  507



>gb|KIZ01781.1| hypothetical protein MNEG_6180 [Monoraphidium neglectum]
Length=537

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 137/197 (70%), Gaps = 4/197 (2%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            + L+LFQQITGQPSVLYYA +IF+ AGF++  +A   S+ LG  KL+MT VAV  VD+LG
Sbjct  318  SSLMLFQQITGQPSVLYYANQIFEKAGFSSGQEAAEVSVVLGAFKLLMTIVAVATVDKLG  377

Query  514  rrplllggvsGIAVALF----LLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMI  347
            RRPLLL GVSG+ VAL       GS       V  V+V+ALLLYVGCYQ+SFGPI WL++
Sbjct  378  RRPLLLAGVSGMVVALLALGLAQGSGGGGGGAVAGVSVVALLLYVGCYQVSFGPISWLIV  437

Query  346  SEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvff  167
             E+FPL VR + +++A ++N+ +N  V+ A   ++E VG    +  F  + VVA++ ++ 
Sbjct  438  GEVFPLAVRSQAIALAAVMNYASNFGVSLALPTVQEAVGLPATYLGFAGVGVVALLSIYL  497

Query  166  iIPETKGLTLEEIEAKY  116
             +PETKG TLEEIEA +
Sbjct  498  TVPETKGKTLEEIEAMW  514



>gb|KDO39945.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=451

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 8/126 (6%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLG
Sbjct  313  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLG  372

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL--SFGPIGWLMISE  341
            RRPLLLGGVSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQ+  +F P      S+
Sbjct  373  RRPLLLGGVSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQVIKNFNP------SK  426

Query  340  IFPLRV  323
            I+  R+
Sbjct  427  IYHFRI  432



>ref|XP_006443190.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 gb|ESR56430.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=451

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 8/126 (6%)
 Frame = -3

Query  694  AGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlg  515
            AGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLG
Sbjct  313  AGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLG  372

Query  514  rrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL--SFGPIGWLMISE  341
            RRPLLLGGVSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQ+  +F P      S+
Sbjct  373  RRPLLLGGVSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQVIKNFNP------SK  426

Query  340  IFPLRV  323
            I+  R+
Sbjct  427  IYHFRI  432



>ref|XP_005831465.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
 gb|EKX44485.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
Length=431

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 127/194 (65%), Gaps = 13/194 (7%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+LFQQ++GQPSVLYYA +IF+ AG    A A    + + L++    G          R
Sbjct  244  GLVLFQQLSGQPSVLYYANRIFERAGLGFEAAAIMTLLSVNLVEDPKWG----------R  293

Query  511  rplllggvsGIAVALFLLGSYYTF-LDNVPPVAVIA-LLLYVGCYQLSFGPIGWLMISEI  338
            RPLLL G SG+AV+L +L + ++   D++   AVIA ++ YVGCYQ+ FGPI WL++SE+
Sbjct  294  RPLLLLGTSGMAVSLLVLAALFSGGADSINQSAVIASIVAYVGCYQIGFGPITWLILSEV  353

Query  337  FPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIP  158
            FPL++R   +S+  L NFG+N LVT AF   ++ +G   +F  F  IAV AV F F ++P
Sbjct  354  FPLKIRAAAVSVGTLANFGSNVLVTLAFESERQSLGETLLFLQFAAIAVAAVAFEFKMVP  413

Query  157  ETK-GLTLEEIEAK  119
            ET+ GLTLE+IE K
Sbjct  414  ETRWGLTLEQIEEK  427



>gb|EWM26836.1| d-xylose-proton symporter-like protein [Nannochloropsis gaditana]
Length=663

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 131/201 (65%), Gaps = 12/201 (6%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            G++ FQQ++GQPSVLY++ +I +D G A +A     ++ +G+ KL+ T  AV+ VDR GR
Sbjct  332  GVVTFQQVSGQPSVLYFSNEILRDFGLADSA-----TLLVGVFKLVATMGAVLTVDRRGR  386

Query  511  rplllggvsGIAVALFLLGSYYTFLDN-------VPPVAVIALLLYVGCYQLSFGPIGWL  353
            R LLL G+  + +AL LL + +            +  V + A+ LY+  YQ+ FGP+ W+
Sbjct  387  RTLLLLGIGVMVLALALLSAMFAVEKEPGAKGQALDGVLIAAMFLYIAGYQVGFGPVSWI  446

Query  352  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  173
            ++SEI+P  VRG  + +AV+ NFG+N LVTFAF P++E +G    F +F  +A+ A +FV
Sbjct  447  LVSEIYPTEVRGETVGLAVMANFGSNLLVTFAFDPVRESIGTSATFGLFLGVAMAAWLFV  506

Query  172  ffiIPETKGLTLEEIEAKYLT  110
            + ++PETKGL LE I A++ +
Sbjct  507  YMLLPETKGLALEMIGAQFQS  527



>gb|KEH30181.1| monosaccharide-H+ symporter [Medicago truncatula]
Length=81

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -3

Query  352  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  173
            M+SEIFPLR RGRG+S+AVL NF  NA+VTFAFSP+KE +GA N+F +F  IA+V+++F+
Sbjct  1    MVSEIFPLRTRGRGISMAVLTNFAANAVVTFAFSPLKEYLGAENLFLLFAAIALVSLVFI  60

Query  172  ffiIPETKGLTLEEIEAKYL  113
               +PETKGL+LEEIE+K L
Sbjct  61   VTSVPETKGLSLEEIESKIL  80



>emb|CEF97100.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 
3 [Ostreococcus tauri]
Length=499

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 124/194 (64%), Gaps = 9/194 (5%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            ++LFQQ TGQPSVLYYA + F+ AG++A   A   S+ LG+ KL MT +AV  VD LGRR
Sbjct  304  VVLFQQFTGQPSVLYYANQTFEAAGWSAEDAANV-SVILGVWKLFMTAIAVSKVDSLGRR  362

Query  508  plllggvsGIAVALFLL------GSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMI  347
            PLLLGGVS + V LF L      G   T       +AVI   LYVG YQLSFGPI WL++
Sbjct  363  PLLLGGVSVVTVCLFALAALNAPGEAQTVAQAQASLAVI--FLYVGAYQLSFGPIAWLLV  420

Query  346  SEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvff  167
             E+FP +VR   + +A L NFG+N LV+     ++E +G    +  F  + V+AV+ ++F
Sbjct  421  GEVFPAKVRSAAVGLATLSNFGSNFLVSLFLPTVEETIGLRGTYLGFASVGVLAVVSIYF  480

Query  166  iIPETKGLTLEEIE  125
             + ET+G TLEEIE
Sbjct  481  TVVETRGKTLEEIE  494



>emb|CBJ33077.1| conserved unknown protein [Ectocarpus siliculosus]
Length=523

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = -3

Query  439  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  260
            LD      + A+ +Y+G YQ+ FGP+ WL+ISEIFPL VRG+ +S+AV+VNFG N LVTF
Sbjct  403  LDTQKACILAAMFVYIGGYQVGFGPVVWLIISEIFPLDVRGKAISVAVVVNFGFNLLVTF  462

Query  259  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYLT*LFLRMMHNH  80
             F  M E +G+   F IF V    ++ F+   +PETKGL+LE+IEA     LFLR    +
Sbjct  463  IFPTMLEDLGSSWTFAIFAVADAYSLYFIKTRVPETKGLSLEQIEA-----LFLRRGQRN  517



>ref|WP_013644894.1| major facilitator transporter [Methanobacterium lacus]
 ref|YP_004290515.1| sugar transporter [Methanobacterium lacus]
 gb|ADZ09543.1| sugar transporter [Methanobacterium lacus]
Length=453

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 138/192 (72%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL  FQQ+TG  +V+YYA  I + AG   A     A++ +G++ +++T V+++++DRLGR
Sbjct  255  GLAAFQQLTGINTVIYYAPTILEFAGLQTATVTIFATVGIGVVNVLLTVVSILLIDRLGR  314

Query  511  rplllggvsGIAVALFLLGSYYT---FLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLLL G++G+ V+L ++G  +       ++  +AVI L+LYVG + +S GPI WLMI+E
Sbjct  315  RPLLLAGITGMIVSLGIMGLAFIIPGLTSSLGWLAVICLMLYVGSFAISLGPIFWLMIAE  374

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            I+PLR+RGR +SI  ++N+ TN +V   F  + EL+GA   F+++GVIAV++++FV++ +
Sbjct  375  IYPLRIRGRAMSIVTMINWATNLVVAITFLTIIELLGASGTFWLYGVIAVLSLLFVYYRV  434

Query  160  PETKGLTLEEIE  125
            PETKG +LEEIE
Sbjct  435  PETKGKSLEEIE  446



>ref|WP_022247679.1| sugar transporter [Clostridium sp. CAG:306]
 emb|CDC20516.1| sugar transporter [Clostridium sp. CAG:306]
Length=455

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 131/196 (67%), Gaps = 5/196 (3%)
 Frame = -3

Query  685  ILFQQI-TGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            I+F QI TG  +++YYA  IF+ +GF +   A  A+  +G++  +MT VA+   D+LGR+
Sbjct  252  IMFAQICTGINTIIYYAPTIFKISGFDSNISAIYAATGIGVVNFLMTIVAIAFTDKLGRK  311

Query  508  plllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            PLL  G++G+ ++L  LG  + F D    N+  VAV +L+ Y+ C+  S GPIGW+++SE
Sbjct  312  PLLYFGLTGVMLSLIALGCAFQFADVLGDNLKWVAVGSLITYIICFACSLGPIGWILVSE  371

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            +FPLR+RG  +S+  + NFG N LV F+F P+   +G    F++FG ++++ + FV+F +
Sbjct  372  VFPLRIRGAAMSLCTVANFGFNFLVVFSFLPLIHRIGEACTFWMFGAVSLLCIFFVYFCV  431

Query  160  PETKGLTLEEIEAKYL  113
            PETKG++LE IE  ++
Sbjct  432  PETKGISLETIEKNWI  447



>ref|XP_002501745.1| sugar transporter [Micromonas sp. RCC299]
 gb|ACO63003.1| sugar transporter [Micromonas sp. RCC299]
Length=506

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 123/196 (63%), Gaps = 9/196 (5%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            ++LFQQITGQPSVLYYA ++F +AG+  A  A   ++ LG  KL+MTGVAV  VD  GRR
Sbjct  308  VVLFQQITGQPSVLYYAEQVFINAGYDPADGAGV-AVILGFFKLLMTGVAVAFVDSAGRR  366

Query  508  plllggvsGIAVALFLLGSYYTFLDN--------VPPVAVIALLLYVGCYQLSFGPIGWL  353
            PLLLGGV  + +++  L      + +            +V A+  YVG YQ+SFGPI WL
Sbjct  367  PLLLGGVGIMTLSVLTLAVCSETMASGDVAGTSFTARASVAAIFAYVGAYQVSFGPIAWL  426

Query  352  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  173
            ++ EIFP RVR   +  A L NF +N LV+     + E +G    +++F V++VVA+  +
Sbjct  427  LVGEIFPQRVRSAAVGTATLTNFFSNFLVSLYLPTLNENLGTAGTYYLFSVMSVVALSSI  486

Query  172  ffiIPETKGLTLEEIE  125
            +  +PETKG TLEEIE
Sbjct  487  YLTVPETKGKTLEEIE  502



>ref|XP_007510995.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66555.1| predicted protein [Bathycoccus prasinos]
Length=595

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 128/202 (63%), Gaps = 12/202 (6%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            ++LFQQ+TGQPSVLYYA + F+ AG++A   +   ++ +G+ KL MT +AV  VD LGRR
Sbjct  384  VVLFQQLTGQPSVLYYATQTFEAAGWSAQGASNI-AVVVGVFKLFMTVIAVWKVDSLGRR  442

Query  508  plllggvsGIAVALFLLG-----------SYYTFLDNVPPVAVIALLLYVGCYQLSFGPI  362
            PLLLGGVS I ++L +L                  +    ++V A+ LYVG YQ+SFGPI
Sbjct  443  PLLLGGVSLITLSLMVLALASPDFAGSGVEAAALSETQARISVAAIFLYVGAYQVSFGPI  502

Query  361  GWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvav  182
             WL++ E+FP +VR + + IA L+NFG+N +V+       E +G  + +F F  I V++V
Sbjct  503  AWLLVGEVFPTKVRSQAVGIATLLNFGSNFIVSLNLPYAIEQIGIKSTYFGFASIGVLSV  562

Query  181  ifvffiIPETKGLTLEEIEAKY  116
              ++F + ETKG TLEEIE  Y
Sbjct  563  ASIYFSVVETKGKTLEEIEDAY  584



>ref|NP_197203.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 emb|CAC01714.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AED92371.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=440

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  352  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  173
            ++ EIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+
Sbjct  361  LLPEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFI  420

Query  172  ffiIPETKGLTLEEIEAKYL  113
            FFI+PETKGLTLEEIEAK L
Sbjct  421  FFIVPETKGLTLEEIEAKCL  440



>gb|KDD76485.1| sugar transporter [Helicosporidium sp. ATCC 50920]
Length=587

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L+LFQQITGQPSVLYYAA IF+ AGF+++  AT  S+ LG  KL+MT VAVV VD LGRR
Sbjct  348  LMLFQQITGQPSVLYYAASIFKAAGFSSSWAATGVSLALGNFKLLMTCVAVVTVDSLGRR  407

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVI-----ALLLYVGCYQLSFGPIGWLMIS  344
            PLLLGGV  +  +L LL      +  + P  V       LLLYVG YQLSFGP+ WL++ 
Sbjct  408  PLLLGGVGALVFSLVLLWVCAGGVLPLGPSGVAWTSLGGLLLYVGAYQLSFGPLSWLIVG  467

Query  343  EIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVG  230
            E+FPLRVR + +++A LVNF  N +V+ A   M+ ++G
Sbjct  468  EVFPLRVRSQAIALATLVNFSANFVVSLALPIMQRVLG  505



>ref|XP_005783754.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
 gb|EOD31325.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
Length=502

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = -3

Query  427  PPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSP  248
            PPV V AL+LYV  YQ+ FGPI WL+ISE+FP++ R R LS+AV VNFG N LVTF  SP
Sbjct  391  PPVVVFALMLYVCGYQVGFGPIAWLIISEVFPIKTRTRALSMAVTVNFGFNLLVTFLLSP  450

Query  247  MKELV-------GAGNvffifgviavvavifvffiIPETKGLTLEEIEA  122
            ++  +       G+  +F I+  + +V+  FV   +PETKG +LE+IEA
Sbjct  451  LQTALDALSPGKGSSYLFAIYAALCLVSSTFVHACVPETKGKSLEQIEA  499



>ref|WP_022187653.1| sugar transporter [Azospirillum sp. CAG:260]
 emb|CDB39512.1| sugar transporter [Azospirillum sp. CAG:260]
Length=462

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 125/196 (64%), Gaps = 4/196 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            G++  Q  TG  +++YY A IFQ AGF     A  A+I +G++  +MT VA+   DRLGR
Sbjct  258  GMMFMQICTGINTIIYYTATIFQAAGFTDTLGALYATIGVGVVNFLMTFVAIFFTDRLGR  317

Query  511  rplllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMIS  344
            +PLL  G++GI  +LF+LG  +   D    ++  VAV ++++Y+ C+  S GPIGW++IS
Sbjct  318  KPLLYAGLAGITASLFVLGGSFWLTDYLGDSLKWVAVGSIVIYIACFAFSLGPIGWIIIS  377

Query  343  EIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffi  164
            EI PL++RG  +SI  + NFG N LV   F  + E +G    F++FG++ + ++ F F  
Sbjct  378  EIMPLKIRGLAMSICTMANFGFNFLVALTFPVLLEHIGEAYTFWMFGLVGIFSLWFTFRY  437

Query  163  IPETKGLTLEEIEAKY  116
            IPETKG +LE+IE  +
Sbjct  438  IPETKGRSLEQIEKNW  453



>gb|EKD53804.1| hypothetical protein ACD_60C00149G0003 [uncultured bacterium]
Length=466

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 135/204 (66%), Gaps = 3/204 (1%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL + QQITG  +++YYA  IF  AGF     A  A++ +GL+ ++ T +A+ ++D LGR
Sbjct  250  GLAIIQQITGINTIIYYAPTIFNLAGFEGPTAAILATMGVGLVFVVSTIIALPLIDTLGR  309

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIAL---LLYVGCYQLSFGPIGWLMISE  341
            RPLLL G+ G+A++L LL   ++     P +  IAL   L+Y+ C+  S GPI WLMI+E
Sbjct  310  RPLLLIGLLGMALSLGLLSIAFSHAGTFPFLKWIALSSMLIYIACFGFSLGPIMWLMIAE  369

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            I+PL++RG G SIA   N+G+N +V   F  + E +GA + F I+ ++++++++F+++++
Sbjct  370  IYPLKIRGLGCSIATAANWGSNMIVALTFLSLIEYMGASHTFLIYCLLSIISLLFIYYLV  429

Query  160  PETKGLTLEEIEAKYLT*LFLRMM  89
            PETK +TLE+IE      L+ + M
Sbjct  430  PETKDITLEQIEENLRAGLYFKKM  453



>ref|XP_002179486.1| TRD4 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49309.1| TRD4, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=467

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 120/190 (63%), Gaps = 6/190 (3%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL++ QQITGQPSVL YA  IF+DAG + +A      + L L KL+ T  A V V++ GR
Sbjct  283  GLVVLQQITGQPSVLSYATPIFRDAGLSDSA-----PVLLALFKLLATLSAAVTVEKYGR  337

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAV-IALLLYVGCYQLSFGPIGWLMISEIF  335
            + LL  G S + + L +L         +  VAV +A+ +Y+G YQ+ FGPI WL+ SE++
Sbjct  338  KMLLYTGCSLMLIGLTILSFSLDGGTYIAKVAVLVAMFVYIGGYQVGFGPITWLLTSELY  397

Query  334  PLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPE  155
            PL +RG+ ++IAV +NF  N  V F    ++E++G    F +FG++   ++ FV   +PE
Sbjct  398  PLSIRGQAVAIAVQMNFLLNTAVQFGVPLLQEVIGLSFTFALFGILTAYSIFFVATRVPE  457

Query  154  TKGLTLEEIE  125
            TKGL+LEEIE
Sbjct  458  TKGLSLEEIE  467



>ref|WP_025318950.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ68933.1| hypothetical protein GbCGDNIH2_1264 [Granulibacter bethesdensis 
CGDNIH2]
Length=448

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 123/194 (63%), Gaps = 5/194 (3%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++DR GR
Sbjct  249  GLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLMDRAGR  308

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPIGWLMI  347
            R LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+ WL+I
Sbjct  309  RSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPVFWLII  368

Query  346  SEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvff  167
            SEIFPL  RGRG+++A +VN+G+NA+V + F PM   VG  + F IF  ++V++V F   
Sbjct  369  SEIFPLHARGRGMAVATVVNWGSNAIVAYTFLPMLNSVGIISTFLIFAFMSVLSVFFTIR  428

Query  166  iIPETKGLTLEEIE  125
             +PET G TLE+IE
Sbjct  429  FVPETTGQTLEDIE  442



>gb|ACJ18943.1| D-xylose-proton symporter [Coxiella burnetii CbuG_Q212]
Length=409

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++D LGR
Sbjct  204  GLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLIDSLGR  263

Query  511  rplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI WLM SE
Sbjct  264  RPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMWLMFSE  323

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF++  +
Sbjct  324  IFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIFIYTSV  383

Query  160  PETKGLTLEEIE  125
            PETKG+TLE+IE
Sbjct  384  PETKGVTLEQIE  395



>gb|ACJ19821.1| D-xylose-proton symporter [Coxiella burnetii CbuK_Q154]
Length=409

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++D LGR
Sbjct  204  GLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLIDSLGR  263

Query  511  rplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI WLM SE
Sbjct  264  RPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMWLMFSE  323

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF++  +
Sbjct  324  IFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIFIYTSV  383

Query  160  PETKGLTLEEIE  125
            PETKG+TLE+IE
Sbjct  384  PETKGVTLEQIE  395



>ref|WP_022021988.1| sugar transporter [Acinetobacter sp. CAG:196]
 emb|CCZ51005.1| sugar transporter [Acinetobacter sp. CAG:196]
Length=451

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 132/195 (68%), Gaps = 5/195 (3%)
 Frame = -3

Query  685  ILFQQI-TGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            I+F QI TG  +++YYA  IF+ AGF +   A  A+  +G++  IMT VAV   DR+GR+
Sbjct  248  IMFAQICTGINTIIYYAPTIFKTAGFDSNLTAIYATTGIGVVNFIMTIVAVFFTDRIGRK  307

Query  508  plllggvsGIAVALFLLGSYYTFL----DNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            PLL  G++G+ ++LF LG+ + F      ++  VAV +L+ Y+ C+ +S GPIGW+++SE
Sbjct  308  PLLYFGLTGVMLSLFALGTSFAFAGVLGSSLKWVAVGSLVTYIICFAMSLGPIGWILVSE  367

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            +FPLR+RG  +S+  + NF  N  V  +F  +   +G    F+IFG+++++ +IFV+F +
Sbjct  368  VFPLRIRGIAMSVCTVSNFAFNFFVVGSFPVLLHRIGGAWTFWIFGIVSILCIIFVYFFV  427

Query  160  PETKGLTLEEIEAKY  116
            PETKG++LEEIE+ +
Sbjct  428  PETKGISLEEIESNW  442



>ref|WP_011631971.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|ABI62162.1| sugar-proton symporter [Granulibacter bethesdensis CGDNIH1]
Length=448

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 123/194 (63%), Gaps = 5/194 (3%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++DR GR
Sbjct  249  GLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLMDRAGR  308

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPIGWLMI  347
            R LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+ WL+I
Sbjct  309  RSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPVFWLII  368

Query  346  SEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvff  167
            SEIFPL  RGRG+++A + N+G+NA+V + F PM   VG  + F IF +++VV++ F   
Sbjct  369  SEIFPLHARGRGMAVATVANWGSNAIVAYTFLPMLNSVGIISTFLIFALMSVVSIFFTIR  428

Query  166  iIPETKGLTLEEIE  125
             +PET G TLE+IE
Sbjct  429  FVPETTGQTLEDIE  442



>ref|WP_025286678.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ63069.1| hypothetical protein GbCGDNIH3_1264 [Granulibacter bethesdensis 
CGDNIH3]
Length=448

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 123/194 (63%), Gaps = 5/194 (3%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++DR GR
Sbjct  249  GLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLMDRAGR  308

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPIGWLMI  347
            R LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+ WL+I
Sbjct  309  RSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPVFWLII  368

Query  346  SEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvff  167
            SEIFPL  RGRG+++A + N+G+NA+V + F PM   VG  + F IF +++VV++ F   
Sbjct  369  SEIFPLHARGRGMAVATVANWGSNAIVAYTFLPMLNSVGIISTFLIFALMSVVSIFFTIR  428

Query  166  iIPETKGLTLEEIE  125
             +PET G TLE+IE
Sbjct  429  FVPETTGQTLEDIE  442



>ref|WP_005772424.1| major facilitator transporter [Coxiella burnetii]
 ref|NP_819388.2| D-xylose-proton symporter [Coxiella burnetii RSA 493]
 gb|ABX78561.1| D-xylose-proton symporter [Coxiella burnetii RSA 331]
 gb|EDR36245.1| D-xylose-proton symporter [Coxiella burnetii Q321]
 gb|AAO89902.2| D-xylose-proton symporter [Coxiella burnetii RSA 493]
 gb|AIT62840.1| Sugar transporter (Precursor) [Coxiella burnetii str. Namibia]
Length=463

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++D LGR
Sbjct  258  GLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLIDSLGR  317

Query  511  rplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI WLM SE
Sbjct  318  RPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMWLMFSE  377

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF++  +
Sbjct  378  IFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIFIYTSV  437

Query  160  PETKGLTLEEIE  125
            PETKG+TLE+IE
Sbjct  438  PETKGVTLEQIE  449



>ref|WP_005769170.1| major facilitator transporter [Coxiella burnetii]
 gb|EAX33375.1| D-xylose-proton symporter [Coxiella burnetii 'MSU Goat Q177']
Length=463

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++D LGR
Sbjct  258  GLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLIDSLGR  317

Query  511  rplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI WLM SE
Sbjct  318  RPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMWLMFSE  377

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF++  +
Sbjct  378  IFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIFIYTSV  437

Query  160  PETKGLTLEEIE  125
            PETKG+TLE+IE
Sbjct  438  PETKGVTLEQIE  449



>ref|WP_011997243.1| major facilitator transporter [Coxiella burnetii]
 gb|ABS76630.1| D-xylose-proton symporter [Coxiella burnetii Dugway 5J108-111]
Length=463

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++D LGR
Sbjct  258  GLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLIDSLGR  317

Query  511  rplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI WLM SE
Sbjct  318  RPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMWLMFSE  377

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF++  +
Sbjct  378  IFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIFIYTSV  437

Query  160  PETKGLTLEEIE  125
            PETKG+TLE+IE
Sbjct  438  PETKGVTLEQIE  449



>ref|WP_032138490.1| major facilitator transporter [Coxiella burnetii]
Length=463

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 126/192 (66%), Gaps = 3/192 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++D LGR
Sbjct  258  GLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLIDSLGR  317

Query  511  rplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            RPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI WLM SE
Sbjct  318  RPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMWLMFSE  377

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF++  +
Sbjct  378  IFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIFIYTSV  437

Query  160  PETKGLTLEEIE  125
            PETKG+TLE+IE
Sbjct  438  PETKGVTLEQIE  449



>ref|WP_025320564.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ66299.1| hypothetical protein GbCGDNIH4_1264 [Granulibacter bethesdensis 
CGDNIH4]
Length=448

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 123/194 (63%), Gaps = 5/194 (3%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++DR GR
Sbjct  249  GLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLMDRAGR  308

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPIGWLMI  347
            R LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+ WL+I
Sbjct  309  RSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPVFWLII  368

Query  346  SEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvff  167
            SEIFPL  RGRG+++A + N+G+NA+V + F PM   VG  + F IF +++VV++ F   
Sbjct  369  SEIFPLHARGRGMAVATVANWGSNAIVAYTFLPMLNNVGIISTFLIFALMSVVSIFFTIR  428

Query  166  iIPETKGLTLEEIE  125
             +PET G TLE+IE
Sbjct  429  FVPETTGQTLEDIE  442



>ref|WP_022196350.1| putative metabolite transport protein ywtG [Azospirillum sp. 
CAG:239]
 emb|CDB53004.1| putative metabolite transport protein ywtG [Azospirillum sp. 
CAG:239]
Length=463

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 124/196 (63%), Gaps = 4/196 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            G++  Q  TG  +++YY   IF+ AGF++A  A  A+I +G +   MT VA+V  DR+GR
Sbjct  259  GMMFMQICTGINTIIYYTTTIFKVAGFSSAIGAIYATIGIGFVNFFMTFVAIVFADRIGR  318

Query  511  rplllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMIS  344
            +PLL  G+SG+ V+LF LG+ + F D    N+  +AV ++++Y+  +  S GPIGW+++S
Sbjct  319  KPLLYAGLSGVTVSLFALGASFWFADALGDNLKWMAVGSVVVYIASFAFSLGPIGWIVVS  378

Query  343  EIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffi  164
            EI PL++RG  +SI  + N   N +V   F P+   VG    F+++G+I +  + F +  
Sbjct  379  EILPLKIRGLAMSICTVANMAFNFVVVLTFLPLINSVGEARTFWMYGIIGIFCLFFTYRY  438

Query  163  IPETKGLTLEEIEAKY  116
            +PETKG +LE+IE  +
Sbjct  439  LPETKGRSLEQIEKNW  454



>ref|WP_022486233.1| sugar transporter [Fusobacterium sp. CAG:815]
 emb|CDE92933.1| sugar transporter [Fusobacterium sp. CAG:815]
Length=453

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 131/196 (67%), Gaps = 5/196 (3%)
 Frame = -3

Query  685  ILFQQI-TGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            I+F QI TG  +++YYA  IF++AGF +   A  A+  +G++  +MT VA+   D+LGR+
Sbjct  250  IMFAQICTGINTIIYYAPTIFKNAGFESNITAIYATTGIGVINFLMTIVALFFTDKLGRK  309

Query  508  plllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            PLL  G++G+ ++L  LG  + F D    N+  V V +L++Y+ C+ +S GPIGW+++SE
Sbjct  310  PLLYFGLTGVMLSLIALGCGFAFADFFGDNLKWVTVGSLVIYIICFAMSLGPIGWILVSE  369

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            +FPLR+RG  +SI  + NF  N  V  +F  +   +G    F+ FG+++++ ++FV+F +
Sbjct  370  VFPLRIRGVAMSICTVSNFAFNFFVVSSFPILLHRIGGAWTFWGFGIVSLLCIVFVYFCV  429

Query  160  PETKGLTLEEIEAKYL  113
            PETKG++LE IE+ ++
Sbjct  430  PETKGISLETIESNWI  445



>ref|WP_022491563.1| metabolite transport protein, partial [Clostridium sp. CAG:813]
 emb|CDE97891.1| metabolite transport protein [Clostridium sp. CAG:813]
Length=336

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 131/196 (67%), Gaps = 5/196 (3%)
 Frame = -3

Query  685  ILFQQI-TGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            I+F QI TG  +++YYA  IF+ AGF +  +A  A+  +G++  +MT VAV   DRLGR+
Sbjct  130  IMFAQICTGINTIIYYAPTIFKIAGFDSNLNAIYATTGIGVINFLMTIVAVFFTDRLGRK  189

Query  508  plllggvsGIAVALFLLGSYYTFL----DNVPPVAVIALLLYVGCYQLSFGPIGWLMISE  341
            PLL  G++G+ ++L  LG  + F     D++  VAV +L+ Y+ C+ +S GPIGW+++SE
Sbjct  190  PLLYFGLTGVMLSLVALGCAFAFSSVSGDSLKWVAVGSLVTYIICFAMSLGPIGWIIVSE  249

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            +FPL++RG  +SI  + NF  N  V  +F  +   +G    F+ F V++++ ++FV+F +
Sbjct  250  VFPLKIRGVAMSICTVSNFAFNFFVVGSFPILIHRIGGAYTFWGFAVVSLLCILFVYFFV  309

Query  160  PETKGLTLEEIEAKYL  113
            PETKG++LE+IE+ +L
Sbjct  310  PETKGISLEQIESNWL  325



>ref|WP_022006956.1| d-xylose-proton symporter [Proteobacteria bacterium CAG:495]
 emb|CCZ29782.1| d-xylose-proton symporter [Proteobacteria bacterium CAG:495]
Length=456

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 128/196 (65%), Gaps = 4/196 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            G++  Q  TG  +++YY   IF+ AGF++   A  A+I +G +  +MT VA+   D+ GR
Sbjct  252  GIMFVQICTGINTIIYYTTTIFKIAGFSSTIGAIYATIGIGTVNFLMTLVAIFFTDKWGR  311

Query  511  rplllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMIS  344
            +PLL  G+ GI ++L  LG  + + D    ++  +AV +++LY+  + +S GPIGW+++S
Sbjct  312  KPLLYIGLWGILISLLSLGFAFHYSDVLGESLKWIAVGSVVLYIASFAMSLGPIGWILVS  371

Query  343  EIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffi  164
            EI PL++RG  +S+  + NFG N +V  +F P+   +G    F+IF +IA ++++FV+F 
Sbjct  372  EILPLKIRGFAMSLCTVANFGFNFIVVLSFLPLINSIGEARTFWIFALIAALSLLFVYFF  431

Query  163  IPETKGLTLEEIEAKY  116
            +PETKG++LE+IE  +
Sbjct  432  VPETKGISLEKIERNW  447



>ref|WP_007429069.1| MFS transporter [Paenibacillus sp. Aloe-11]
 gb|EHS58830.1| sugar transporter [Paenibacillus sp. Aloe-11]
Length=466

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 122/192 (64%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTLCLIIIGAAFKMGLTTGPLVLIMILIYVAAYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            RVRG+ ++IA +  +  + LV+ AF P+    G  N F+ FG I++  V F++  +PETK
Sbjct  393  RVRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWTFGAISLFVVFFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_024816367.1| major facilitator transporter [Methylopila sp. 73B]
Length=447

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 127/194 (65%), Gaps = 2/194 (1%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQ+TG  +V+YYA  IF+ AG A+ + A  A+  +G++ +IMT VA+ ++D  GR
Sbjct  247  GLAIFQQVTGINTVIYYAPIIFEKAGMASTSAAILATAGVGVVNVIMTYVALKLLDTAGR  306

Query  511  rplllggvsGIAVALFLLGSYYTFLDN--VPPVAVIALLLYVGCYQLSFGPIGWLMISEI  338
            R LL+ G++G+A  L +L + +       +  +A +++  YVG + +  GP+ WL+ISEI
Sbjct  307  RKLLIVGLAGMAAMLAILTAGFAVGTEGALAWIATLSVAAYVGFFAIGLGPVFWLLISEI  366

Query  337  FPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIP  158
            FPL VRGR + +A + N+G+N +V+  F  +   +G+   F +F V++V A+ F   ++P
Sbjct  367  FPLAVRGRAMGVATVANWGSNLIVSQVFLMLIAGLGSAATFGLFAVMSVGALFFTIALVP  426

Query  157  ETKGLTLEEIEAKY  116
            ETKG TLEEIEA +
Sbjct  427  ETKGRTLEEIEAGF  440



>ref|XP_009036253.1| general sugar transporter [Aureococcus anophagefferens]
 gb|EGB09136.1| general sugar transporter [Aureococcus anophagefferens]
Length=498

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 124/203 (61%), Gaps = 19/203 (9%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            G++L QQ+TGQPSVLYYA+ IF  AG    A     ++F+G+ KL  T  AVV VDR GR
Sbjct  277  GVVLLQQLTGQPSVLYYASTIFDAAGIGTVA-----TVFVGVFKLFATLFAVVTVDRRGR  331

Query  511  rplllggvsGIAVALFLLGSYYTFLD-----NVPPVAVIALL-LYVGCYQLSFGPIGWLM  350
            R LL  GV  + +AL  L   +   D     +    A++ L+ +Y+  YQ+ FGPI WL+
Sbjct  332  RELLFVGVGSMFLALAALALAFYDFDPSGGFSAQKGAIVGLIFVYIAGYQVGFGPIAWLL  391

Query  349  ISEIFPLRVRGRGLSIAVLVNFGTNALVTFAF----SPMKELVGAGNvffif----gvia  194
            ISE+FPL VRG+ +++AV  NF +N LV+F F    + +K L+G+     +      V+ 
Sbjct  392  ISEVFPLEVRGQAVALAVQANFASNMLVSFLFPVAQTGLKALLGSTWYLTVLFGIFAVLD  451

Query  193  vvavifvffiIPETKGLTLEEIE  125
            + A+ F+   +PETKG+TLEEIE
Sbjct  452  LYALHFINRNVPETKGMTLEEIE  474



>ref|WP_016821403.1| MULTISPECIES: MFS transporter [Paenibacillus]
 gb|AHM64706.1| sugar transporter [Paenibacillus polymyxa SQR-21]
 gb|AIY10329.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTLCLIIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_019686308.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTLCLIIIGAAFKIGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_044786399.1| MFS transporter [Paenibacillus polymyxa]
 gb|KJD39913.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTLCLIIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_025675784.1| MFS transporter [Paenibacillus polymyxa]
 gb|AJE50781.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_013369675.1| MFS transporter [Paenibacillus polymyxa]
 gb|ADO55042.1| Sugar transporter [Paenibacillus polymyxa SC2]
 emb|CCC83913.1| arabinose-proton symporter Arabinose transporter [Paenibacillus 
polymyxa M1]
Length=466

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_014280112.1| MFS transporter [Paenibacillus terrae]
 gb|AET59385.1| sugar transporter [Paenibacillus terrae HPL-003]
Length=466

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G + + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTTLMTLCLVIIGAAFKMGLTTGPLVLIMILIYVAAYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F+IFGVI++  V F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGVISLFVVFFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_023987284.1| MFS transporter [Paenibacillus polymyxa]
 ref|YP_008910510.1| MFS transporter [Paenibacillus polymyxa CR1]
 gb|AHC18659.1| MFS transporter [Paenibacillus polymyxa CR1]
Length=466

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLIIGTSLMTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F++FG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_025722405.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLIIGTSLMTLCLVIIGAAFKLGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F++FG I++  VIF++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVIFLWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_028543212.1| MFS transporter [Paenibacillus sp. UNCCL52]
Length=466

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLIIGTSLMTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F++FG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVVFLWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_029516079.1| MFS transporter [Paenibacillus polymyxa]
 gb|KEO80016.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 123/192 (64%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIMQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S +   L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  ILLIIGTSLMTCCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            R+RG+ ++IA +  +  + LV+ AF P+    G  N F++FG I++  V+F++  +PETK
Sbjct  393  RIRGKAVAIASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMENMWL  464



>ref|WP_010638886.1| major facilitator transporter [Acidithiobacillus thiooxidans]
Length=412

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 126/191 (66%), Gaps = 2/191 (1%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQITG   V+Y+A  IF+DAG ++A+ +  A++ +G + +IMTGVA+ ++D  GR
Sbjct  219  GLAVFQQITGINVVIYFAPTIFRDAGLSSASGSILATVGIGAVNVIMTGVAMRLLDTAGR  278

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIA--LLLYVGCYQLSFGPIGWLMISEI  338
            R +LL G+ G+  +L  +G+ +    + P   +I   + ++V  + +  GPI WLMISEI
Sbjct  279  RKMLLLGLYGMLTSLVFIGTGFLIQLHGPLTYIIVGMVAIFVAFFAIGLGPIFWLMISEI  338

Query  337  FPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIP  158
            FPL +RGR +SIA + N+ +N +++  F  +  ++G G  F  +  + V+A++F  +I+P
Sbjct  339  FPLAIRGRAMSIATVANWVSNMVISGIFLDLLLIIGRGPTFMFYAAMTVLAILFTLWIVP  398

Query  157  ETKGLTLEEIE  125
            ETKG TLE+IE
Sbjct  399  ETKGKTLEQIE  409



>ref|WP_018661922.1| major facilitator transporter [Bacillus acidiproducens]
Length=459

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 125/194 (64%), Gaps = 4/194 (2%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQI G  +VLYYA   F + G  A+A     ++ +G++ +I+T VAV+++D++GR
Sbjct  249  GLAVFQQIIGCNTVLYYAPTTFTNVGLGASAAILG-TVGIGIVNVIITAVAVLIIDKIGR  307

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVA---VIALLLYVGCYQLSFGPIGWLMISE  341
            +PLLL G +G+++ALF+LG     L      +   VI L +Y+  + LS+GP+ W+M+SE
Sbjct  308  KPLLLIGNAGMSIALFVLGIVNVSLGQTTAASWTTVICLAIYIAFFSLSWGPVVWVMLSE  367

Query  340  IFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiI  161
            IFPLR+RG G+ I  + N+  N +V+  F  + E  G   +F  +G++ V A IFV   I
Sbjct  368  IFPLRIRGIGMGIGSVTNWLANLVVSLTFPKLIEQFGISTMFISYGIMGVFAYIFVNKKI  427

Query  160  PETKGLTLEEIEAK  119
            PETKG +LE+IE +
Sbjct  428  PETKGKSLEQIEME  441



>ref|WP_037344745.1| major facilitator transporter [Sciscionella sp. SE31]
Length=454

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L LFQ ITG  +V+Y+A  I  D GF+A +     ++ +G++ L MT V+++++DR+GRR
Sbjct  251  LALFQTITGIDTVIYFAPTILDDVGFSAQSATLS-TVGIGVVNLAMTVVSLLLLDRIGRR  309

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPP-VAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
             LL+ G + +AV L LL   + F  + P  ++V AL+ +VG + +  GP  WL+ SEI+P
Sbjct  310  TLLIAGTAVMAVCLALLA--FVFSASAPGWLSVTALMAFVGAFAIGLGPAFWLINSEIYP  367

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPET  152
            LR+R R   +A ++ FG+NA+V+  F P+ EL+G   VF ++  + + AV+F++  +PET
Sbjct  368  LRLRARAAGLATMMIFGSNAIVSITFLPLVELLGQAQVFLLYLALTIAAVLFMYRWVPET  427

Query  151  KGLTLEEIE  125
            +G +LEEIE
Sbjct  428  RGRSLEEIE  436



>ref|WP_024895141.1| major facilitator transporter [Acidithiobacillus thiooxidans]
Length=452

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 126/191 (66%), Gaps = 2/191 (1%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQITG   V+Y+A  IF+DAG ++A+ +  A++ +G + +IMTGVA+ ++D  GR
Sbjct  259  GLAVFQQITGINVVIYFAPTIFRDAGLSSASGSILATVGIGAVNVIMTGVAMRLLDTAGR  318

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIA--LLLYVGCYQLSFGPIGWLMISEI  338
            R +LL G+ G+  +L  +G+ +    + P   +I   + ++V  + +  GPI WLMISEI
Sbjct  319  RKMLLLGLYGMLTSLVFIGTGFLIQLHGPLTYIIVGMVAIFVAFFAIGLGPIFWLMISEI  378

Query  337  FPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIP  158
            FPL +RGR +SIA + N+ +N +++  F  +  ++G G  F  +  + V+A++F  +I+P
Sbjct  379  FPLAIRGRAMSIATVANWVSNMVISGIFLDLLLIIGRGPTFMFYAAMTVLAILFTLWIVP  438

Query  157  ETKGLTLEEIE  125
            ETKG TLE+IE
Sbjct  439  ETKGKTLEQIE  449



>ref|WP_036621919.1| MFS transporter [Paenibacillus macerans]
 gb|KFN09600.1| MFS transporter, sugar porter family protein [Paenibacillus macerans]
Length=466

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 123/192 (64%), Gaps = 1/192 (1%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L + Q ITG  ++LYYA  IF+  G    A  T+ +I++GL+ ++ T V+V ++D+ GR+
Sbjct  274  LAIIQHITGINAILYYAPVIFKGMGLGTDASLTQ-TIWIGLINVLFTIVSVWLIDKAGRK  332

Query  508  plllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPL  329
             LL+ G S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP 
Sbjct  333  VLLMIGTSLMTICLAVIGAAFKMDLTAGPLVLIMILIYVAAYAISLGPIVWVMISEIFPN  392

Query  328  RVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK  149
            RVRG+ ++IA +  +  + LV+  F P+    G  N F+ FGVI++  V+F++  +PETK
Sbjct  393  RVRGKAVAIASMALWAGDYLVSQLFPPLLSSAGPSNTFWTFGVISLFVVVFIWRKVPETK  452

Query  148  GLTLEEIEAKYL  113
            G +LE++E  +L
Sbjct  453  GRSLEQMEHMWL  464



>ref|WP_034935483.1| hypothetical protein [Erwinia mallotivora]
 gb|EXU76216.1| hypothetical protein BG55_06355 [Erwinia mallotivora]
Length=488

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 127/198 (64%), Gaps = 10/198 (5%)
 Frame = -3

Query  688  LILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrr  509
            L +FQQ  G   VLYYA ++F+  G +      + +I +G++ L+ T +A+  VD+ GR+
Sbjct  282  LSVFQQFVGINVVLYYAPEVFRTVGSSTDVALLQ-TIIVGVINLLFTTIAIATVDKFGRK  340

Query  508  plllggvsGIAVALFLLGS-YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFP  332
            PL + G  G+AV +F LGS +Y+ L   P VA+ A+L YV  + +S+GP+ W++++EIFP
Sbjct  341  PLQIIGALGMAVGMFTLGSAFYSKLS--PTVALAAMLFYVAAFAISWGPVCWVLLAEIFP  398

Query  331  LRVRGRGLSIAVLVNFGTNALVTFAFSPMKE------LVGAGNvffifgviavvavifvf  170
             R+R + +S+AV   +  N LV++ F  M +          G  ++++GV+A++A +F++
Sbjct  399  NRIRSKAMSVAVAAQWIANYLVSWTFPMMDKNSYLNAHFNNGFAYWMYGVMALLAALFMW  458

Query  169  fiIPETKGLTLEEIEAKY  116
              +PETKG TLEE+EA++
Sbjct  459  KYVPETKGRTLEELEAQW  476



>ref|WP_007424295.1| MULTISPECIES: major facilitator transporter [Acidiphilium]
 gb|ABQ29692.1| sugar transporter [Acidiphilium cryptum JF-5]
 dbj|BAJ79908.1| sugar transporter [Acidiphilium multivorum AIU301]
 gb|EGO94042.1| Sugar transporter [Acidiphilium sp. PM]
Length=447

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 127/192 (66%), Gaps = 2/192 (1%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL +FQQITG  +V+Y+A  IFQ AG ++A+ +  A+  +GL+ ++MT VA+ ++D  GR
Sbjct  247  GLAVFQQITGINTVIYFAPTIFQKAGLSSASVSILATAGVGLVNVVMTFVAMRLLDSAGR  306

Query  511  rplllggvsGIAVALFLL-GSYYTFLDN-VPPVAVIALLLYVGCYQLSFGPIGWLMISEI  338
            R LLL G+SG+ V L  + G +   +   +  V VI++  YV  + +  GP+ WL+I+EI
Sbjct  307  RRLLLVGLSGMLVTLLAVAGGFMAGMQGGLAWVTVISVAAYVAFFAIGLGPVFWLLIAEI  366

Query  337  FPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIP  158
            FPL VRGRG+S+A + N+  N LV+  F  +   +G G  F I+  + ++ ++F +F++P
Sbjct  367  FPLAVRGRGMSLATIANWAFNMLVSITFLDLVHGLGRGPTFLIYAAMTLITLVFTWFLVP  426

Query  157  ETKGLTLEEIEA  122
            ETKG +LE+IEA
Sbjct  427  ETKGRSLEQIEA  438



>ref|XP_001959931.1| GF13114 [Drosophila ananassae]
 gb|EDV36753.1| GF13114 [Drosophila ananassae]
Length=894

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 69/199 (35%), Positives = 115/199 (58%), Gaps = 8/199 (4%)
 Frame = -3

Query  691  GLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgr  512
            GL+ FQQ++G  +V++Y   IF+DAG     +    +I +G++  + T +A +++DR GR
Sbjct  679  GLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNVC--TIIVGVVNFLATFIATLLIDRAGR  736

Query  511  rplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALL------LYVGCYQLSFGPIGWLM  350
            + LL      + + LF+LG ++    + P V+ +  L      +Y+  + L FGPI WLM
Sbjct  737  KILLYVSNIAMIITLFVLGGFFYCKAHGPDVSHLGWLPLSCFVIYILGFSLGFGPIPWLM  796

Query  349  ISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvf  170
            + EI P ++RG   S+A   N+    +VT  F  M +++GA   F++FG I  + + FV 
Sbjct  797  MGEILPAKIRGSAASVATAFNWTCTFVVTKTFQDMIDVMGAHGAFWLFGAICFIGLFFVI  856

Query  169  fiIPETKGLTLEEIEAKYL  113
              +PET+G TLE+IE K +
Sbjct  857  LYVPETQGKTLEDIERKMM  875



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160