BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033N10

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               353   4e-116   Ipomoea nil [qian niu]
gb|ABW69693.1|  flavonoid 3'-hydrogenase                                351   4e-115   Ipomoea purpurea
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                348   9e-114   Ipomoea purpurea
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                345   1e-112   Ipomoea batatas [batate]
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                343   8e-112   Ipomoea batatas [batate]
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               342   2e-111   Ipomoea tricolor [campanilla]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                342   2e-111   Ipomoea ternifolia
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                341   3e-111   Ipomoea batatas [batate]
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                341   5e-111   Ipomoea batatas [batate]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                339   2e-110   Ipomoea quamoclit [bejuco de cipres]
gb|ACS71532.1|  flavonoid 3' hydroxylase                                339   2e-110   Ipomoea horsfalliae [Kuhio-vine]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                337   2e-109   Ipomoea batatas [batate]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                337   2e-109   Ipomoea coccinea [red morning-glory]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               319   1e-102   Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               318   3e-102   Calystegia soldanella
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       293   1e-92    Camellia sinensis [black tea]
emb|CDP16533.1|  unnamed protein product                                290   3e-92    Coffea canephora [robusta coffee]
gb|EYU36856.1|  hypothetical protein MIMGU_mgv1a009393mg                287   3e-92    Erythranthe guttata [common monkey flower]
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                292   5e-92    Camellia nitidissima
emb|CDP19009.1|  unnamed protein product                                291   6e-92    Coffea canephora [robusta coffee]
emb|CDP19008.1|  unnamed protein product                                291   7e-92    Coffea canephora [robusta coffee]
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               288   3e-91    Glandularia x hybrida [garden verbena]
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                287   3e-90    Paeonia lactiflora [common garden peony]
gb|AJO67966.1|  flavonoid-3'-hydroxylase                                275   2e-89    Prunus avium [gean]
gb|AJO67972.1|  flavonoid-3'-hydroxylase                                275   2e-89    Prunus avium [gean]
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             284   4e-89    Callistephus chinensis [Chinese aster]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                283   7e-89    Cynara cardunculus var. scolymus [artichoke]
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              283   1e-88    Sesamum indicum [beniseed]
gb|AGG18103.1|  flavonoid 3'-hydroxylase                                275   1e-88    Prunus persica
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                282   2e-88    Osteospermum hybrid cultivar
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                282   2e-88    Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               282   4e-88    Vaccinium ashei
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               281   4e-88    Lobelia erinus
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               281   5e-88    Antirrhinum kelloggii
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      278   5e-88    Diospyros kaki [Japanese persimmon]
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                280   2e-87    Antirrhinum majus [garden snapdragon]
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       280   2e-87    Coreopsis grandiflora
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                280   2e-87    Paeonia suffruticosa [moutan peony]
gb|AGG18092.1|  flavonoid 3'-hydroxylase                                271   4e-87    Prunus armeniaca
gb|AEN71546.1|  flavanone 3'-hydroxylase                                279   4e-87    Paeonia suffruticosa [moutan peony]
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                279   4e-87    Gerbera hybrid cultivar
emb|CBI15132.3|  unnamed protein product                                277   5e-87    Vitis vinifera
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       278   5e-87    Dahlia pinnata
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                278   6e-87    Pilosella officinarum [mouse-ear hawkweed]
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                278   6e-87    Iochroma calycinum
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                278   7e-87    Iochroma calycinum
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                278   7e-87    Echinops bannaticus
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                278   1e-86    Cichorium intybus [radicchio]
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              278   1e-86    Nelumbo nucifera [Indian lotus]
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       278   1e-86    Dahlia pinnata
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                278   1e-86    Rudbeckia hirta
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    277   2e-86    Petunia x hybrida [garden petunia]
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                277   2e-86    Tagetes erecta [big marigold]
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                277   3e-86    Cosmos sulphureus [orange cosmos]
emb|CAN62275.1|  hypothetical protein VITISV_007552                     275   4e-86    Vitis vinifera
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      276   4e-86    Trifolium pratense [peavine clover]
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              276   5e-86    Prunus avium [gean]
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               276   5e-86    Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              276   6e-86    Vitis vinifera
gb|KEH32010.1|  flavonoid hydroxylase                                   276   7e-86    Medicago truncatula
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                276   7e-86    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                275   8e-86    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                276   8e-86    Penstemon neomexicanus
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                275   9e-86    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                275   9e-86    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                275   9e-86    Iochroma cyaneum
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            275   1e-85    Malus domestica [apple tree]
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               273   1e-85    Torenia hybrid cultivar
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                275   1e-85    Dahlia pinnata
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            275   1e-85    Daucus carota [carrots]
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              275   2e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         275   2e-85    Eucalyptus grandis [rose gum]
gb|AHA49900.1|  flavonoid 3' hydroxylase                                274   3e-85    Malus hybrid cultivar
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         274   4e-85    Malus domestica [apple tree]
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           274   4e-85    Vitis vinifera
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             274   4e-85    Populus trichocarpa [western balsam poplar]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                274   4e-85    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              274   4e-85    Populus euphratica
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                273   5e-85    Bidens aurea
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             273   5e-85    Prunus persica
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               273   7e-85    Vitis vinifera
gb|ACO35755.1|  chalcone 3-hydroxylase                                  273   7e-85    Cosmos sulphureus [orange cosmos]
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 273   8e-85    Theobroma cacao [chocolate]
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                273   8e-85    Nekemias grossedentata
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               273   9e-85    Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                273   1e-84    Vitis amurensis
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               273   1e-84    Gentiana triflora
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              272   1e-84    Prunus mume [ume]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  271   2e-84    
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             272   2e-84    Gossypium arboreum [tree cotton]
gb|ACR14867.1|  flavonoid 3' hydroxylase                                272   2e-84    Malus domestica [apple tree]
emb|CAN68303.1|  hypothetical protein VITISV_041731                     271   2e-84    Vitis vinifera
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                272   2e-84    Penstemon barbatus
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                271   3e-84    Fragaria x ananassa
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                271   4e-84    Fragaria x ananassa
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              271   4e-84    Nicotiana sylvestris
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              271   4e-84    Nicotiana tabacum [American tobacco]
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                271   4e-84    Fragaria chiloensis
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               271   4e-84    Gynura bicolor
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                271   4e-84    Fragaria vesca [alpine strawberry]
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                271   5e-84    Gossypium hirsutum [American cotton]
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                271   5e-84    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                270   7e-84    Gossypium hirsutum [American cotton]
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              270   8e-84    Pyrus x bretschneideri [bai li]
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               270   9e-84    Fragaria x ananassa
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                270   9e-84    Centaurea cyanus [bachelor's-button]
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                270   1e-83    Pyrus pyrifolia [sha li]
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              270   1e-83    Cichorium intybus [radicchio]
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      270   1e-83    Pelargonium x hortorum [bedding geranium]
gb|AFK73718.1|  cytochrome P450                                         269   1e-83    Papaver somniferum
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                270   2e-83    Ageratina adenophora
gb|KJB51032.1|  hypothetical protein B456_008G198200                    270   2e-83    Gossypium raimondii
ref|NP_001274347.1|  uncharacterized protein LOC101314754               270   2e-83    Fragaria vesca [alpine strawberry]
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    270   2e-83    Nicotiana sylvestris
gb|AJA79074.1|  flavonoid 3' hydroxylase                                269   2e-83    Prunus persica
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         269   3e-83    Solanum tuberosum [potatoes]
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                269   4e-83    Epimedium sagittatum
gb|AGI16386.1|  flavonoid 3' hydroxylase                                269   4e-83    Ribes nigrum [European black currant]
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         268   5e-83    Eucalyptus grandis [rose gum]
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           268   5e-83    Medicago truncatula
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         268   5e-83    
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               267   7e-83    Rhododendron x pulchrum
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                268   7e-83    Fragaria virginiana
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                267   1e-82    Viola x wittrockiana
gb|KEH33153.1|  flavonoid hydroxylase                                   267   1e-82    Medicago truncatula
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     266   1e-82    Eucalyptus grandis [rose gum]
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 267   1e-82    
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     266   2e-82    Eucalyptus grandis [rose gum]
gb|AJD25177.1|  cytochrome P450 CYP75B79                                267   2e-82    Salvia miltiorrhiza [Chinese salvia]
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              267   2e-82    Nicotiana tomentosiformis
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             267   2e-82    Phaseolus vulgaris [French bean]
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                266   2e-82    Fragaria x ananassa
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              266   3e-82    Echinops bannaticus
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               266   4e-82    Perilla frutescens var. crispa
gb|AGC29948.1|  CYP75B65                                                266   4e-82    Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                264   5e-82    Meconopsis quintuplinervia
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                266   5e-82    Nicotiana tabacum [American tobacco]
gb|AAO47857.1|  flavonoid 3'-hydroxylase                                260   6e-82    Glycine max [soybeans]
gb|AGL81348.1|  flavanone 3' hydroxylase                                265   1e-81    Pyrus communis
gb|AJD25178.1|  cytochrome P450 CYP75B80                                265   1e-81    Salvia miltiorrhiza [Chinese salvia]
gb|AEX07282.1|  F3'H                                                    265   1e-81    Arachis hypogaea [goober]
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         265   1e-81    Eucalyptus grandis [rose gum]
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         265   1e-81    Phoenix dactylifera
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         264   2e-81    Solanum lycopersicum
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                262   2e-81    Papaver radicatum
gb|AJF48886.1|  flavonoid 3'-hydroxylase                                255   3e-81    Paeonia suffruticosa [moutan peony]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                263   3e-81    Chromolaena odorata
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         263   6e-81    Jatropha curcas
gb|AIB06740.1|  flavanone 3'-hydroxylase                                263   6e-81    Mangifera indica
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                261   1e-80    Meconopsis lancifolia
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                260   2e-80    Meconopsis pseudohorridula
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              261   2e-80    Morus notabilis
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         262   2e-80    Nelumbo nucifera [Indian lotus]
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                261   2e-80    Meconopsis punicea [red poppywort]
gb|AAO47851.1|  flavonoid 3'-hydroxylase                                256   2e-80    Glycine max [soybeans]
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         261   2e-80    Morus notabilis
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              261   3e-80    Osteospermum hybrid cultivar
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              261   3e-80    Glycine soja [wild soybean]
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                261   4e-80    Garcinia mangostana [mangosteen]
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                258   7e-80    Papaver nudicaule [Arctic poppy]
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         260   8e-80    Elaeis guineensis
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         259   1e-79    Elaeis guineensis
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         259   1e-79    Camelina sativa [gold-of-pleasure]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           259   2e-79    Glycine max [soybeans]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                259   2e-79    Glycine max [soybeans]
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                258   2e-79    Meconopsis horridula [prickly blue-poppy]
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              259   2e-79    Camelina sativa [gold-of-pleasure]
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               258   2e-79    Tricyrtis hirta
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               258   4e-79    Dianthus caryophyllus [carnation]
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             258   6e-79    Eutrema salsugineum [saltwater cress]
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                256   7e-79    Meconopsis delavayi
gb|ADE80872.1|  flavonoid 3'-hydroxylase                                246   8e-79    Cyclamen persicum
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             257   9e-79    Capsella rubella
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               257   1e-78    Torenia hybrid cultivar
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         257   1e-78    Phoenix dactylifera
gb|AGL98409.1|  flavonoid 3'-hydroxylase                                248   1e-78    Tulipa fosteriana
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         256   2e-78    Camelina sativa [gold-of-pleasure]
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                256   4e-78    Erythranthe guttata [common monkey flower]
gb|AHB18038.1|  flavonoid 3'-hydroxylase                                249   5e-78    Anthurium andraeanum [flamingo-lily]
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               255   5e-78    Dianthus caryophyllus [carnation]
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   255   6e-78    Callistephus chinensis [Chinese aster]
ref|XP_003598947.1|  Flavonoid 3'-hydroxylase                           248   7e-78    
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              255   9e-78    
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             254   1e-77    
gb|AES69199.2|  flavonoid hydroxylase                                   254   2e-77    Medicago truncatula
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            254   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                252   2e-77    Meconopsis henrici
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               252   3e-77    Lilium hybrid division I
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              253   4e-77    Brassica rapa
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             253   6e-77    
gb|EMT05634.1|  Flavonoid 3'-monooxygenase                              244   8e-77    
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                252   1e-76    Allium cepa
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         252   1e-76    Citrus sinensis [apfelsine]
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                251   2e-76    Iris x hollandica [Dutch iris]
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              250   2e-76    Morus notabilis
emb|CDX99037.1|  BnaC09g47980D                                          256   3e-76    
emb|CDX69984.1|  BnaA10g23330D                                          251   3e-76    
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               251   3e-76    Lilium hybrid division I
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           253   3e-76    
ref|XP_007155244.1|  hypothetical protein PHAVU_003G1855001g            245   4e-76    Phaseolus vulgaris [French bean]
ref|XP_007155243.1|  hypothetical protein PHAVU_003G1855001g            246   5e-76    Phaseolus vulgaris [French bean]
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                248   5e-76    Meconopsis integrifolia [Farrer's lampshade-poppy]
ref|XP_007155245.1|  hypothetical protein PHAVU_003G1855001g            246   6e-76    Phaseolus vulgaris [French bean]
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      250   6e-76    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         251   6e-76    Brachypodium distachyon [annual false brome]
ref|NP_001141292.1|  uncharacterized protein LOC100273383               248   7e-76    
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         249   9e-76    
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         249   1e-75    Glycine max [soybeans]
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                249   1e-75    Brassica napus [oilseed rape]
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               249   1e-75    Lilium hybrid division I
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              249   1e-75    Glycine soja [wild soybean]
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      249   1e-75    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                249   2e-75    Anthurium andraeanum [flamingo-lily]
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                247   2e-75    Meconopsis racemosa
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    244   2e-75    
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      248   2e-75    Matthiola incana
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             248   4e-75    Pericallis cruenta
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                248   4e-75    Tulipa fosteriana
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         248   5e-75    Morus notabilis
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                246   6e-75    Meconopsis wilsonii
gb|AFP95893.1|  F3'H                                                    248   6e-75    Narcissus tazetta
gb|AFW72123.1|  red aleurone1                                           247   1e-74    
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                244   2e-74    Meconopsis betonicifolia [Himalayan blue-poppy]
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              246   2e-74    Pericallis cruenta
gb|ABC48911.1|  flavonoid 3'-hydroxylase                                239   3e-74    Vitis vinifera
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         246   4e-74    Cucumis sativus [cucumbers]
gb|ABC48912.1|  flavonoid 3'-hydroxylase                                239   4e-74    Vitis vinifera
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                244   4e-74    Meconopsis simplicifolia
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              245   4e-74    Glycine soja [wild soybean]
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    245   5e-74    Glycine max [soybeans]
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         245   7e-74    Oryza brachyantha
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                244   7e-74    Sorghum bicolor [broomcorn]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          244   7e-74    Sorghum bicolor [broomcorn]
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              244   8e-74    Billardiera heterophylla
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          244   9e-74    
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         244   9e-74    Glycine max [soybeans]
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         244   1e-73    Zea mays [maize]
gb|AAX51195.1|  cytochrome p450                                         234   2e-73    Ageratina adenophora
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                244   2e-73    Sorghum bicolor [broomcorn]
gb|ABC48913.1|  flavonoid 3'-hydroxylase                                237   2e-73    Vitis vinifera
ref|NP_001064338.1|  Os10g0320100                                       243   3e-73    
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                243   4e-73    Sorghum bicolor [broomcorn]
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         242   5e-73    
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              242   6e-73    Cucumis melo [Oriental melon]
gb|EMT22073.1|  Flavonoid 3'-monooxygenase                              236   7e-73    
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                241   8e-73    Cucumis sativus [cucumbers]
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                239   1e-72    Meconopsis zangnanensis
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                239   1e-72    Meconopsis paniculata
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                238   2e-72    Meconopsis gracilipes
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                240   4e-72    Sorghum bicolor [broomcorn]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          240   4e-72    Sorghum bicolor [broomcorn]
gb|AGG40645.1|  flavanone 3'-hydroxylase                                240   7e-72    Narcissus tazetta
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              240   8e-72    Iris x hollandica [Dutch iris]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         238   3e-71    Setaria italica
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          238   3e-71    Sorghum bicolor [broomcorn]
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            244   8e-71    
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         236   1e-70    
dbj|BAJ95115.1|  predicted protein                                      237   1e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY78004.1|  hypothetical protein OsI_33044                          236   2e-70    Oryza sativa Indica Group [Indian rice]
ref|NP_001064333.1|  Os10g0317900                                       236   2e-70    
gb|ACG38346.1|  flavonoid 3-monooxygenase                               236   3e-70    Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         236   3e-70    
ref|NP_001146311.1|  uncharacterized protein LOC100279887               236   3e-70    Zea mays [maize]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              234   6e-70    Indosasa hispida
gb|AII26680.1|  flavonoid 3'-hydroxylase                                234   7e-70    Indosasa hispida
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          233   1e-69    
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         234   2e-69    Brachypodium distachyon [annual false brome]
gb|AEF33624.1|  flavonoid 3' hydroxylase                                232   5e-69    Zea mays [maize]
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              230   3e-68    Glycine soja [wild soybean]
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         230   4e-68    
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         228   2e-67    Brachypodium distachyon [annual false brome]
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   8e-67    
dbj|BAJ98136.1|  predicted protein                                      224   7e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16821.1|  unknown                                                 224   8e-66    Picea sitchensis
gb|ABQ81928.1|  flavonoid 3-hydroxylase                                 213   2e-65    Brassica rapa var. purpuraria [purple stem mustard]
gb|AIS35917.1|  flavonoid 3'-hydroxylase                                220   5e-65    Phalaenopsis equestris
gb|EEE50732.1|  hypothetical protein OsJ_31043                          221   6e-65    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93256.1|  predicted protein                                      221   1e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO47849.1|  flavonoid 3'-hydroxylase                                208   2e-64    Glycine max [soybeans]
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              216   4e-63    
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             214   3e-62    
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    212   3e-61    
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            211   3e-61    
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            211   3e-61    
ref|XP_009788708.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           206   3e-61    
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            211   5e-61    
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             211   6e-61    
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             211   6e-61    
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            210   8e-61    
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            211   8e-61    
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            211   9e-61    
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             210   1e-60    
gb|EMT24088.1|  Flavonoid 3'-monooxygenase                              200   2e-60    
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            209   2e-60    
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        209   2e-60    
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             209   3e-60    
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             207   8e-60    
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             207   8e-60    
ref|XP_007146137.1|  hypothetical protein PHAVU_006G015400g             207   1e-59    
gb|ABG76002.1|  flavonoid-3',5'-hydroxylase                             199   1e-59    
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            207   2e-59    
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             206   2e-59    
gb|ADQ12778.1|  cytochrome P450                                         197   2e-59    
gb|ADQ12769.1|  cytochrome P450                                         197   3e-59    
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         206   3e-59    
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            206   4e-59    
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   206   6e-59    
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             206   6e-59    
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      206   6e-59    
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              205   6e-59    
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             205   6e-59    
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            205   6e-59    
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     205   7e-59    
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      205   7e-59    
gb|KEH33357.1|  flavonoid hydroxylase                                   205   8e-59    
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     205   8e-59    
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        205   9e-59    
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            204   1e-58    
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              205   1e-58    
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             205   1e-58    
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       205   1e-58    
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            204   1e-58    
gb|ADQ12772.1|  cytochrome P450                                         195   2e-58    
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            204   2e-58    
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            204   2e-58    
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      204   2e-58    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            204   2e-58    
gb|ADQ12775.1|  cytochrome P450                                         195   2e-58    
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            204   2e-58    
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             204   2e-58    
dbj|BAJ16337.1|  flavonoid 3' hydroxylase-like protein                  192   3e-58    
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             204   3e-58    
gb|KJB09328.1|  hypothetical protein B456_001G134900                    204   3e-58    
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              203   3e-58    
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             203   3e-58    
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             203   3e-58    
ref|XP_010905625.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      203   4e-58    
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      203   4e-58    
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            203   5e-58    
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      203   5e-58    
dbj|BAJ16338.1|  flavonoid 3' 5'-hydroxylase-like protein               197   5e-58    
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            203   5e-58    
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            203   6e-58    
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            202   8e-58    
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            202   8e-58    
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            202   8e-58    
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    202   9e-58    
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    202   9e-58    
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    202   9e-58    
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            202   9e-58    
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            202   1e-57    
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              202   1e-57    
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      202   1e-57    
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             202   1e-57    
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            202   1e-57    
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             202   1e-57    
ref|XP_010651674.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      199   1e-57    
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             202   1e-57    
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            202   1e-57    
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    202   1e-57    
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 202   1e-57    
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           202   1e-57    
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            202   1e-57    
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      201   2e-57    
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             201   2e-57    
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                200   2e-57    
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             201   3e-57    
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             201   3e-57    
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            201   3e-57    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    201   4e-57    
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   201   4e-57    
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            201   4e-57    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            201   4e-57    
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            201   4e-57    
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              200   4e-57    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             200   5e-57    
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            200   5e-57    
gb|AGC74041.1|  flavonoid-3',5'-hydroxylase                             200   6e-57    
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            200   6e-57    
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            200   6e-57    
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            200   7e-57    
emb|CAN62887.1|  hypothetical protein VITISV_025543                     199   8e-57    
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            199   8e-57    
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             199   9e-57    
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            199   9e-57    
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           199   1e-56    
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              199   1e-56    
gb|AEE65378.1|  flavonoid 3',5'-hydroxylase                             199   1e-56    
gb|AAS91654.1|  flavonoid 3'-hydroxylase                                188   1e-56    
dbj|BAF96937.1|  flavonoid 3'-hydroxylase                               189   1e-56    
ref|XP_002280662.2|  PREDICTED: flavonoid 3',5'-hydroxylase 2           199   1e-56    
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           199   1e-56    
ref|XP_003632212.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      199   2e-56    
emb|CAN82588.1|  hypothetical protein VITISV_038260                     199   2e-56    
ref|XP_010932509.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      199   2e-56    
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             199   2e-56    
gb|ABC72066.1|  flavonoid 3',5'-hydroxylase                             198   2e-56    
ref|NP_001268164.1|  uncharacterized protein LOC100261319               199   2e-56    
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           198   3e-56    
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              198   3e-56    
gb|EMS55165.1|  Flavonoid 3'-monooxygenase                              189   4e-56    
dbj|BAJ23912.1|  flavonoid 3',5'-hydroxylase                            197   5e-56    
gb|ABC86841.1|  flavonoid 3',5'-hydroxylase                             197   5e-56    
gb|ABR17122.1|  unknown                                                 196   6e-56    
ref|XP_010651527.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      197   6e-56    
ref|XP_010932510.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        197   6e-56    
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    197   6e-56    
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        197   7e-56    
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                197   7e-56    
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      197   7e-56    
gb|KHN23927.1|  Flavonoid 3',5'-hydroxylase 1                           193   8e-56    
dbj|BAF49322.1|  flavonoid 3',5'-hydroxylase                            198   8e-56    
dbj|BAF49320.1|  flavonoid 3',5'-hydroxylase                            198   9e-56    
ref|XP_010922088.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      197   1e-55    
dbj|BAH89260.1|  putative flavonoid 3'5'-hydroxylase fragment           187   1e-55    
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           197   1e-55    
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           196   1e-55    
ref|NP_001268157.1|  flavonoid-3,5'-hydroxylase                         196   1e-55    
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             196   2e-55    
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            196   2e-55    
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             196   2e-55    
ref|XP_010651675.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      197   2e-55    
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             196   2e-55    
emb|CAN82604.1|  hypothetical protein VITISV_005589                     195   2e-55    
ref|XP_010922089.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      196   2e-55    
gb|ABR16345.1|  unknown                                                 196   2e-55    
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      196   2e-55    
gb|ABR16655.1|  unknown                                                 196   2e-55    
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             196   3e-55    
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    196   3e-55    
emb|CAN81079.1|  hypothetical protein VITISV_007550                     196   3e-55    
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             196   3e-55    
ref|XP_010922086.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        195   3e-55    
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             196   4e-55    
gb|ACN40555.1|  unknown                                                 195   4e-55    
dbj|BAF49319.1|  flavonoid 3',5'-hydroxylase                            196   4e-55    
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             196   4e-55    
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             195   5e-55    
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           195   5e-55    
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            195   7e-55    
ref|XP_008788485.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      194   8e-55    
emb|CAN61852.1|  hypothetical protein VITISV_020443                     194   9e-55    
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             194   1e-54    
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            194   1e-54    
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           194   1e-54    
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            194   1e-54    
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             194   1e-54    
emb|CAN60359.1|  hypothetical protein VITISV_034723                     194   2e-54    
ref|XP_010512836.1|  PREDICTED: cytochrome P450 76C4-like               184   2e-54    
emb|CBI30128.3|  unnamed protein product                                194   3e-54    
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             192   4e-54    
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    192   4e-54    
emb|CAN80142.1|  hypothetical protein VITISV_038979                     191   8e-54    
gb|ACH59623.1|  flavenoid 3-hydroxylase                                 181   8e-54    
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             191   1e-53    
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             191   1e-53    
ref|XP_008789234.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like ...    191   2e-53    
ref|XP_008389814.1|  PREDICTED: geraniol 8-hydroxylase-like             191   2e-53    
gb|ACH59632.1|  flavenoid 3-hydroxylase                                 181   2e-53    
gb|ACH59639.1|  flavenoid 3-hydroxylase                                 181   2e-53    
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             191   2e-53    
ref|XP_009383876.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      191   2e-53    
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             190   3e-53    
sp|O04773.1|C75A6_CAMME  RecName: Full=Flavonoid 3',5'-hydroxylas...    190   3e-53    
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      190   4e-53    
ref|XP_010105780.1|  Cytochrome P450 76C2                               188   5e-53    
ref|XP_009417895.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      189   6e-53    
gb|ACH59618.1|  flavenoid 3-hydroxylase                                 179   8e-53    
ref|XP_009386727.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      189   8e-53    
ref|NP_001144946.1|  uncharacterized protein LOC100278079               181   9e-53    
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             189   1e-52    
gb|EAZ43969.1|  hypothetical protein OsJ_28590                          180   1e-52    
ref|XP_010544666.1|  PREDICTED: cytochrome P450 76C4-like               189   1e-52    
ref|XP_010687564.1|  PREDICTED: cytochrome P450 76C4-like isoform X2    181   1e-52    
ref|NP_001268152.1|  ripening-related P-450 enzyme-like                 188   2e-52    
gb|ABF96137.1|  Flavonoid 3',5'-hydroxylase 1, putative, expressed      180   2e-52    
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...    188   2e-52    
gb|ACH59637.1|  flavenoid 3-hydroxylase                                 177   2e-52    
ref|XP_010687563.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    181   3e-52    
gb|EAY90148.1|  hypothetical protein OsI_11713                          179   3e-52    
ref|XP_006650116.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        179   3e-52    
gb|ACH59617.1|  flavenoid 3-hydroxylase                                 177   3e-52    
gb|EMT31530.1|  Flavonoid 3',5'-hydroxylase 1                           183   5e-52    
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    187   5e-52    
gb|EMT12133.1|  Flavonoid 3',5'-hydroxylase                             178   6e-52    
ref|XP_008660132.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        179   6e-52    
ref|XP_010910221.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      187   6e-52    
gb|KCW72821.1|  hypothetical protein EUGRSUZ_E01263                     185   7e-52    
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               187   7e-52    
gb|EMS47893.1|  Flavonoid 3',5'-hydroxylase 2                           184   8e-52    
gb|ACH59626.1|  flavenoid 3-hydroxylase                                 176   9e-52    
ref|XP_008389819.1|  PREDICTED: geraniol 8-hydroxylase-like             186   1e-51    
ref|XP_008798387.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      186   1e-51    
gb|ACH59624.1|  flavenoid 3-hydroxylase                                 176   1e-51    
dbj|BAK03886.1|  predicted protein                                      186   2e-51    
ref|XP_010506515.1|  PREDICTED: cytochrome P450 76C4-like               186   2e-51    
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             186   2e-51    
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      185   2e-51    
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                  185   3e-51    
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like             185   3e-51    



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   353 bits (907),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA
Sbjct  349  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA
Sbjct  409  RDPNVWTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  469  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA
Sbjct  349  LVTESDLTHLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA
Sbjct  409  RDPNVWTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  469  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   348 bits (892),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA
Sbjct  349  LVTESDLTHLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEF PHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA
Sbjct  409  RDPNVWTNPLEFKPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL+NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  469  TLVHAFDWDLMNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRM AQ CEINGYFIPKGATLLVNVWAIA
Sbjct  347  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMAAQSCEINGYFIPKGATLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRIC+GMSLGIRMVHLL+A
Sbjct  407  RDPNVWTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICTGMSLGIRMVHLLIA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  467  TLVHAFDWDLGNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  517



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   343 bits (879),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRM AQ CEINGYFIPKGATLLVNVWAIA
Sbjct  348  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMAAQSCEINGYFIPKGATLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
             DPNV TNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLL+A
Sbjct  408  LDPNVWTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLIA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSVETLNMEEAYGLTLQRA+PLMLHPKPRLQPHLYTLN
Sbjct  468  TLVHAFDWDLGNGQSVETLNMEEAYGLTLQRAIPLMLHPKPRLQPHLYTLN  518



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRMGA+ CEINGYFIPKGATLLVNVWAIA
Sbjct  352  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMGAESCEINGYFIPKGATLLVNVWAIA  411

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA
Sbjct  412  RDPNVWTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  471

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDW LV+GQSV+TLNMEEAYGLTLQRAVPLMLHPKPRLQPH+YTLN
Sbjct  472  TLVHAFDWGLVDGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHIYTLN  522



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPR+GA+ CEINGYFIPKGATLLVNVWAIA
Sbjct  349  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRIGAESCEINGYFIPKGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN  TNPLEFNPHRFLPGGEK +VDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLL+A
Sbjct  409  RDPNAWTNPLEFNPHRFLPGGEKASVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLIA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  469  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRM AQ CEINGYFIPKGATLLVNVWAIA
Sbjct  348  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMAAQSCEINGYFIPKGATLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
             DPNV TNPLEFNPHRFLPGG+KPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLL+A
Sbjct  408  LDPNVWTNPLEFNPHRFLPGGDKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLIA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSVETLNMEEAYGLTLQRA+PLMLHPKPRLQPHLYTLN
Sbjct  468  TLVHAFDWDLGNGQSVETLNMEEAYGLTLQRAIPLMLHPKPRLQPHLYTLN  518



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   341 bits (874),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRM AQ CEINGYFIPKGATLLVNVWAIA
Sbjct  348  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMAAQSCEINGYFIPKGATLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNP+RFLPGGEKP+VDIKGNDFEVIPFGAGRRIC+GMSLGIRMVHLL+A
Sbjct  408  RDPNVWTNPLEFNPNRFLPGGEKPSVDIKGNDFEVIPFGAGRRICTGMSLGIRMVHLLIA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  468  TLVHAFDWDLGNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  518



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPR+GA+ CEINGYFIPKGATLLVNVWAIA
Sbjct  349  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRIGAESCEINGYFIPKGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN  TNPL+FNP+RFLPGGEK NVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLL+A
Sbjct  409  RDPNAWTNPLQFNPNRFLPGGEKTNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLIA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDLVNGQSVETLNMEE+YGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  469  TLVHAFDWDLVNGQSVETLNMEESYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRMGA+ CEINGYFIPKGA LLVNVWAIA
Sbjct  347  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMGAESCEINGYFIPKGARLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNP RFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA
Sbjct  407  RDPNVWTNPLEFNPDRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSV+TLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  467  TLVHAFDWDLGNGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  517



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPRM AQ CEINGYFIPKGATL VNVWAIA
Sbjct  348  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRMAAQSCEINGYFIPKGATLPVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV TNPLEFNP+RFLPGGEKP+VDIKGNDFEVIPFGAGRRIC+GMSLGIRMVHLL+A
Sbjct  408  RDPNVWTNPLEFNPNRFLPGGEKPSVDIKGNDFEVIPFGAGRRICTGMSLGIRMVHLLIA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  468  TLVHAFDWDLGNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  518



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT LPFLQAIVKETFRLHPSTPLSLPR+GA+ C+INGYFIPKGATLLVNVWAIA
Sbjct  349  LVTESDLTQLPFLQAIVKETFRLHPSTPLSLPRIGAESCKINGYFIPKGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN  TNPLEFNP RFLPGGEK NVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA
Sbjct  409  RDPNAWTNPLEFNPRRFLPGGEKTNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVHAFDWDL NGQSVETLNMEEAYGLTLQR VPLMLHPKPRLQPHLYTLN
Sbjct  469  TLVHAFDWDLANGQSVETLNMEEAYGLTLQRVVPLMLHPKPRLQPHLYTLN  519



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +VTE DL  LPF QAIVKETFRLHPSTPLSLPRM ++ CEINGYFIPKGATLLVNVWAIA
Sbjct  352  VVTEPDLAQLPFTQAIVKETFRLHPSTPLSLPRMASENCEINGYFIPKGATLLVNVWAIA  411

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV T+PLEFNP RFLPGGEKP+VDIKGNDFEVIPFGAGRRICSGMSLG+RMVHLL+A
Sbjct  412  RDPNVWTDPLEFNPARFLPGGEKPSVDIKGNDFEVIPFGAGRRICSGMSLGLRMVHLLIA  471

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TL+H+FDWDL +GQS+ETLNMEEAYGLTLQRAVPLM+HPKPRLQPHLY+
Sbjct  472  TLIHSFDWDLASGQSIETLNMEEAYGLTLQRAVPLMVHPKPRLQPHLYS  520



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +VTE DL  LPF QAIVKETFRLHPSTPLSLPRM ++ CEINGYFIPKGATLLVNVWAIA
Sbjct  352  VVTEPDLAQLPFTQAIVKETFRLHPSTPLSLPRMASENCEINGYFIPKGATLLVNVWAIA  411

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV T+PLEFNP RFLPGGEKP+VDIKGNDFEVIPFGAGRRICSGMSLG+RMVHLL+A
Sbjct  412  RDPNVWTDPLEFNPARFLPGGEKPSVDIKGNDFEVIPFGAGRRICSGMSLGLRMVHLLIA  471

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TL+H+FDWDLV+GQS+ETLNMEEAYGLTLQRAVPLM+HPKPRLQPH Y+
Sbjct  472  TLIHSFDWDLVSGQSIETLNMEEAYGLTLQRAVPLMVHPKPRLQPHQYS  520



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            VTESDL  L FLQAI+KETFRLHPSTPLSLPRM +  CEINGYFIPKG+TLLVNVWAIAR
Sbjct  350  VTESDLAQLTFLQAIIKETFRLHPSTPLSLPRMASDSCEINGYFIPKGSTLLVNVWAIAR  409

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+    PLEF P RFLPGGEKPN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL AT
Sbjct  410  DPDAWAEPLEFRPERFLPGGEKPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTAT  469

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            LVHAFDWDL +GQS E LNM+EAYGLTLQRA PLM+HP PRL PH+Y
Sbjct  470  LVHAFDWDLADGQSTEKLNMDEAYGLTLQRAAPLMVHPWPRLAPHVY  516



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE+DL  L FLQAIVKETFRLHPSTPLSLPR+ A+ CEINGYFIPKG+TLLVNVWAIA
Sbjct  283  LVTEADLPRLTFLQAIVKETFRLHPSTPLSLPRIAAENCEINGYFIPKGSTLLVNVWAIA  342

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  343  RDPDMWADPLEFRPGRFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  402

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +L+H FDWDL NGQ  E LNMEEAYGLTLQRA PLM+HP+PRL+PH Y
Sbjct  403  SLIHGFDWDLPNGQVAEKLNMEEAYGLTLQRASPLMVHPRPRLKPHSY  450



>gb|EYU36856.1| hypothetical protein MIMGU_mgv1a009393mg [Erythranthe guttata]
Length=343

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT L FLQA++KETFRLHPSTPLSLPR+  + CE+NGYFIPKG+TLLVNVWAIA
Sbjct  173  LVTESDLTQLSFLQAVIKETFRLHPSTPLSLPRISDKSCEVNGYFIPKGSTLLVNVWAIA  232

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  ++PLEF P RFL GGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  233  RDPDAWSDPLEFKPERFLMGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  292

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFD++L NGQ  ETLNMEEAYGLTLQR  PL +HPKPRL PHLY
Sbjct  293  TLIHAFDFELANGQLPETLNMEEAYGLTLQRDEPLSVHPKPRLAPHLY  340



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            VTESDL  L FLQAI+KETFRLHPSTPLSLPRM +  CEINGYFIPKG+TLLVNVWAIAR
Sbjct  350  VTESDLAQLTFLQAIIKETFRLHPSTPLSLPRMASDSCEINGYFIPKGSTLLVNVWAIAR  409

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+    PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL AT
Sbjct  410  DPDAWAEPLEFRPERFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTAT  469

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            LVHAF+WDL +GQS E L M+EAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  470  LVHAFNWDLADGQSAEKLKMDEAYGLTLQRAAPLMVHPRPRLAPHVY  516



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT++DL  L F+QAIVKE FRLHPSTPLSLPRM  + CEINGYFIPKG+TLLVNVWAIA
Sbjct  344  LVTDADLPKLTFIQAIVKEAFRLHPSTPLSLPRMATENCEINGYFIPKGSTLLVNVWAIA  403

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  404  RDPDIWADPLEFRPERFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGVRMVQLLTA  463

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDWDL NGQ  E LNMEEAYGLTLQRA PLM+HPKPRL P++Y
Sbjct  464  TLIHAFDWDLPNGQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT++DL  L F+QAIVKE FRLHPSTPLSLPRM  + CEINGYFIPKG+TLLVNVWAIA
Sbjct  344  LVTDADLPKLTFIQAIVKEAFRLHPSTPLSLPRMATENCEINGYFIPKGSTLLVNVWAIA  403

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  404  RDPDIWADPLEFRPERFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGVRMVQLLTA  463

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDWDL NGQ  E LNMEEAYGLTLQRA PLM+HPKPRL P++Y
Sbjct  464  TLIHAFDWDLPNGQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +V+ESDLT LPFLQAIVKETFRLHPSTPLSLPR+  + CEINGYFIPKG+TLLVNVWAIA
Sbjct  290  VVSESDLTQLPFLQAIVKETFRLHPSTPLSLPRIAEKSCEINGYFIPKGSTLLVNVWAIA  349

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV  +PLEF P RF+PGGEKPNVD+KGNDFE+IPFGAGRRIC+GMSLGIRMV LL A
Sbjct  350  RDPNVWADPLEFRPERFMPGGEKPNVDVKGNDFELIPFGAGRRICAGMSLGIRMVQLLTA  409

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
             L+H FD++L NG S + L+MEEAYGLTLQRA PL++HPKPRL PH+Y
Sbjct  410  NLIHGFDFELGNGLSAQQLSMEEAYGLTLQRAEPLVVHPKPRLAPHVY  457



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +LPFLQA+VKETFRLHPSTPLSLPRM +Q CEINGY+IPKG+TLLVNVWAIA
Sbjct  340  LVTELDLPNLPFLQAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV   PLEF P RFLPGGEKPN+DIKGNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  400  RDPNVWAEPLEFRPDRFLPGGEKPNIDIKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ  E L MEEAYGLTLQRAVPL+L+P+PRL  H+Y
Sbjct  460  TLVHAFDWGLPEGQIPEKLQMEEAYGLTLQRAVPLVLYPQPRLSSHVY  507



>gb|AJO67966.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=208

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  36   LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASENCEINGFHIPKGATLLVNVWAIS  95

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  96   RDPEQWKDPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  155

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  156  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  203



>gb|AJO67972.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=209

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  37   LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASENCEINGFHIPKGATLLVNVWAIS  96

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  97   RDPEQWKDPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  156

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  157  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  204



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKETFRLHPSTPLSLPRM ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  348  LVTELDLSRLTFLQAIVKETFRLHPSTPLSLPRMASESCEVDGYYIPKGSTLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + TNPLEF P RFLPGGEKP+ DIKGNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  408  RDPKMWTNPLEFRPSRFLPGGEKPDADIKGNDFEVIPFGAGRRICAGMSLGMRMVQLLIA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  468  TLVQTFDWELANGLDPEKLNMEEAYGLTLQRAEPLMVHPRPRLSPHVY  515



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL+ L FL+AIVKETFRLHPSTPLSLPR+ ++ CE+NGY+IPKG+TLLVNVWAIA
Sbjct  342  LVSELDLSRLTFLEAIVKETFRLHPSTPLSLPRIASESCEVNGYYIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPN ++KGNDFE+IPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  402  RDPKMWTDPLEFRPSRFLPGGEKPNANVKGNDFEIIPFGAGRRICAGMSLGLRMVQLLIA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +LVHAFDW+L NG   E LNMEEAYGLTLQRA PLM+HP PRL PHLY
Sbjct  462  SLVHAFDWELANGLDPEKLNMEEAYGLTLQRAAPLMVHPSPRLAPHLY  509



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V ESDL  L FLQA+VKE FRLHPSTPLSLPRM  + CEINGYFIPKG+TLLVNVWAIAR
Sbjct  343  VLESDLPQLHFLQAVVKENFRLHPSTPLSLPRMADESCEINGYFIPKGSTLLVNVWAIAR  402

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP++ +NPLEF P RFLPGGE+P VD+KGNDFE+IPFGAGRR+C+GMSLGIRMV LL+AT
Sbjct  403  DPDLWSNPLEFQPARFLPGGERPVVDVKGNDFELIPFGAGRRVCAGMSLGIRMVQLLIAT  462

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            L+HAFD+DL +GQ  ETL+MEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  LIHAFDFDLADGQLAETLSMEEAYGLTLQRAEPLMVHPKPRLAPHVY  509



>gb|AGG18103.1| flavonoid 3'-hydroxylase, partial [Prunus persica]
Length=264

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM ++ CEIN + IPKGATLLVNVWAI+
Sbjct  92   LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINSFHIPKGATLLVNVWAIS  151

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  152  RDPEQWKEPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  211

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  212  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  259



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DLT LPFLQAIVKETFRLHPSTPLSLPR+ ++ CE+NGY IPKG+TLLVNVWAIA
Sbjct  344  LVTELDLTQLPFLQAIVKETFRLHPSTPLSLPRIASESCEVNGYHIPKGSTLLVNVWAIA  403

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + + PLEF P RFLPGGEKP+ D+KGNDFEVIPFGAGRR C+GMSLG+RMV LLVA
Sbjct  404  RDPKMWSEPLEFRPARFLPGGEKPDADVKGNDFEVIPFGAGRRSCAGMSLGLRMVQLLVA  463

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PL++HPKPRL PH+Y  N
Sbjct  464  TLVQTFDWELANGLKPEKLNMEEAYGLTLQRAAPLLVHPKPRLAPHVYGSN  514



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L FLQA++KETFRLHPSTPLSLPRM ++GCEINGY IPKG+TLLVNVW+IA
Sbjct  350  LVTESDLPQLAFLQAVIKETFRLHPSTPLSLPRMASEGCEINGYSIPKGSTLLVNVWSIA  409

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  410  RDPSIWADPLEFRPSRFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  469

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH+F+WDL+NG S + L+MEEAYGLTLQRA PL++HPKPRL   +Y
Sbjct  470  TLVHSFNWDLLNGMSPDKLDMEEAYGLTLQRASPLIVHPKPRLASSMY  517



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE+DL  L +LQA++KETFRLHPSTPLSLPRM A+ CEINGYFIPKG+TLLVNVWAIA
Sbjct  348  LVTEADLAQLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYFIPKGSTLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    NPLEF P RFLPGGE+PN DI+GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  408  RDPEAWDNPLEFKPERFLPGGERPNADIRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH+F+WDL  G+  E LNM+EAYGLTLQRA PLM+HP+PR   H+Y
Sbjct  468  TLVHSFNWDLPEGKLAEKLNMDEAYGLTLQRAEPLMVHPRPRFGAHVY  515



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ L F QAI+KETFRLHPSTPLSLPRM A+ CEINGYFIPKG+T+LVNVWAIA
Sbjct  346  LVSESDLSQLTFFQAIIKETFRLHPSTPLSLPRMAAESCEINGYFIPKGSTVLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++   PLEF P RFLPGGEK NVD+KGNDFEVIPFGAGRR+C+G+SLG+RMV L+ A
Sbjct  406  RDPDIWAEPLEFRPQRFLPGGEKANVDVKGNDFEVIPFGAGRRVCAGLSLGLRMVQLVTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH+FDW+L +GQ  E LNMEE YGLTLQRA PL +HP+PRL  H+Y
Sbjct  466  TLVHSFDWELADGQKPEELNMEEGYGLTLQRAKPLKVHPRPRLSEHVY  513



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +V E+DL +LPFLQA+VKE FRLHPSTPLSLPR+  Q CE+NGYFIPKG+TLLVNVWAIA
Sbjct  340  VVNEADLAELPFLQAVVKENFRLHPSTPLSLPRIAHQSCEVNGYFIPKGSTLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN    PLEF P RFL GGE+PNVD++GNDF+VIPFGAGRRIC+GMSLGIRMV LL+A
Sbjct  400  RDPNAWDEPLEFRPERFLKGGERPNVDVRGNDFQVIPFGAGRRICAGMSLGIRMVQLLIA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +L+HAF++DL +GQ  E LNMEEAYGLTLQRA PL+LHPKPRL PH+Y
Sbjct  460  SLIHAFNFDLADGQLPERLNMEEAYGLTLQRADPLVLHPKPRLAPHVY  507



>dbj|BAH89259.1| putative flavonoid 3'-hydroxylase [Diospyros kaki]
Length=416

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +VTE DL  L FLQAI+KETFRLHPSTPLSLPRM A+ CEINGYFIPKG+TLLVNVWAIA
Sbjct  247  VVTEPDLPKLTFLQAIIKETFRLHPSTPLSLPRMAAESCEINGYFIPKGSTLLVNVWAIA  306

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  307  RDPEAWADPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLVTA  366

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW L  G+  E LNM+EAYGLTLQRAVPLM+HP+PRL  H+Y
Sbjct  367  TLIHAFDWALPEGEEPEKLNMDEAYGLTLQRAVPLMVHPRPRLAGHVY  414



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +V E+DL  LPFLQA+VKE FRLHPSTPLSLPR+  + CE+NGY IPKG+TLLVNVWAIA
Sbjct  351  VVKEADLAGLPFLQAVVKENFRLHPSTPLSLPRIAHESCEVNGYLIPKGSTLLVNVWAIA  410

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV   PLEF P RFL GGEKPNVD++GNDFE+IPFGAGRRIC+GMSLGIRMV LL A
Sbjct  411  RDPNVWDEPLEFRPERFLKGGEKPNVDVRGNDFELIPFGAGRRICAGMSLGIRMVQLLTA  470

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFD+DL +GQ  E+LNMEEAYGLTLQRA PL++HPKPRL PH+Y
Sbjct  471  TLIHAFDFDLADGQLPESLNMEEAYGLTLQRADPLVVHPKPRLAPHVY  518



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKETFRLHPSTPLSLPR+ ++ CEINGY IPKG+TLLVNVWAIA
Sbjct  342  LVTELDLSQLTFLQAIVKETFRLHPSTPLSLPRIASESCEINGYNIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + TNPL+F P RF+PGGEKPN D+KGNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  402  RDPKMWTNPLQFQPARFMPGGEKPNADVKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV AFDW+L NG     LNMEEAYGLTLQRA PL++HP+PRL PH+Y
Sbjct  462  TLVQAFDWELANGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLAPHVY  509



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV E DL +LPFLQA+VKETFRLHPSTPLSLPRM +Q CEINGY+IPKG+TLLVNVWAIA
Sbjct  345  LVIELDLPNLPFLQAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V   PLEF P RFL GGEKPNVDIKGN+FEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  405  RDPDVWAEPLEFRPDRFLLGGEKPNVDIKGNNFEVIPFGAGRRICAGMSLGLRMVQLLTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ  E L MEEAYGLTLQRAVPL+LHP+PRL  H+Y
Sbjct  465  TLVHAFDWGLPAGQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>gb|AGG18092.1| flavonoid 3'-hydroxylase, partial [Prunus armeniaca]
Length=264

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D+ +L +LQA++KETFRLHPSTPLSLPRM ++ CEIN + IPKGATLLVNVWAI+
Sbjct  92   LVTELDIPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINSFHIPKGATLLVNVWAIS  151

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PL F P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  152  RDPEQWKDPLVFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  211

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  212  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  259



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV E DL +LPFLQA+VKETFRLHPSTPLSLPRM +Q CEINGY+IPKG+TLLVNVWAIA
Sbjct  345  LVIELDLPNLPFLQAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V   PLEF P RFL GGEKPNVDIKGN+FEV+PFGAGRRIC+GMSLG+RMV LL A
Sbjct  405  RDPDVWAEPLEFRPDRFLLGGEKPNVDIKGNNFEVVPFGAGRRICAGMSLGLRMVQLLTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ  E L MEEAYGLTLQRAVPL+LHP+PRL  H+Y
Sbjct  465  TLVHAFDWGLPAGQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L FLQAI+KETFRLHPSTPLSLPRM  + CE+ GY+IPKG+TLLVNVWAI+
Sbjct  340  LVTESDLGQLTFLQAIIKETFRLHPSTPLSLPRMALESCEVGGYYIPKGSTLLVNVWAIS  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKPN DIKGNDFEVIPFGAGRRIC GMSLG+RMV LL A
Sbjct  400  RDPKIWADPLEFQPTRFLPGGEKPNTDIKGNDFEVIPFGAGRRICVGMSLGLRMVQLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW+L +G + + LNMEEAYGLTLQRA PL++HP+PRL PH+Y
Sbjct  460  TLIHAFDWELADGLNPKKLNMEEAYGLTLQRAAPLVVHPRPRLAPHVY  507



>emb|CBI15132.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L ++QAI+KETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  219  LVTDLDLPQLTYVQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  278

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  279  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  338

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  339  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  386



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L  LQAIVKETFRLHPSTPLSLPR+ +  CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTESDLGQLTLLQAIVKETFRLHPSTPLSLPRIASDSCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  398  RDPKMWTDPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L +G   E LNM EAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELASGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLAPHVY  505



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL+ L FLQAIVKETFRLHPSTPLSLPR+ ++ CEINGY IPKG+TLLVNVWAIA
Sbjct  342  LVNESDLSQLTFLQAIVKETFRLHPSTPLSLPRIASESCEINGYNIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T PLEF P RFLP GEKPN D+KGNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  402  RDPKMWTEPLEFRPSRFLPDGEKPNADVKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+ AFDW+L NG     LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  462  TLIQAFDWELANGLEPRNLNMEEAYGLTLQRAQPLMVHPRPRLAPHVY  509



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKETFRLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  346  LVMESDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD+KGNDFE IPFGAGRRIC+GMSLGIRMV L+ A
Sbjct  406  RDPNEWADPLEFRPERFLPGGEKPKVDVKGNDFEAIPFGAGRRICAGMSLGIRMVQLMTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+H+F+WDL NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  466  TLIHSFNWDLPNGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  513



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKETFRLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  346  LVMESDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD+KGNDFE IPFGAGRRIC+GMSLGIRMV L+ A
Sbjct  406  RDPNEWADPLEFRPERFLPGGEKPKVDVKGNDFEAIPFGAGRRICAGMSLGIRMVQLMTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+H+F+WDL NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  466  TLIHSFNWDLPNGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  513



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKE FRLHPSTPLSLPR+ +  CE++GY+IPKG+TLLVNVWAI+
Sbjct  338  LVTEVDLSRLTFLQAIVKEIFRLHPSTPLSLPRIASDTCEVDGYYIPKGSTLLVNVWAIS  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + +NPLEF P RFLPGGEKP+ D+KGNDFE+IPFGAGRRIC+GMSLG++MV LL A
Sbjct  398  RDPKIWSNPLEFQPTRFLPGGEKPDADVKGNDFELIPFGAGRRICAGMSLGLKMVQLLTA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW+L NG   + LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  458  TLVHAFDWELANGLDPDKLNMEEAYGLTLQRATPLMVHPRPRLAPHVY  505



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKETFRLHPSTPLSLPR+ ++ CEINGY IPKG+TLLVNVWAIA
Sbjct  342  LVTELDLSQLTFLQAIVKETFRLHPSTPLSLPRIASESCEINGYNIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + TNPL+F P RF+PGGEKPN D+KGNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  402  RDPKMWTNPLQFQPARFMPGGEKPNADVKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV AFDW+L NG     LNMEEAYGLTLQRA PL++HP+PRL P++Y
Sbjct  462  TLVQAFDWELANGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLAPYVY  509



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESD++ L +LQA++KETFRLHPSTPLS+PRM ++GCEINGY+IPKG+TLLVNVWAIA
Sbjct  342  LVTESDISQLTYLQAVIKETFRLHPSTPLSVPRMASEGCEINGYYIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +   PL+F P RFLPG +  NVD++GNDFEVIPFGAGRRIC+GM+LG+RMVHLL A
Sbjct  402  RDPAIWPEPLQFRPERFLPGSKHANVDVRGNDFEVIPFGAGRRICAGMNLGLRMVHLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHA DW L  GQ  E LNMEEAYGLTLQRAVPL +HP+PRL PH+Y
Sbjct  462  TLVHALDWGLQEGQMAEKLNMEEAYGLTLQRAVPLTVHPRPRLAPHVY  509



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L  LQAIVKETFRLHPSTPLSLPR+ +  CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTESDLGQLTLLQAIVKETFRLHPSTPLSLPRIASDSCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPNVD KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  398  RDPKMWTDPLEFRPTRFLPGGEKPNVDAKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L +G   E LNM EAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELASGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLAPHVY  505



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LPFLQAIVKETFRLHPSTPLSLPR+ ++ CE++GY IPKG+TLLVNVWAIA
Sbjct  339  LVSESDLGQLPFLQAIVKETFRLHPSTPLSLPRISSENCEVDGYHIPKGSTLLVNVWAIA  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  399  RDPKMWADPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNM EAYGLTLQR  PLM+HPKPRL PH+Y
Sbjct  459  TLVQTFDWELANGLEPEKLNMNEAYGLTLQREEPLMVHPKPRLAPHVY  506



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV E DL  L +L+AIVKETFRLHPSTPLSLPR+ ++ CEINGYFIPKG+TLL+NVWAIA
Sbjct  343  LVGELDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLLNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD++GNDFEVIPFGAGRRIC+GM+LGIRMV L++A
Sbjct  403  RDPNAWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLMIA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDLV+GQ  E LNMEEAYGLTLQRA PL++HP+PRL+   Y
Sbjct  463  TLIHAFNWDLVSGQLPEMLNMEEAYGLTLQRADPLVVHPRPRLEAQAY  510



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQAIVKETFRLHPSTPLSLPR+ ++ CE++GY IPKG+TLLVNVWAIA
Sbjct  339  LVSESDLSQLPFLQAIVKETFRLHPSTPLSLPRISSENCEVDGYHIPKGSTLLVNVWAIA  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  399  RDPKMWADPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNM EAYGLTLQR  PL++HPKPRL PH+Y
Sbjct  459  TLVQTFDWELANGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVY  506



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L FLQAIVKETFRLHPSTPLSLPR+ ++ CEI+GYFIPKG+TLLVNVWAIA
Sbjct  338  LVTESDLGKLTFLQAIVKETFRLHPSTPLSLPRIASESCEIDGYFIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  398  RDPKMWTDPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNM EA+GLTLQRA PL+++PKPRL PH+Y
Sbjct  458  TLVQTFDWELANGVLPEKLNMNEAFGLTLQRAEPLIVYPKPRLAPHVY  505



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  302  LVTDLDLPQLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  361

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  362  RDPEVWEKPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  421

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  422  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  469



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DLT LP+L+A++KETFRLHPSTPLSLPR+    CEI  Y IPKGATLLVNVWAI+
Sbjct  342  LVTEQDLTHLPYLEAVIKETFRLHPSTPLSLPRVATNSCEIFNYHIPKGATLLVNVWAIS  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   TNPLEF P RFLPGGEK +VDI+GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  402  RDPKEWTNPLEFKPERFLPGGEKFDVDIRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HA+DW+L NG S E LNM+EAYGLTLQRAVP++ HP+PRL PHLY
Sbjct  462  TLAHAYDWELENGLSPEKLNMDEAYGLTLQRAVPILAHPRPRLSPHLY  509



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  338  LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASENCEINGFHIPKGATLLVNVWAIS  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  398  RDPEQWKDPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  458  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  507



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  507



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DLT+LP+L+A+VKET RLHPSTPLSLPR+  Q CEI  Y IPKGATLLVNVWAI+
Sbjct  342  LVTEQDLTNLPYLEAVVKETLRLHPSTPLSLPRVATQSCEIFNYHIPKGATLLVNVWAIS  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   +NPLEF P RFLPGGEK +VD++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  402  RDPKEWSNPLEFKPERFLPGGEKFDVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HA+DW+L NG S E LNM+EAYGLTLQRAVP++ HP+PRL PHLY
Sbjct  462  TLAHAYDWELENGVSPEKLNMDEAYGLTLQRAVPILAHPRPRLSPHLY  509



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQA+VKE FRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTELDLSQLTYLQALVKEVFRLHPSTPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKP  D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  398  RDPKMWADPLEFRPSRFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQA+VKE FRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTELDLSQLTYLQALVKEVFRLHPSTPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKP  D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  398  RDPKMWADPLEFRPSRFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  LPF QA++KE FRLHPSTPLSLPR+  + CEINGY IPKG+TLLVNVWAIA
Sbjct  348  LVTESDLAQLPFFQAVIKENFRLHPSTPLSLPRVAQESCEINGYLIPKGSTLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV  +PLEF P RF+  G+KPN D+KGNDF+VIPFGAGRRIC+GM LGIRMV LL A
Sbjct  408  RDPNVWESPLEFQPQRFMADGQKPNADVKGNDFDVIPFGAGRRICAGMGLGIRMVQLLTA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFD++L NGQ  E LNMEEAYGL L RA PLM+HPKPRL+PH+Y
Sbjct  468  TLIHAFDFELANGQLPENLNMEEAYGLQLTRADPLMVHPKPRLEPHVY  515



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQA+VKE FRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTELDLSQLTYLQALVKEVFRLHPSTPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKP  D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  398  RDPKMWADPLEFRPSRFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQA+VKE FRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTELDLSQLTYLQALVKEVFRLHPSTPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKP  D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  398  RDPKMWADPLEFRPSRFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKETFRLHPSTPLSLPR+ ++ CEI+GYFIPKG+TLLVNVWAIA
Sbjct  345  LVMESDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEIDGYFIPKGSTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD+KGNDFEVI FGAGRRIC+GMSLGIRMV L+ A
Sbjct  405  RDPNEWADPLEFRPERFLPGGEKPKVDVKGNDFEVITFGAGRRICAGMSLGIRMVQLMTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+H+F+WDL NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  465  TLIHSFNWDLPNGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  512



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  339  LVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   + PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC+GM+LG+RMV L++A
Sbjct  399  RDPAQWSEPLEFRPERFLPGGEKPNVDVKGNDFEVIPFGAGRRICAGMTLGLRMVSLMIA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
             VTESDL  L FLQA++KETFRLHPSTPLSLPRM A+ CEINGY++ +G+TLLVNVWAIA
Sbjct  288  FVTESDLPQLTFLQAVIKETFRLHPSTPLSLPRMAAEDCEINGYYVSEGSTLLVNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPL+FNP RFL GGEKPNVD+KGNDFEVIPFGAGRRIC+GMSLGIRMV L+ A
Sbjct  348  RDPNAWANPLDFNPTRFLAGGEKPNVDVKGNDFEVIPFGAGRRICAGMSLGIRMVQLVTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            +LVH+FDW L++G   E L+MEE YGLTLQRA PL++HPKPRL   +Y +
Sbjct  408  SLVHSFDWALLDGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVYCM  457



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQAIVKETFRLHPSTPLSLPR+ ++ CE++GY IPKG+TLLVNVWAIA
Sbjct  339  LVSESDLSQLPFLQAIVKETFRLHPSTPLSLPRISSENCEVDGYHIPKGSTLLVNVWAIA  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  399  RDPKMWADPLEFRPARFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            T V  FDW+L NG   E LNM EAYGLTLQR  PL++HPKPRL PH+Y
Sbjct  459  TSVQTFDWELANGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVY  506



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+L+AIVKETFRLHPSTPLSLPRM ++ CEINGY IP+G+TLLVNVWAIA
Sbjct  355  LVTELDLPRLPYLEAIVKETFRLHPSTPLSLPRMASESCEINGYSIPEGSTLLVNVWAIA  414

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+G+SLG+RMV LL A
Sbjct  415  RDPKAWADPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGLSLGLRMVQLLTA  474

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +GQ    +NM+EAYGLTLQRAVPLM+HP PRL P  Y
Sbjct  475  TLVHAFDWTLADGQEAAKINMDEAYGLTLQRAVPLMVHPSPRLSPVAY  522



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL +LP+ QA++KE FRLHPSTPLSLPR+ A  CEINGY+IPK  TLLVNVWAIA
Sbjct  343  LVNESDLPNLPYFQAMIKEVFRLHPSTPLSLPRISADPCEINGYYIPKNTTLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV ++PLEF P RFLPGGE+PN D+KGNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  403  RDPNVWSSPLEFQPERFLPGGERPNADVKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TLVH FDW L +G   E LNMEEAYGLTLQR +PL +HP PRL  H Y L
Sbjct  463  TLVHGFDWKLADGLMSEKLNMEEAYGLTLQRKIPLAVHPLPRLSAHAYNL  512



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA++KETFRLHPSTPLSLPR+ A+ CEINGY IPKGATLLVNVWAIA
Sbjct  343  LVTELDLPRLPYLQAVIKETFRLHPSTPLSLPRVAAESCEINGYHIPKGATLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+    PL F P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  403  RDPDTWAEPLAFRPERFLPGGEKPNVDVKGNDFEVIPFGAGRRICAGVSLGLRMVQFMTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAFDW+L NG   E LNM+EAYGLTLQRA PL +HPKPRL  H Y
Sbjct  463  TLAHAFDWELANGALPEKLNMDEAYGLTLQRAEPLSVHPKPRLAAHAY  510



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  339  LVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   + PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC+GM+LG+RMV L+ A
Sbjct  399  RDPAQWSEPLEFRPERFLPGGEKPNVDVKGNDFEVIPFGAGRRICAGMTLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            L+TESDL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  339  LITESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   + PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC+GM+LG+RMV L+ A
Sbjct  399  RDPAQWSEPLEFRPERFLPGGEKPNVDVKGNDFEVIPFGAGRRICAGMTLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAI+KETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPQLTYLQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEKPLEFRPSRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAPPLMVHPRPRLSPQVF  507



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA+VKETFRLHPSTPLSLPR+ A+ CEI GY IPKG+T+LVNVWAIA
Sbjct  350  LVTELDLAQLTYLQAVVKETFRLHPSTPLSLPRIAAESCEIGGYHIPKGSTVLVNVWAIA  409

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V T PLEF P RFLPGG+K +VD+KGNDFE+IPFGAGRRIC+GMSLG+RMV LL A
Sbjct  410  RDPDVWTKPLEFRPERFLPGGDKADVDVKGNDFELIPFGAGRRICAGMSLGLRMVQLLTA  469

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDWDL +G   E LNM+EAYGLTLQRA PLM+HP+PRL P +Y
Sbjct  470  TLIHAFDWDLADGLVPEKLNMDEAYGLTLQRADPLMVHPRPRLSPKVY  517



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQA+VKE FRLHPS PLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTELDLSQLTYLQALVKEVFRLHPSAPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKP  D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  398  RDPKMWADPLEFRPSRFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA+VKETFRLHPSTPLSLPR+ A+ CEI GY IPKG T+LVNVWAIA
Sbjct  350  LVTELDLAQLTYLQAVVKETFRLHPSTPLSLPRIAAESCEIGGYHIPKGTTVLVNVWAIA  409

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V T PLEF P RFLPGGEK +VD+KGNDFE+IPFGAGRRIC+GMSLG+RMV LL A
Sbjct  410  RDPDVWTKPLEFRPERFLPGGEKADVDVKGNDFELIPFGAGRRICAGMSLGLRMVQLLTA  469

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW L +G   E LNM+EAYGLTLQRAVPLM+HP+PRL P  Y
Sbjct  470  TLIHAFDWQLADGLVPEKLNMDEAYGLTLQRAVPLMVHPRPRLSPKAY  517



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L FLQAIVKETFRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  342  LVTESDLGQLTFLQAIVKETFRLHPSTPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPNVD+KGNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  402  RDPKMWTDPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQP  224
            TLV  FDW+L NG   E LNM EAYGLTLQRA PL++HPKPRL P
Sbjct  462  TLVQTFDWELANGVQPEKLNMNEAYGLTLQRAEPLIVHPKPRLAP  506



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM ++ CEIN + IPKGATLLVNVWAI+
Sbjct  338  LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINSFHIPKGATLLVNVWAIS  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  398  RDPEQWKEPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  458  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAI+KETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPQLTYLQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEKPLEFRPSRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L FLQAIVKETFRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  342  LVTELDLNELNFLQAIVKETFRLHPSTPLSLPRIASESCEVDGYYIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV  +PLEF P RFLPGGEKPNVD++GN+FEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  402  RDPNVWADPLEFRPMRFLPGGEKPNVDVQGNNFEVIPFGAGRRICVGISLGLRMVQLLVA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG + E LNM+EA+GLTLQ+A PLM+HP PRL PH+Y
Sbjct  462  TLVQTFDWELANGLNPEKLNMDEAFGLTLQKAEPLMVHPMPRLAPHVY  509



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL +L + QA++KETFRLHPSTPLSLPRM ++ CEINGY IPKGATLLVNVWAIA
Sbjct  340  LVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASESCEINGYHIPKGATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+   +PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  400  RDPDEWKDPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLAA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW+L +G   E LNMEEA+GLTLQRA PLM+HP+PRL P  Y
Sbjct  460  TLVHAFDWELADGLMPEKLNMEEAFGLTLQRAAPLMVHPRPRLSPRAY  507



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D+  L +LQAI++ETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTELDVPQLTYLQAIIEETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEEPLEFKPSRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW+L +GQ  E LNM+EAYGLTLQRA PLM+HP+ RL P  +
Sbjct  460  TLIHAFDWELADGQVPEKLNMDEAYGLTLQRAAPLMVHPRSRLSPQAF  507



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L ++QAI+KETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPQLTYVQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAI+KETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPRLTYLQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEKPLEFRPSRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM++P+PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVYPRPRLSPQVF  507



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
             VTESDL  L FLQA++KETFRLHPSTPLSLPRM A+ CEINGY++ +G+TLLVNVWAIA
Sbjct  355  FVTESDLPQLTFLQAVIKETFRLHPSTPLSLPRMAAEDCEINGYYVSEGSTLLVNVWAIA  414

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPL+FNP RFL GGEKPNVD+KGNDFEVIPFGAGRRIC+GMSLGIRMV L+ A
Sbjct  415  RDPNAWANPLDFNPTRFLAGGEKPNVDVKGNDFEVIPFGAGRRICAGMSLGIRMVQLVTA  474

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            +LVH+FDW L++G   E L+MEE YGLTLQRA PL++HPKPRL   +Y +
Sbjct  475  SLVHSFDWALLDGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVYCM  524



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D+ +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  338  LVTELDIPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PL F P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC+GMSLG+RMVHL+ A
Sbjct  398  RDPEQWKDPLVFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRMVHLMAA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  458  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D+    +LQA+VKE  RLHPSTPLSLPRM  + CEING+ IPKG+TLLVNVWAIA
Sbjct  289  LVTEVDIAQFTYLQAVVKEVLRLHPSTPLSLPRMATESCEINGFHIPKGSTLLVNVWAIA  348

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + TNPLEF P RFLP GEK NVD+KGNDFE+IPFGAGRRIC+GM+LG+RMV+LL+A
Sbjct  349  RDPKIWTNPLEFQPERFLPTGEKSNVDVKGNDFELIPFGAGRRICAGMNLGLRMVNLLIA  408

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW+L NG   E LNMEEAYGLTLQR VPL++ P+PRL P++Y
Sbjct  409  TLIHAFDWELENGLKAEELNMEEAYGLTLQRLVPLIVRPRPRLSPNVY  456



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL +L + QA++KETFRLHPSTPLSLPRM +  C+INGY IPKGATLLVNVWAI+
Sbjct  343  LVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASDSCDINGYHIPKGATLLVNVWAIS  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  403  RDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAFDW+L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  463  TLAHAFDWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L +LQA++KETFRLHPSTPLSLPRM  + CEING+ IPKGATLLVNVWA++
Sbjct  339  LVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMATESCEINGFHIPKGATLLVNVWAVS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  + PLEF P RF+ GGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  399  RDPDQWSEPLEFRPERFMSGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L + QAI+KETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  340  LVTDLDLPQLTYXQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  400  RDPEVWEKPLEFRPSRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF+W+L  GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  460  TLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  LPF QA++KE FRLHP TPLSLPR+  + CEINGY IPKG+TLLVNVWAIA
Sbjct  348  LVTESDLAQLPFFQAVIKENFRLHPPTPLSLPRVAQESCEINGYLIPKGSTLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+   +PLEF P RF+ GG+KPNVD+KG+DFE+IPFGAGRRIC+GM LGIRMV LL A
Sbjct  408  RDPDEWESPLEFRPQRFMAGGQKPNVDVKGSDFELIPFGAGRRICAGMGLGIRMVQLLTA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFD++L NGQ  E LNMEEAYGL L RA PLM+HPKPRL+PH+Y
Sbjct  468  TLIHAFDFELANGQLPENLNMEEAYGLQLTRADPLMVHPKPRLEPHVY  515



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVNVWAI+
Sbjct  341  LVTEPDLPKLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVNVWAI+
Sbjct  341  LVTEPDLPKLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKET RLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  345  LVMESDLAQLTYLEAIVKETLRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGEKP VD++GNDFEVIPFGAGRRIC+GM+LGIRMV L+ A
Sbjct  405  RDPNEWINPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLITA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  465  TLIHAFNWDLPIGQSSEKLNMEEAFGLTLQRADPLVVHPGLRLEAQAY  512



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKET RLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  346  LVMESDLAQLTYLEAIVKETLRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGEKP VD++GNDFEVIPFGAGRRIC+GM+LGIRMV L+ A
Sbjct  406  RDPNEWVNPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLITA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  466  TLIHAFNWDLPIGQSSEKLNMEEAFGLTLQRADPLVVHPGLRLEAQAY  513



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVNVWAI+
Sbjct  341  LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMVHPRTRLAPHAY  507



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKETFRLHPSTPLSLPR+ ++ CEINGY IPKG+TLLVNVWAIA
Sbjct  341  LVTELDLSRLTFLQAIVKETFRLHPSTPLSLPRIASESCEINGYHIPKGSTLLVNVWAIA  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRRIC G+SLG+RMV LL+A
Sbjct  401  RDPKKWADPLEFRPARFLPGGEKPDVDVRGNDFEVIPFGAGRRICVGLSLGMRMVQLLIA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L NG   E LNMEEAYGLTLQRA PLM+HP  RL PH+Y
Sbjct  461  TLVQTFDWELANGLMPEKLNMEEAYGLTLQRAAPLMVHPMSRLAPHVY  508



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVNVWAI+
Sbjct  341  LVTEPDLPKLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL +L + QA++KETFRLHPSTPLSLPRM +  C+INGY IPKGATLLVNVWAI+
Sbjct  343  LVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASDSCDINGYHIPKGATLLVNVWAIS  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  403  RDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAF+W+L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  463  TLAHAFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQA+VKE FRLHPSTPLSLPR+ ++ CE +GY+IPKG+TLLVNVWAIA
Sbjct  338  LVTELDLSQLTYLQALVKEVFRLHPSTPLSLPRISSESCEADGYYIPKGSTLLVNVWAIA  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGGEKP  D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  398  RDPKMWADPLEFRPSRFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L N    E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  458  TLVQTFDWELANRLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL +L + QA++KETFRLHPSTPLSLPRM +  C+INGY IPKGATLLVNVWAI+
Sbjct  343  LVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASDSCDINGYHIPKGATLLVNVWAIS  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  403  RDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAF+W+L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  463  TLAHAFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   270 bits (691),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  339  LVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   + PLEF P RFL GGEKP VD++GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  399  RDPAQWSEPLEFKPERFLSGGEKPTVDVRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVNVWAI+
Sbjct  341  LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLVTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMVHPRTRLAPHAY  507



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  L FL+A+VKETFRLHPSTPLSLPRM  + CE++GY+IPKG+TLLVNVWAIA
Sbjct  344  LVSELDLPRLTFLEAVVKETFRLHPSTPLSLPRMALESCEVDGYYIPKGSTLLVNVWAIA  403

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLP GEKPN ++KGNDFE+IPFGAGRRIC+GMSLG+RMV LL A
Sbjct  404  RDPKMWDDPLEFRPRRFLPRGEKPNANVKGNDFEIIPFGAGRRICAGMSLGLRMVQLLTA  463

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L NG   E LNM+EAYGLTLQR VPLM+HP PRL P LY
Sbjct  464  TLVHAFDWKLANGLDSEKLNMKEAYGLTLQRDVPLMVHPSPRLAPELY  511



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L +LQA++KETFRLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  339  LVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   + PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC+GM+LG+RMV L+ A
Sbjct  399  RDPAQWSKPLEFRPERFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMTLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L NG + + L M+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLANGLTPDKLIMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D++ L FLQAIVKETFRLHP+TPLSLPR+ ++ CEINGY IPKG+TLL +VWAIA
Sbjct  344  LVTELDISQLTFLQAIVKETFRLHPATPLSLPRIASENCEINGYNIPKGSTLLTHVWAIA  403

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PL+F P RFLPGGEKPN D+KGNDF++IPFGAGRRIC+GMSLG+RMV LL+A
Sbjct  404  RDPKIWTDPLKFQPTRFLPGGEKPNADVKGNDFDLIPFGAGRRICAGMSLGVRMVQLLIA  463

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLV AFDW+L N    E LNMEEAYGL L+RA PLM+HP+PRL PH+YT
Sbjct  464  TLVQAFDWELANCLEPENLNMEEAYGLALRRAEPLMVHPRPRLSPHVYT  512



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ LP+LQAIVKETFRLH STPLSLPR+  Q CEINGY IPKGATLLVNVWAIA
Sbjct  344  LVTELDLSKLPYLQAIVKETFRLHSSTPLSLPRIATQSCEINGYHIPKGATLLVNVWAIA  403

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V  +PL F P RFLPG EK NVD+KGNDFE+IPFGAGRRIC+GMSLG+RMV LL A
Sbjct  404  RDPDVWADPLSFRPERFLPGSEKENVDVKGNDFELIPFGAGRRICAGMSLGLRMVQLLTA  463

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDL  GQ  + LNM+EAYGLTLQRA PL + P+PRL  HLY
Sbjct  464  TLLHAFNWDLPQGQIPQELNMDEAYGLTLQRASPLHVRPRPRLPSHLY  511



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LP+LQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  303  LVSESDLNQLPYLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  362

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PL F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  363  RDPSMWPDPLRFEPERFLPGSEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  422

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
             L+H F+W+L  GQ +E LNM+EAYGLTLQRA PLM+HPKPRL+ H+Y+
Sbjct  423  ALIHGFNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKPRLEAHVYS  471



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L F+QAIVKETFRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  340  LVTELDLNQLTFIQAIVKETFRLHPSTPLSLPRISSEACEVDGYYIPKGSTLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC GM+LG+RMV LLVA
Sbjct  400  RDPEMWTDPLEFRPSRFLPGGEKPNVDVRGNDFEVIPFGAGRRICVGMTLGLRMVQLLVA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV  FDW+L  G   E LNM+EAYGLTLQRA  L++HPKPRL P +Y
Sbjct  460  TLVQTFDWELAKGLEPEKLNMDEAYGLTLQRAEQLIVHPKPRLAPGVY  507



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL +L + QA++KETFR+HPSTPLSLPRM +  C+INGY IPKGATLLVNVWAI+
Sbjct  343  LVSDLDLPNLTYFQAVIKETFRIHPSTPLSLPRMASDSCDINGYHIPKGATLLVNVWAIS  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  403  RDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAF+W+L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  463  TLAHAFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KETFRLHPSTPLSLPRM A+ CEING+ IPKG+TLLVNVWAI+
Sbjct  341  LVTEPDLPKLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGFHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKET RLHP+TPLSLPR+ ++ CEINGYFIPKG+TLLVNVW IA
Sbjct  346  LVMESDLAQLTYLEAIVKETLRLHPTTPLSLPRIASESCEINGYFIPKGSTLLVNVWVIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGEKP VD++GNDFEVIPFGAGRRIC+GM+LGIRMV L+ A
Sbjct  406  RDPNEWVNPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLMTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDL  GQS E LNME+A+GLTL RA PL++HP+PRL+   Y
Sbjct  466  TLIHAFNWDLPIGQSSEKLNMEDAFGLTLHRADPLVVHPRPRLEAQAY  513



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM ++ CEIN + IPKGATLLVNVWAI+
Sbjct  343  LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINSFHIPKGATLLVNVWAIS  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKP+VD++GNDFEVIPFGAGRR+C+GMSLG+RMVHL+ A
Sbjct  403  RDPEQWKEPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRMCAGMSLGLRMVHLMAA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPH  221
            TLVHAFDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH
Sbjct  463  TLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPH  508



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKETFRLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAI+
Sbjct  345  LVVESDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIS  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD+KGNDFEVIPFGAGRRIC GMSLGIRMV L+ A
Sbjct  405  RDPNEWADPLEFRPERFLPGGEKPKVDVKGNDFEVIPFGAGRRICPGMSLGIRMVQLMTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+H+F+W L  GQ  E LNMEEA+GLTLQRA PL++HP PRL+  +Y
Sbjct  465  TLIHSFNWALPTGQLPEKLNMEEAFGLTLQRADPLVVHPIPRLEAQVY  512



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L F QAI+KETFRLHPSTPLSLPRM ++ CEI+GY IPK +TLLVNVWAIA
Sbjct  342  LVSESDLGQLTFFQAIIKETFRLHPSTPLSLPRMASESCEIDGYHIPKNSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V + PLEF P RFLPGG+  ++D+KG DFEVIPFGAGRRIC+GMS+G+RMV  + A
Sbjct  402  RDPDVWSEPLEFKPDRFLPGGKNAHMDVKGTDFEVIPFGAGRRICAGMSMGMRMVQYVTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVH FDW++  GQ VE LNMEE+YGLTLQRA PL++HP+PRL PH+Y  N
Sbjct  462  TLVHGFDWEMPEGQMVEKLNMEESYGLTLQRAAPLVVHPRPRLAPHVYQTN  512



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQAIVKETFRLHPSTPLSLPR+ ++ CEINGY IPKGATLLVNVWAI+
Sbjct  357  LVTELDLPQLTYLQAIVKETFRLHPSTPLSLPRVASESCEINGYHIPKGATLLVNVWAIS  416

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RD NV   PLEF P+RFLP GEKPN D++GNDFEVIPFGAGRRIC+GM+LGIRMV LL A
Sbjct  417  RDSNVWDEPLEFRPNRFLPNGEKPNADVRGNDFEVIPFGAGRRICAGMTLGIRMVQLLTA  476

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW+L  GQ  E LNMEEAYGLTLQR  PLM+HP+ RL  ++Y
Sbjct  477  TLIHAFDWELPAGQIAEKLNMEEAYGLTLQRHTPLMVHPRTRLSQNVY  524



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KETFRLHP TPLS+PR+GA+GCEINGY IPKGA LLVNVWAIA
Sbjct  343  LVTELDLPRLTYLQAVIKETFRLHPPTPLSIPRVGAEGCEINGYHIPKGAKLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+    PL F P RFLPGGEKPN D++GNDFE+IPFGAGRRIC GMS+G+RMV L+ A
Sbjct  403  RDPDAWAEPLVFRPERFLPGGEKPNADVRGNDFEIIPFGAGRRICIGMSMGLRMVQLMTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAFDW+L  G S E LNM+EAYGLTLQRA PL +HPKPRL  H+Y
Sbjct  463  TLAHAFDWELAGGVSPEKLNMDEAYGLTLQRAEPLSVHPKPRLASHVY  510



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E D+ +LP+LQA++KETFRLHPSTPLSLPR+ ++ CEI GY IPKG+TLLVNVWAIAR
Sbjct  346  VKEDDIPNLPYLQAVIKETFRLHPSTPLSLPRIASESCEIFGYHIPKGSTLLVNVWAIAR  405

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFLPGGEK +VD+KGNDFEVIPFGAGRRIC GMSLG+RMV LL AT
Sbjct  406  DPKEWVDPLEFKPERFLPGGEKCDVDVKGNDFEVIPFGAGRRICPGMSLGLRMVQLLTAT  465

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+FDW+L NG +   +NM+E YGLTLQRAVPL++HPKPRL PH+Y+
Sbjct  466  LAHSFDWELENGLNAGKMNMDEGYGLTLQRAVPLLVHPKPRLSPHVYS  513



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L +LQA++KETFRLHPSTPLSLPRM  + CEING+ IPKGATLLVNVWA +
Sbjct  339  LVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMATESCEINGFHIPKGATLLVNVWAXS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  + PLEF P RF+ GGEKPNVD +GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  399  RDPDQWSEPLEFRPERFMSGGEKPNVDXRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +LQAI+KETFRLHPSTPLSLPRM A+ CEINGYFIPKG+TLLVNVWAIA
Sbjct  310  LVMESDLPQLTYLQAIIKETFRLHPSTPLSLPRMAAESCEINGYFIPKGSTLLVNVWAIA  369

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDF-EVIPFGAGRRICSGMSLGIRMVHLLV  362
            RDP+   NPLEF P RFLPGGEKPNVDI+G  F     FGAGRRIC+GMSLG+RMV LL 
Sbjct  370  RDPDAWANPLEFQPERFLPGGEKPNVDIRGERFLRSFRFGAGRRICAGMSLGLRMVQLLT  429

Query  361  ATLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            ATLV AF+W+L  G+S E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  430  ATLVQAFNWELPEGKSAEKLNMDEAYGLTLQRADPLMVHPRPRLAAHLY  478



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L ++QA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVN+WAI+
Sbjct  341  LVTEPDLPKLTYIQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNIWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPG EKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGSEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KETFRLHPSTPLSLPR+ ++GCEINGY IPKG+TLLVNVWAIA
Sbjct  337  LVTELDLPQLTYLQAVIKETFRLHPSTPLSLPRIASEGCEINGYEIPKGSTLLVNVWAIA  396

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V   PLEF P RFLPGGEK +VD++GNDFE+IPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  397  RDPDVWAQPLEFRPERFLPGGEKASVDVRGNDFELIPFGAGRRICAGMSLGLRMVQLMTA  456

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDWDL  G     LNM+EAYGLTLQRA PL++HPKPRL    Y
Sbjct  457  TLVHAFDWDLEEGVDPLKLNMDEAYGLTLQRAAPLIVHPKPRLSTQAY  504



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E D+ +LP+LQA++KETFRLHPSTPLSLPR+ ++ CEI GY IPKG+TLLVNVWAIAR
Sbjct  346  VKEDDIPNLPYLQAVIKETFRLHPSTPLSLPRIASESCEIFGYHIPKGSTLLVNVWAIAR  405

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFLPGGEK +VD+KGNDFEVIPFGAGRRIC GMSLG+RMV LL AT
Sbjct  406  DPKEWVDPLEFKPERFLPGGEKCDVDVKGNDFEVIPFGAGRRICPGMSLGLRMVQLLTAT  465

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+FDW+L NG +   +NM+E YGLTLQRAVPL +HPKPRL PH+Y+
Sbjct  466  LAHSFDWELENGLNAGKMNMDEGYGLTLQRAVPLSVHPKPRLSPHVYS  513



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA+VKETFRLHP TPLSLPR+ A+ CEINGY IPKGATLLVNVWAIA
Sbjct  294  LVTELDLPRLTYLQAVVKETFRLHPPTPLSLPRIAAESCEINGYRIPKGATLLVNVWAIA  353

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL F P RFLPGGEK NVD+KGNDFE+IPFGAGRRIC GMSLG+RMV  + A
Sbjct  354  RDPEAWAEPLAFRPERFLPGGEKANVDVKGNDFELIPFGAGRRICVGMSLGLRMVQFMTA  413

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAFDW++ +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  414  TLAHAFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  461



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL +L + QA++KETFRLHPSTPLSLPRM ++ CEINGY IPKGATLLVNVWAIA
Sbjct  340  LVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASESCEINGYHIPKGATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+   +PLEF P RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  400  RDPDEWKDPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLAA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  233
            TLVHAFDW+L +G   E LNMEEA+GLTLQRA PLM+HP+PR
Sbjct  460  TLVHAFDWELADGLMPEKLNMEEAFGLTLQRAAPLMVHPRPR  501



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA+VKETFRLHP TPLSLPR+ A+ CEINGY IPKGATLLVNVWAIA
Sbjct  307  LVTELDLPRLTYLQAVVKETFRLHPPTPLSLPRIAAESCEINGYRIPKGATLLVNVWAIA  366

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL F P RFLPGGEK NVD+KGNDFE+IPFGAGRRIC GMSLG+RMV  + A
Sbjct  367  RDPEAWAEPLAFRPERFLPGGEKANVDVKGNDFELIPFGAGRRICVGMSLGLRMVQFMTA  426

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAFDW++ +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  427  TLAHAFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  474



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
             VTESDL +L +LQA++KE FRLHPSTPLSLPR+  + CEINGY IPKG+TLLVNVWAI+
Sbjct  342  FVTESDLPELVYLQAVIKENFRLHPSTPLSLPRIAEESCEINGYHIPKGSTLLVNVWAIS  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   T PLEF P RFL  GEKPNVD++GNDFE+IPFGAGRRIC+GMSLGIRMV LL A
Sbjct  402  RDPEQWTQPLEFRPDRFLAAGEKPNVDVRGNDFELIPFGAGRRICAGMSLGIRMVQLLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAF++DL NG S + LNM+EAYGLTLQRA PL++HP PRL PH+Y
Sbjct  462  TLVHAFNFDLANGLSPQNLNMDEAYGLTLQRAQPLIVHPNPRLAPHVY  509



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDLT L +L+AIVKET RLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  346  LVMESDLTQLAYLEAIVKETLRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD++GNDFEVIPFGAGRRIC+GM+ GIRMV L+ A
Sbjct  406  RDPNEWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNSGIRMVQLMTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  466  TLIHAFNWDLPIGQSPEKLNMEEAFGLTLQRADPLVVHPCLRLEAQAY  513



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA++KETFRLHPSTPLSLPR+ A+ CEI GY IPKG+TLLVNVWAIAR
Sbjct  338  VKEEDLAHLPYLQAVIKETFRLHPSTPLSLPRVAAESCEIFGYHIPKGSTLLVNVWAIAR  397

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFLPGGEK +VD+KGNDFEVIPFGAGRRIC+G+SLG+RMV LL AT
Sbjct  398  DPKEWADPLEFRPERFLPGGEKADVDVKGNDFEVIPFGAGRRICAGLSLGLRMVQLLTAT  457

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+FDW+L NG + E LNM+EAYGLTLQRA PL +HP+PRL  H+Y+
Sbjct  458  LAHSFDWELENGLNPEKLNMDEAYGLTLQRAEPLSVHPRPRLASHVYS  505



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +L +LQA++KETFRLHPSTPLSLPRM A+ CEINGY IPKG+TLLVNVWAI+
Sbjct  341  LVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGGEKPNVDI+GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  401  RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKP-RLQPHLY  215
            TLVHAFDW L +G + E LNM+EA+GLTLQRA PLM+HP+  RL PH Y
Sbjct  461  TLVHAFDWTLADG-TPEKLNMDEAFGLTLQRAAPLMVHPRTGRLAPHAY  508



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L +LQAIVKETFRLHPSTPLSLPRM  + CE+NGY+IPKG+TLLVNVWAIA
Sbjct  340  LVTEMDLSRLIYLQAIVKETFRLHPSTPLSLPRMATESCEVNGYYIPKGSTLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF   RFLPGGEKP+VD+KGNDFE+IPFG GRRIC+GM+LG++MV LL+A
Sbjct  400  RDPKMWTDPLEFRATRFLPGGEKPDVDVKGNDFELIPFGGGRRICAGMNLGLKMVQLLIA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L +G   E LNMEEA GL L R VPLM+HPKPRL  H Y
Sbjct  460  TLVHAFDWKLADGLDPEKLNMEEAPGLALHRVVPLMVHPKPRLAHHAY  507



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +LQA++KE FRLHPSTPLSLPR+  + CEINGY+IPK +TLLVNVWAI 
Sbjct  352  LVKESDLGQLTYLQAVIKENFRLHPSTPLSLPRVAQESCEINGYYIPKDSTLLVNVWAIG  411

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV  +PLEF P RFL GGEKPNVD++GNDFE+IPFG+GRRIC+GM+LGIRMV LL+A
Sbjct  412  RDPNVWPDPLEFRPERFLMGGEKPNVDVRGNDFELIPFGSGRRICAGMNLGIRMVQLLIA  471

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            T+VHAFD++L NGQ  + LNMEEAYG+TLQRA PL++HP+PRL  H+Y
Sbjct  472  TMVHAFDFELANGQLAKDLNMEEAYGITLQRADPLVVHPRPRLARHVY  519



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ L F QAI+KETFRLHPSTPLSLPRM  + CEING++IPK +TLLVNVWAIA
Sbjct  343  LVSESDLSQLTFFQAIIKETFRLHPSTPLSLPRMATESCEINGFYIPKDSTLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V   PLEF P RF+PGG   ++D+KGNDFEVIPFGAGRRIC+GMS+GIRMV  + A
Sbjct  403  RDPSVWPEPLEFKPERFVPGGRNAHMDVKGNDFEVIPFGAGRRICAGMSMGIRMVTFVAA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH F+W+L  GQ  E LNM+EAYGLTLQRAVPL++HP+PRL PH Y
Sbjct  463  TLVHGFNWELPEGQMPEKLNMDEAYGLTLQRAVPLVVHPQPRLAPHAY  510



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  290  LVSEADLSQLPFLQAVIKEVFRLHPSTPLSLPRVSIEDCEIDGYFIPKNTTLLTNVWAIA  349

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + + PLEF P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  350  RDPLMWSGPLEFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGMSLGLRMVQFMTA  409

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H F+WDL  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  410  TLIHGFNWDLPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  453



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKET RLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  346  LVMESDLAQLTYLEAIVKETLRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEKP VD++GNDFEVIPFGAGRRIC+GM+ GIRMV L+ A
Sbjct  406  RDPNEWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNSGIRMVQLMTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+WDL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  466  TLIHAFNWDLSIGQSPEKLNMEEAFGLTLQRADPLVVHPCLRLEAQAY  513



>gb|AAO47857.1| flavonoid 3'-hydroxylase, partial [Glycine max]
Length=323

 Score =   260 bits (664),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA++KETFRLHPSTPLS+PR  A+ CEI GY IPKGATLLVN+WAIAR
Sbjct  153  VKEEDLAHLPYLQAVIKETFRLHPSTPLSVPRAAAESCEIFGYHIPKGATLLVNIWAIAR  212

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+G+SLG++MV LL A 
Sbjct  213  DPKEWNDPLEFRPERFLLGGEKADVDVRGNDFEVIPFGAGRRICAGLSLGLQMVQLLTAA  272

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            L H+FDW+L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  273  LAHSFDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  322



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT SD  +L +LQA++KET RLHPSTPLSLPRM ++ CEING+ IPKGATLLVNVWAI+
Sbjct  339  LVTXSDXPNLTYLQAVIKETXRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   + PLEF P RFL GGEKPNVD++GNDFEVIPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  399  RDPAQWSEPLEFKPERFLSGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  459  TLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L FLQA++KE FRLHPSTPLSLPR+  + CEINGYFIPK +TLLVNVWAIA
Sbjct  343  LVKESDLGQLTFLQAVIKENFRLHPSTPLSLPRIAQESCEINGYFIPKDSTLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPNV  +PLEF P RFL GGE+PN D++GNDFE++PFGAGRR+C+GMSLGIRMV L+ A
Sbjct  403  RDPNVWADPLEFRPGRFLRGGERPNADVRGNDFELMPFGAGRRVCAGMSLGIRMVQLMFA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFD++L NG S + L+MEEAYGLTLQRA PL+++P+PRL  H+Y
Sbjct  463  TLIHAFDFELGNGLSAQNLSMEEAYGLTLQRAEPLVVYPRPRLASHVY  510



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            VTE DL +LP+LQA++KETFRLHPSTPLSLPR+ A+ CEI GY IP+GATLLVNVWAIAR
Sbjct  347  VTEEDLPNLPYLQAVIKETFRLHPSTPLSLPRVAAKSCEIFGYHIPEGATLLVNVWAIAR  406

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP     PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+GM+LG+RMV LL AT
Sbjct  407  DPKEWAEPLEFRPERFLKGGEKADVDVRGNDFEVIPFGAGRRICAGMTLGLRMVQLLTAT  466

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+FDW+L  G   E LNM+EAYGLTLQRA+PL +HPKPRL  H+Y+
Sbjct  467  LAHSFDWELEGGLKQEDLNMDEAYGLTLQRALPLSVHPKPRLSSHVYS  514



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA+VKETFRLHP TPLSLPR+ A+ CEINGY IPKGATLLVNVWAIA
Sbjct  343  LVTELDLPRLTYLQAVVKETFRLHPPTPLSLPRIAAESCEINGYRIPKGATLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL F P RFLPGGEK NVD+KGNDFE+IPFGAGRRIC GMSLG+RMV  + A
Sbjct  403  RDPEAWAEPLAFRPERFLPGGEKANVDVKGNDFELIPFGAGRRICVGMSLGLRMVQFMTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAFDW++ +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  463  TLAHAFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  510



>ref|XP_008794133.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=510

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LP LQAI+KETFR+HPSTPLSLPR+ A  CEINGY IPKGATLLVNVWAI 
Sbjct  340  LVSESDLAHLPLLQAIIKETFRIHPSTPLSLPRVAAGHCEINGYHIPKGATLLVNVWAIG  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGG   +VDIKGNDFE+IPFGAGRRIC+GMSLG+RMV L+ A
Sbjct  400  RDPATWADPLEFRPSRFLPGGGHEHVDIKGNDFEIIPFGAGRRICAGMSLGLRMVQLMAA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ  E LNMEEA+GLTLQRAVPL + PKPRL PH+Y
Sbjct  460  TLVHAFDWALPVGQDPEKLNMEEAFGLTLQRAVPLAVCPKPRLAPHVY  507



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +L+AIVKE FRLHPSTPLSLPR+ ++ CEINGYFIPKG+TLLVNVWAIA
Sbjct  345  LVMESDLAQLTYLEAIVKEIFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +P+EF P RFLPGGEKP VD+KGNDFEVIPFGAGRRIC GMSLGIRMV L+ A
Sbjct  405  RDPNQWADPIEFRPERFLPGGEKPKVDVKGNDFEVIPFGAGRRICPGMSLGIRMVQLMTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+H+F+W L  GQ  + LNMEEA+GLTLQRA PL++HP PRL+  ++
Sbjct  465  TLIHSFNWALPTGQLPDKLNMEEAFGLTLQRADPLVVHPIPRLEAQVF  512



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  285  LVSESDLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  344

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +   PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  345  RDPLMWPEPLKFKPERFLPGSEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  404

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H+FDW+L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  405  TLIHSFDWELPEGQLIEKLNMDEAYGLTLQRASPLMVHPKLRLE  448



>gb|AJF48886.1| flavonoid 3'-hydroxylase, partial [Paeonia suffruticosa]
Length=252

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL +LPFLQA+VKETFRLHPSTPLSLPRM +Q CEINGY+IPKG+TLLVNVWAIA
Sbjct  104  LVTELDLLNLPFLQAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIA  163

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V   PLEF P RFL GGEKPNVDIKGNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  164  RDPDVWAEPLEFRPDRFLLGGEKPNVDIKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  223

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTL  272
            TLVHAFDW L  GQ  E L MEEAYGLTL
Sbjct  224  TLVHAFDWSLPAGQIPEKLEMEEAYGLTL  252



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKETFRLHPSTPLSLPR+ +  CE++GY IPKG+TLLVNVW IA
Sbjct  337  LVTELDLSQLTFLQAIVKETFRLHPSTPLSLPRVSSDDCEVSGYHIPKGSTLLVNVWGIA  396

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V T+PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC G+SLG+RMV LLVA
Sbjct  397  RDPEVWTDPLEFRPTRFLPGGEKPNVDVRGNDFEVIPFGAGRRICVGISLGLRMVQLLVA  456

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHL  218
            TLV  FDW+L  G   E LNM+E YGLTLQRA PLM+HPK RL  H+
Sbjct  457  TLVQTFDWELAKGLEPEKLNMDETYGLTLQRAEPLMVHPKSRLAHHV  503



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA+VKETFRLHPSTPLSLPR+ A+ CEINGY IPKG+TLLVNVWAIA
Sbjct  340  LVTELDLPQLTYLQAVVKETFRLHPSTPLSLPRIAAESCEINGYHIPKGSTLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL F P RFL GGEK NVD++GNDFE+IPFGAGRRIC+GMSLG+RMV LL A
Sbjct  400  RDPEEWVEPLVFRPERFLAGGEKANVDVRGNDFELIPFGAGRRICAGMSLGLRMVQLLTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  230
            TLVHAF+W+L +G   E LNMEEAYGLTLQRAVPLM+HPKPRL
Sbjct  460  TLVHAFEWELADGLLPEKLNMEEAYGLTLQRAVPLMVHPKPRL  502



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L + QA++KETFRLHPSTPLSLPR+ A+ CEINGY IP+G+TLLVNVWAIA
Sbjct  346  LVTELDLPKLTYFQAVIKETFRLHPSTPLSLPRVAAKSCEINGYHIPEGSTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+    PL F P RFLPGGEK NVD++GND+E+IPFGAGRRIC+GMSLG+RMV LL A
Sbjct  406  RDPDEWAEPLVFRPERFLPGGEKANVDVRGNDYEIIPFGAGRRICAGMSLGLRMVQLLTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDWD  +G + E LNMEEAYGLTLQRA PL++HP+PRL P  Y
Sbjct  466  TLIHAFDWDFPSGLTPEKLNMEEAYGLTLQRADPLIVHPRPRLTPKAY  513



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  312  LVSEADLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  371

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + ++PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  372  RDPLMWSDPLKFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  431

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H F+W+L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  432  TLIHGFNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  475



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  288  LVSEADLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + ++PL+F P RFLPG EK N+DIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  348  RDPLMWSDPLKFKPERFLPGNEKANIDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H F+W+L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  408  TLIHGFNWELPAGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  451



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  L +LQA+VKETFRLHPSTP+S+PRM  + CEINGY IPKG TLLVNVWAIA
Sbjct  341  LVSELDLAQLTYLQAVVKETFRLHPSTPMSVPRMANESCEINGYHIPKGTTLLVNVWAIA  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   T+PLEF P RFLPGGEK  VDI+GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  401  RDPAEWTDPLEFRPERFLPGGEKAQVDIRGNDFEVIPFGAGRRICAGMSLGVRMVQLLTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +LVH F+  L NG   E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  461  SLVHGFNLGLPNGLLPEKLNMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESD+  L FLQA++KETFRLHPSTPLSLPR+ A+ CEING+FIPKG+TLLVNVWAIA
Sbjct  342  LVTESDIAQLTFLQAVMKETFRLHPSTPLSLPRIAAENCEINGFFIPKGSTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PL+F P RFLPG E  +VD++GNDFE++PFGAGRRIC+GMS G+RMV  L A
Sbjct  402  RDPAVWPEPLKFRPERFLPGSEHAHVDVRGNDFELMPFGAGRRICAGMSWGLRMVLFLTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV AFDW L  GQ+ E LNMEEAYGLTLQRAVPL++H +PRL PH+Y
Sbjct  462  TLVQAFDWVLPEGQTPENLNMEEAYGLTLQRAVPLLVHTRPRLAPHVY  509



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  321  LVSEADLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  380

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + ++PLEF P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  381  RDPLMWSDPLEFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGMSLGLRMVQFMTA  440

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
             L+H F+W+L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  441  ALIHGFNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  484



>gb|AAO47851.1| flavonoid 3'-hydroxylase [Glycine max]
Length=325

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA++KETFRLHPSTPLS+PR  A+ CEI GY IPKGATLLVN+WAIAR
Sbjct  155  VKEEDLAHLPYLQAVIKETFRLHPSTPLSVPRAAAESCEIFGYHIPKGATLLVNIWAIAR  214

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+G+SLG++MV LL A 
Sbjct  215  DPKEWNDPLEFRPERFLLGGEKADVDVRGNDFEVIPFGAGRRICAGLSLGLQMVQLLTAA  274

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            L H+FDW+L +  + E LNM+EAYGLTLQ AVPL +HP+PRL PH+Y+++
Sbjct  275  LAHSFDWELEDCMNPEKLNMDEAYGLTLQPAVPLSVHPRPRLAPHVYSMS  324



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  L +LQA+VKETFRLHPSTP+S+PRM  + CEINGY IPKG TLLVNVWAIA
Sbjct  341  LVSELDLAQLTYLQAVVKETFRLHPSTPMSVPRMANESCEINGYHIPKGTTLLVNVWAIA  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   T+PLEF P RFLPGGEK  VDI+GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  401  RDPAEWTDPLEFRPERFLPGGEKAQVDIRGNDFEVIPFGAGRRICAGMSLGVRMVQLLTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +LVH F+  L NG   E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  461  SLVHGFNLGLPNGLLPEKLNMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDLT L FL AIVKE+FRLHPSTPLSLPR+ ++ CE+NGY IPKG+TLLVN+WAI 
Sbjct  340  LVTESDLTQLTFLHAIVKESFRLHPSTPLSLPRIASESCEVNGYHIPKGSTLLVNIWAIG  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            R P V  +PLEF P RFLPGGEKP V++K NDFEV+PFGAGRRIC+GMSL ++MVHLL+A
Sbjct  400  RHPEVWADPLEFRPARFLPGGEKPGVNVKVNDFEVLPFGAGRRICAGMSLALKMVHLLIA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+ AFDW+L NG   E LNMEE +G+++Q+A PLM+HP+PRL PH Y
Sbjct  460  TLIQAFDWELANGLDPERLNMEEEFGISVQKAEPLMVHPRPRLAPHTY  507



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA++KETFRLHPSTPLS+PR  A+ CEI GY IPKGATLLVN+WAIAR
Sbjct  343  VKEEDLAHLPYLQAVIKETFRLHPSTPLSVPRAAAESCEIFGYHIPKGATLLVNIWAIAR  402

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+G+SLG++MV LL AT
Sbjct  403  DPKEWNDPLEFRPERFLLGGEKADVDVRGNDFEVIPFGAGRRICAGLSLGLQMVQLLTAT  462

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            L H+FDW+L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  463  LAHSFDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL  L +L A++KETFRLHPSTPLSLPRM A+ CEI+GY IPKGATLLVNVWAIA
Sbjct  336  LVSDLDLPQLTYLSAVIKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGATLLVNVWAIA  395

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V   PL F P RFLPGGEK  VD++GNDFE+IPFG GRRIC+G+S G+R+V+L+ A
Sbjct  396  RDPDVWAEPLVFMPERFLPGGEKAKVDVRGNDFELIPFGGGRRICAGLSYGLRVVYLMAA  455

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAFDW+L NG   E LNM+EAYGLTLQRA PLM+HPKPRL P  Y
Sbjct  456  TLLHAFDWELANGLIPEKLNMDEAYGLTLQRAAPLMVHPKPRLSPQAY  503



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  285  LVSESDLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  344

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RD  +   PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  345  RDLLMWPEPLKFKPERFLPGSEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  404

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H+FDW+L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  405  TLIHSFDWELPEGQLIEKLNMDEAYGLTLQRASPLMVHPKLRLE  448



>ref|XP_010939156.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=516

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL +LPF+QAI KETFRLHPSTPLSLPRM ++ CE+ GY IP+GATLLVNVWAIA
Sbjct  349  LVSESDLPNLPFVQAISKETFRLHPSTPLSLPRMSSEACEVAGYHIPQGATLLVNVWAIA  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V  +PLEF P RFLPGG   ++D+KGNDFE+IPFGAGRRIC+GMSLGIRMV  ++A
Sbjct  409  RDPAVWHDPLEFQPARFLPGGGYEHMDVKGNDFEIIPFGAGRRICAGMSLGIRMVQFMIA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +LVHAFDW L  GQ  E L+MEEAYGLTLQRA+PLM+HP PRL    Y
Sbjct  469  SLVHAFDWALPEGQMAEKLDMEEAYGLTLQRAMPLMVHPVPRLASAAY  516



>ref|XP_010936313.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=508

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  LP LQAIVKETFR+HPSTPLSLPR+ A  CEINGY IPKGA LLVN+WAI 
Sbjct  338  LVSEPDLVHLPLLQAIVKETFRIHPSTPLSLPRIAADNCEINGYHIPKGANLLVNIWAIG  397

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGG   ++DIKGNDFE+IPFGAGRRIC+GMSLG+RMV L++A
Sbjct  398  RDPATWADPLEFRPSRFLPGGGHEHIDIKGNDFEIIPFGAGRRICAGMSLGLRMVQLMLA  457

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            T+VH FDW L+ GQ  E LNMEEA+GLTLQRA PL L PKPRL PH YT
Sbjct  458  TMVHGFDWALLMGQVPEKLNMEEAFGLTLQRAEPLSLWPKPRLAPHAYT  506



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESD++ LP+LQA++KE FRLHP TPLSLP + A+ CEINGY IPKG+TLL N+WAIA
Sbjct  337  LVSESDISQLPYLQAVIKENFRLHPPTPLSLPHIAAESCEINGYHIPKGSTLLTNIWAIA  396

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R + +L A
Sbjct  397  RDPDQWSDPLSFKPERFLPGGEKAGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQMLTA  456

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TLVH F+W+L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  457  TLVHGFEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGL  506



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA++KETFRLHPSTPLS+PR  A+ CEI GY IPKGATLLVN+WAIAR
Sbjct  343  VKEEDLAHLPYLQAVIKETFRLHPSTPLSVPRAAAESCEIFGYHIPKGATLLVNIWAIAR  402

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+G+SLG++MV LL A 
Sbjct  403  DPKEWNDPLEFRPERFLLGGEKADVDVRGNDFEVIPFGAGRRICAGLSLGLQMVQLLTAA  462

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            L H+FDW+L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  463  LAHSFDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA++KETFRLHPSTPLS+PR  A+ CEI GY IPKGATLLVN+WAIAR
Sbjct  343  VKEEDLAHLPYLQAVIKETFRLHPSTPLSVPRAAAESCEIFGYHIPKGATLLVNIWAIAR  402

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+G+SLG++MV LL A 
Sbjct  403  DPKEWNDPLEFRPERFLLGGEKADVDVRGNDFEVIPFGAGRRICAGLSLGLQMVQLLTAA  462

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            L H+FDW+L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  463  LAHSFDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  320  LVSEADLSQLPFLQAVIKEVFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  379

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  380  RDPLMWPDPLKFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  439

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H F+W+L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  440  TLIHGFNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  483



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESD++ LP+LQAI+KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIA
Sbjct  337  LVSESDISQLPYLQAIIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIA  396

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R + +L A
Sbjct  397  RDPDQWSDPLSFKPERFLPGGEKAGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQMLTA  456

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TLVH F+W+L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  457  TLVHGFEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGL  506



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL +LPFLQAI+KETFRLHPSTPLSLPR+ ++ CEINGY+IPK ATLLVNVWAIA
Sbjct  333  LVSETDLPNLPFLQAIIKETFRLHPSTPLSLPRISSEPCEINGYYIPKNATLLVNVWAIA  392

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V ++PLEF P RF+PGGEK NVD+KGNDFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  393  RDPAVWSDPLEFKPERFMPGGEKANVDVKGNDFEVIPFGAGRRICAGMSLGLRMVQFMTA  452

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  230
            TLVH F+W L  G + E L+MEE+YGLTLQR VPL + P PRL
Sbjct  453  TLVHGFEWGLPEGVNAEKLDMEESYGLTLQRKVPLTVQPIPRL  495



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            L+ E+D+ +L + QA++KE FRLHPSTPLSLPR+  + CEINGY IPK  TLLVNVWAIA
Sbjct  343  LIAEADIPNLTYFQAVIKEVFRLHPSTPLSLPRVANESCEINGYHIPKNTTLLVNVWAIA  402

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V  +PLEF P RFLPGGEKPNVD+KGNDFE+IPFGAGRRIC+G+SLG+RMV L+ A
Sbjct  403  RDPEVWADPLEFKPERFLPGGEKPNVDVKGNDFELIPFGAGRRICAGLSLGLRMVQLMTA  462

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL H +DW L +G   E LNM+EAYGLTLQR VPLM+HP  RL  H+Y
Sbjct  463  TLAHTYDWALADGLMPEKLNMDEAYGLTLQRKVPLMVHPTRRLSAHVY  510



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   258 bits (658),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA+VKE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  339  INESDLSQLPYLQAVVKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  398

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  399  DPDQWSDPLSFRPERFLPGGEKFGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQLLTAT  458

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH FDW+L  G + E LNMEEAYG+TLQRAVPL++HPKPRL P +Y L
Sbjct  459  LVHGFDWELAGGITPEKLNMEEAYGITLQRAVPLVVHPKPRLAPGIYGL  507



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  312  LVSEADLSQLPFLQAVIKEVFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  371

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  372  RDPLMWPDPLKFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  431

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H F+W+L  GQ +E LNM+EAYGLTLQRA  LM+HPK RL+
Sbjct  432  TLIHGFNWELPQGQVIEKLNMDEAYGLTLQRASTLMVHPKLRLE  475



>gb|ADE80872.1| flavonoid 3'-hydroxylase, partial [Cyclamen persicum]
Length=176

 Score =   246 bits (629),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L FLQA++KETFRLHPSTPLSLPRM ++GCEINGY IPKG+TLLVNVW+IA
Sbjct  32   LVTESDLPQLAFLQAVIKETFRLHPSTPLSLPRMASEGCEINGYSIPKGSTLLVNVWSIA  91

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PLEF P RFLPGGEKPN D++GNDFEVIPFGAGRRIC+GMSLG+RMV LL A
Sbjct  92   RDPSIWADPLEFRPARFLPGGEKPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTA  151

Query  358  TLVHAFDWDLVNGQSVETLNMEEAY  284
            TLVH+F+WDL+NG S + L+MEEAY
Sbjct  152  TLVHSFNWDLLNGMSPDKLDMEEAY  176



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   257 bits (657),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESD++ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIA
Sbjct  337  LVNESDISQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIA  396

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R + +L A
Sbjct  397  RDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQILTA  456

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TLVH F+W+L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  457  TLVHGFEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGL  506



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL  LP+LQA+VKETFRLHP TPLSLPR+    CEI+GY IPKG+TLLVNVWAIA
Sbjct  345  LVSETDLNQLPYLQAVVKETFRLHPPTPLSLPRLAEDDCEIDGYLIPKGSTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V  +PLEF P RFL GGEK +VD+KGNDFE+IPFGAGRRIC+G+ LGIRMV LL A
Sbjct  405  RDPKVWADPLEFRPERFLTGGEKADVDVKGNDFELIPFGAGRRICAGVGLGIRMVQLLTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +L+HAFD DL NG   + LNMEEAYGLTLQRA PL++HP+ RL  H+Y
Sbjct  465  SLIHAFDLDLANGLLPQNLNMEEAYGLTLQRAEPLLVHPRLRLATHVY  512



>ref|XP_008791304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=517

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL +LPF+QAI KETFRLHPSTPLSLPRM A+ CE+ GY IPKGATLLVNVWAIA
Sbjct  348  LVSESDLPNLPFMQAITKETFRLHPSTPLSLPRMAAEECEVAGYCIPKGATLLVNVWAIA  407

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V  +PLEF P RFLP G    +D+KGNDF +IPFGAGRRIC+GMSLGIRMV  + A
Sbjct  408  RDPAVWRDPLEFRPARFLPDGGCEGMDVKGNDFGIIPFGAGRRICAGMSLGIRMVQFMTA  467

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAF WDL  GQ  E L+MEEAYGLTLQRA PLM+HP PRL P  Y
Sbjct  468  TLAHAFHWDLPEGQITEKLDMEEAYGLTLQRATPLMVHPVPRLAPTAY  515



>gb|AGL98409.1| flavonoid 3'-hydroxylase, partial [Tulipa fosteriana]
Length=216

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  LPFLQAI+KETFRLHPSTPLSLPRM ++ C ING+ IPK ATLLVNVWAIA
Sbjct  47   LVAESDLPRLPFLQAIIKETFRLHPSTPLSLPRMASESCTINGFHIPKHATLLVNVWAIA  106

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V ++P+EF P RF+PGG+   +D+KG+DFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  107  RDPAVWSDPVEFKPSRFMPGGDGARLDVKGSDFEVIPFGAGRRICAGMSLGLRMVTFMTA  166

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW+L  G   E L+MEEAYGLTLQRAVPL + P  RL    Y
Sbjct  167  TLVHGFDWELPKGVVAEKLDMEEAYGLTLQRAVPLTVMPVQRLTARAY  214



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESD++ LP+LQAI+KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIA
Sbjct  337  LVNESDISQLPYLQAIIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIA  396

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+  ++PL F P RFLPGGEK  VD++G+DFE+IPFGAGRRIC+G+SLG+R + +L A
Sbjct  397  RDPDQWSDPLSFKPERFLPGGEKAGVDVRGSDFELIPFGAGRRICAGLSLGLRTIQILTA  456

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TLVH F+W+L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  457  TLVHGFEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGL  506



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L +LQAI+KE FRLHPSTPLS+PR+  + CEINGYFIPKG+TLLVN+WAIA
Sbjct  367  LVIESDLPQLTYLQAIIKENFRLHPSTPLSVPRIAHESCEINGYFIPKGSTLLVNIWAIA  426

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN+  +PL+F P RFLPGGEK +VD++GNDFE++PFG+GRRIC+G+ L +R V LL A
Sbjct  427  RDPNIWADPLQFRPDRFLPGGEKADVDVRGNDFELMPFGSGRRICAGLGLAVRTVQLLTA  486

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+H FD++L +G+    LNMEEAYGLTLQRA PLM+HP+PRL P +Y
Sbjct  487  TLIHGFDFELGDGKLGHELNMEEAYGLTLQRAEPLMVHPRPRLAPRVY  534



>gb|AHB18038.1| flavonoid 3'-hydroxylase, partial [Anthurium andraeanum]
Length=292

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL  LPFLQA+VKETFRLHPSTPLSLPR  +  CE+ GY IP GATLLVNVWAIA
Sbjct  120  LVSDDDLAGLPFLQAVVKETFRLHPSTPLSLPRASSGSCEVGGYHIPGGATLLVNVWAIA  179

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE  +VD++G DFE+IPFGA RRIC+GM++G+RMV  L A
Sbjct  180  RDPAVWPCPLEFRPERFLPGGEHTHVDVRGTDFELIPFGAARRICAGMTMGLRMVQFLTA  239

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ+ E L+MEEA+GLTLQRAVPL   P PRL P  Y
Sbjct  240  TLVHAFDWALPEGQTPEKLDMEEAFGLTLQRAVPLQARPTPRLSPEAY  287



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            L+ E+D+ +L + QA++KE FRLHPSTPLSLPR+  + CEINGY IPK  TLLVNVWAIA
Sbjct  342  LIAEADIPNLTYFQAVIKEVFRLHPSTPLSLPRVANESCEINGYHIPKNTTLLVNVWAIA  401

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V  +PLEF P RFLPGGEKPNVD+KGNDFE+IPFGAGRRIC+G+SLG+RMV L+ A
Sbjct  402  RDPEVWADPLEFKPERFLPGGEKPNVDVKGNDFELIPFGAGRRICAGLSLGLRMVQLMTA  461

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL H +DW L +G   E LNM+EAYGLTLQR VPLM+HP  RL   +Y
Sbjct  462  TLAHTYDWALADGLMPEKLNMDEAYGLTLQRKVPLMVHPTRRLSARVY  509



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL+ L FLQAIVKE FRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVN+WAI 
Sbjct  340  LVTEMDLSQLTFLQAIVKEAFRLHPSTPLSLPRIASESCEVDGYYIPKGSTLLVNIWAIG  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            R P V T+PLEF P RFLPGGEKP + +K NDFEV+PFGAGRRIC+GMSL +R V LL+ 
Sbjct  400  RHPEVWTDPLEFRPTRFLPGGEKPGIVVKVNDFEVLPFGAGRRICAGMSLALRTVQLLMG  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV AFDW+L NG   E LNM+EA+GL++QRA PL++HP+PRL PH+Y
Sbjct  460  TLVQAFDWELANGIKPEKLNMDEAFGLSVQRAEPLVVHPRPRLPPHVY  507



>ref|XP_003598947.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69198.1| flavonoid hydroxylase [Medicago truncatula]
Length=286

 Score =   248 bits (633),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
             + +D+ +LP+LQ ++KETFRLHPSTPLSLPR+ ++ CEI GY +PK +TLLVNVWAIAR
Sbjct  116  TSSNDIPNLPYLQTVIKETFRLHPSTPLSLPRIASESCEIFGYHVPKSSTLLVNVWAIAR  175

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PL F P RFL GGEK +VD+KGNDFEVIPFGAGRRIC GMSLG+RMV LL AT
Sbjct  176  DPKEWVDPLGFKPERFLLGGEKCDVDVKGNDFEVIPFGAGRRICVGMSLGLRMVQLLTAT  235

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+FDW+L NG + E  N +E YGLTLQR VPL +HPKPRL PH+++
Sbjct  236  LAHSFDWELENGLNAEKKNKDEGYGLTLQRIVPLSVHPKPRLSPHVFS  283



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL +L FLQA++KETFRLHPSTPLSLPR+ ++ CE+ GY IP+GATLLVN+WAI 
Sbjct  349  LVTESDLPNLRFLQAVIKETFRLHPSTPLSLPRVASEACEVGGYQIPRGATLLVNIWAIT  408

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
             DP    NPLEFNP RFLPGG   +VD++G DFE+IPFGAGRRIC+GMSLGIRMV  + A
Sbjct  409  HDPASWPNPLEFNPARFLPGGGHESVDLRGQDFELIPFGAGRRICAGMSLGIRMVQFMTA  468

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ  E L+MEEAYGLTLQRAVPLM+HP+PRL    Y
Sbjct  469  TLVHAFDWSLPEGQKPEKLDMEEAYGLTLQRAVPLMVHPRPRLTSAAY  516



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V ESD++ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  343  VNESDISQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  402

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R +  L AT
Sbjct  403  DPDQWSDPLTFKPDRFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTAT  462

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LV  FDW+L  G + E LNMEE+YGLTLQRAVPLM+HPKPRL P++Y +
Sbjct  463  LVQGFDWELAGGITPEKLNMEESYGLTLQRAVPLMVHPKPRLAPNVYGI  511



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA+VKETFRLHPSTPLSLPR+ ++ CEI GY IPK +TLLVNVWAIAR
Sbjct  346  VKEEDLPQLPYLQAVVKETFRLHPSTPLSLPRIASESCEIFGYHIPKDSTLLVNVWAIAR  405

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            D  +  +PL+F P RFLPGGE  +VD+KGNDFEVIPFGAGRRIC+G++LGIRMV L +AT
Sbjct  406  DQEIWVDPLKFKPERFLPGGENCDVDVKGNDFEVIPFGAGRRICAGLNLGIRMVQLQIAT  465

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+F+W+L NG + + +NM+E++GL +QRAVPL++HPKPRL PH+Y+
Sbjct  466  LAHSFNWELENGINAKDINMDESFGLGIQRAVPLLVHPKPRLLPHVYS  513



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V ESD+  LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  342  VNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  401

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R +  L AT
Sbjct  402  DPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTAT  461

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LV  FDW+L  G + E LNMEE+YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  462  LVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGL  510



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  288  LVSEADLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  348  RDPLMWPDPLKFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  245
            TL+H F+W+L  GQ +E LNM+EAYGLTLQRA PLM+H
Sbjct  408  TLIHGFNWELPEGQVIEKLNMDEAYGLTLQRASPLMVH  445



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LPFL AI+KETFRLHPSTPLSLPRM ++ C INGY IPK ATLLVNVWAIA
Sbjct  290  LVSESDLPHLPFLSAIIKETFRLHPSTPLSLPRMASESCTINGYHIPKNATLLVNVWAIA  349

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   P+EF P RF+PGG+  ++D+KG+DFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  350  RDPAVWAAPVEFKPDRFMPGGDGAHLDVKGSDFEVIPFGAGRRICAGMSLGLRMVTFMTA  409

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  230
            TLVH FDW L NG   E L+MEEAYGLTLQRAVPLM+ P PRL
Sbjct  410  TLVHGFDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVVPVPRL  452



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  340  INESDLSQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  399

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KGNDFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  400  DPDQWSDPLTFRPERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTAT  459

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH F+W+L  G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L
Sbjct  460  LVHGFEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYGL  508



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KE FRLHPSTPLSLPR  ++ C+INGY IPKG+TLLVN+WAIA
Sbjct  369  LVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIA  428

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEK NVD+KGND+E+IPFGAGRRIC+G+S G+RMV L  A
Sbjct  429  RDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFGAGRRICAGLSWGLRMVQLGTA  488

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAF+W+L  G   E LNM+EAYGLTLQRA PL++HP+PRL P+ Y
Sbjct  489  TLAHAFNWELPGGLKPEKLNMDEAYGLTLQRAAPLVVHPRPRLSPNAY  536



>gb|EMT05634.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=241

 Score =   244 bits (622),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTESDL  L FL A++KETFRLHPSTPLSLPR+ A+ CE++GY IPK  TLLVNVWAIA
Sbjct  71   LVTESDLPQLTFLAAVIKETFRLHPSTPLSLPRVAAEDCEVDGYRIPKDTTLLVNVWAIA  130

Query  538  RDP-NVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLV  362
            RDP +   + LEF P RFLPGG   +VD+KG D+E+IPFGAGRRIC+G+S G+RMV L  
Sbjct  131  RDPASWGDDVLEFRPTRFLPGGSHESVDVKGGDYELIPFGAGRRICAGLSWGLRMVTLTT  190

Query  361  ATLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            ATLVHAFDW LV+G + E L+MEEAYGLTLQRAVPLM+ P PRL P  YT+
Sbjct  191  ATLVHAFDWTLVDGMTPEKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYTM  241



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+D+  LP++QAIVKETFRLHPSTPLSLPR+ ++ C +NGY IPK  TLLVNVWAI+
Sbjct  339  LVSETDIRSLPYIQAIVKETFRLHPSTPLSLPRISSEACTVNGYLIPKNTTLLVNVWAIS  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFL GG    VD+KGNDFE+IPFGAGRR+C+G+SLG+RMV  L A
Sbjct  399  RDPGVWKEPLEFRPERFLGGGGYETVDLKGNDFELIPFGAGRRVCAGLSLGLRMVQFLTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW LV+GQS E L+MEEAYGL LQRAVPLM+ P PRL    Y
Sbjct  459  TLVHGFDWKLVDGQSAEKLDMEEAYGLPLQRAVPLMVRPVPRLDEKAY  506



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L +LQA++KE FRLHPSTPLSLPR  ++ C+INGY IPKG+TLLVN+WAIA
Sbjct  347  LVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   +PLEF P RFLPGGEK NVD+KGND+E+IPFGAGRRIC+G+S G+RMV L  A
Sbjct  407  RDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFGAGRRICAGLSWGLRMVQLGTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL HAF+W+L  G   E L+M+EAYGLTLQRA PL++HP+PRL P+ Y
Sbjct  467  TLAHAFNWELPGGLKPEKLSMDEAYGLTLQRAAPLVVHPRPRLSPNAY  514



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL +LP LQA+VKET RLHPSTPLSLPRM ++ C I GY IPK AT LVNVWAI 
Sbjct  345  LVSESDLPNLPVLQAVVKETLRLHPSTPLSLPRMSSEECVIGGYRIPKHATPLVNVWAIG  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP+V T+PLEF P RFLPGGE+ +VD++GNDFEVIPFGAGRRIC+GMSLGIRMV L+ A
Sbjct  405  RDPSVWTDPLEFRPARFLPGGEREHVDVRGNDFEVIPFGAGRRICAGMSLGIRMVQLMTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            T+VHAFDW L  G   E L+MEEAYGLTLQRAVPL LHP PRL    Y +
Sbjct  465  TIVHAFDWTLPGGFKPEHLDMEEAYGLTLQRAVPLDLHPVPRLLKQSYLI  514



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  L +L+A+VKETFRLHPSTPLSLPR+ A+ C+INGY IPKG TLLVNVWAIA
Sbjct  319  LVSELDLPQLTYLKALVKETFRLHPSTPLSLPRIAAENCDINGYHIPKGTTLLVNVWAIA  378

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   T+PL F P RFLPGGEK  VD++GNDFEVIPFG+GRR+C GMSLG+R V LL A
Sbjct  379  RDPAEWTDPLLFRPERFLPGGEKAEVDVRGNDFEVIPFGSGRRMCVGMSLGLRTVQLLTA  438

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +LVHAF++ L NG   E LNM+EAYGLTLQRA PLM+HP PRL  H+Y
Sbjct  439  SLVHAFNFGLANGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVY  486



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  546  INESDLSQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  605

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  T+PL F P RFLPGGEK  VD+KGNDFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  606  DPDQWTDPLSFRPERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTAT  665

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH F+W+L  G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L
Sbjct  666  LVHGFEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDMSAYGL  714



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  340  INESDLSQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  399

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  T+PL F P RFLPGGEK  VD+KGNDFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  400  DPDQWTDPLSFRPERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTAT  459

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH F+W+L  G + E LNMEE YG+TLQRAVPL++HPK RL    Y L
Sbjct  460  LVHGFEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGL  508



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LPFL AI+KETFRLHPSTPLSLPRM ++ C INGY IPK ATLLVNVWAIA
Sbjct  341  LVSESDLPHLPFLSAIIKETFRLHPSTPLSLPRMASESCTINGYHIPKNATLLVNVWAIA  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   P+EF P RF+PGG+  ++D+KG+DFE+IPFGAGRRIC+GMSLG+RMV  + A
Sbjct  401  RDPAVWAAPVEFKPDRFMPGGDGVHLDVKGSDFEMIPFGAGRRICAGMSLGLRMVTFMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L NG   E L+MEEAYGLTLQRAVPLM+ P PRL    Y
Sbjct  461  TLVHGFDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVLPVPRLAKQAY  508



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V E DL  LP+LQA+VKETFRLHPSTPLSLPR+ ++ CEI GY IPK +TLLVNVWAIAR
Sbjct  346  VKEEDLPQLPYLQAVVKETFRLHPSTPLSLPRIASESCEIFGYHIPKDSTLLVNVWAIAR  405

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            D  +  +PL+F P RFLPGGE  +VD+KGNDFEVIPFGAGRRIC+G++LGIRMV L +AT
Sbjct  406  DQEIWVDPLKFKPERFLPGGENCDVDVKGNDFEVIPFGAGRRICAGLNLGIRMVQLQIAT  465

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+F+W+L NG + + +NM+E++GL +QRAVPL++HPKPRL PH+Y+
Sbjct  466  LAHSFNWELENGINAKDINMDESFGLGIQRAVPLLVHPKPRLLPHVYS  513


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 44/90 (49%), Gaps = 24/90 (27%)
 Frame = -2

Query  481  GGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDWDLVNGQSVETL  302
            GGE  NVD+KGNDFEVI FG G RIC                        L NG + +  
Sbjct  529  GGENCNVDVKGNDFEVILFGVGCRIC------------------------LENGLNAKKH  564

Query  301  NMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
                ++     ++  +++HPKPRL PH+Y+
Sbjct  565  KHGRSFWPRYSKSCAILVHPKPRLLPHVYS  594



>ref|XP_007155244.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
 gb|ESW27238.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
Length=329

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKETFRLHP TPLS+PR+  + CEI GY IPKGATLLVNVWAI 
Sbjct  157  LVTELDLPHLPYLQAVVKETFRLHPPTPLSIPRISEESCEIFGYHIPKGATLLVNVWAIG  216

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   ++PLEF P RFL GGEK  VD+KGN+FEVIPFGAGRRIC+GMSLG+  V LL A
Sbjct  217  RDPKEWSDPLEFKPERFLLGGEKGGVDVKGNNFEVIPFGAGRRICAGMSLGLVEVQLLTA  276

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  233
            TL HAFDW+L NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  277  TLAHAFDWELENGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  318



>ref|XP_007155243.1| hypothetical protein PHAVU_003G1855001g, partial [Phaseolus vulgaris]
 gb|ESW27237.1| hypothetical protein PHAVU_003G1855001g, partial [Phaseolus vulgaris]
Length=364

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKETFRLHP TPLS+PR+  + CEI GY IPKGATLLVNVWAI 
Sbjct  192  LVTELDLPHLPYLQAVVKETFRLHPPTPLSIPRISEESCEIFGYHIPKGATLLVNVWAIG  251

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   ++PLEF P RFL GGEK  VD+KGN+FEVIPFGAGRRIC+GMSLG+  V LL A
Sbjct  252  RDPKEWSDPLEFKPERFLLGGEKGGVDVKGNNFEVIPFGAGRRICAGMSLGLVEVQLLTA  311

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  233
            TL HAFDW+L NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  312  TLAHAFDWELENGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  353



>gb|AGT50316.1| flavonoid 3'-hydroxylase, partial [Meconopsis integrifolia]
Length=445

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  288  LVSEADLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PL F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV    A
Sbjct  348  RDPLMWPDPLRFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFTTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  245
            TL+H F+W+L  GQ +E L+M+EAYGLTLQRA PLM+H
Sbjct  408  TLIHGFNWELPEGQVIEKLSMDEAYGLTLQRASPLMVH  445



>ref|XP_007155245.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
 gb|ESW27239.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
Length=368

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKETFRLHP TPLS+PR+  + CEI GY IPKGATLLVNVWAI 
Sbjct  196  LVTELDLPHLPYLQAVVKETFRLHPPTPLSIPRISEESCEIFGYHIPKGATLLVNVWAIG  255

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   ++PLEF P RFL GGEK  VD+KGN+FEVIPFGAGRRIC+GMSLG+  V LL A
Sbjct  256  RDPKEWSDPLEFKPERFLLGGEKGGVDVKGNNFEVIPFGAGRRICAGMSLGLVEVQLLTA  315

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  233
            TL HAFDW+L NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  316  TLAHAFDWELENGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  357



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  340  INESDLSQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  399

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KGNDFE+IPFGAGRRIC+G+SL +R + LL AT
Sbjct  400  DPDQWSDPLTFRPERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLWLRTIQLLTAT  459

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH F+W+L  G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L
Sbjct  460  LVHGFEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYGL  508



>ref|XP_003574810.2| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=548

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L FL A++KETFRLHPSTPLSLPR+ A+ CE++GY IPKG TLLVNVWAIA
Sbjct  375  LVSESDLPRLAFLAAVIKETFRLHPSTPLSLPRLAAEECEVDGYRIPKGTTLLVNVWAIA  434

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGG    VD+KG D+E+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  435  RDPASWADPLEFRPARFLPGGSHEGVDVKGGDYELIPFGAGRRICAGLSWGLRMVTLMTA  494

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  206
            TLVH FDW LVNG + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y + 
Sbjct  495  TLVHGFDWALVNGMTPDKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYAVQ  545



>ref|NP_001141292.1| uncharacterized protein LOC100273383 [Zea mays]
 gb|ACF85998.1| unknown [Zea mays]
Length=457

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  288  LVSESDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  348  RDPEAWPEPLEFRPARFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  408  TLVHALDWDLADGMTADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  456



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 137/169 (81%), Gaps = 8/169 (5%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            +VTE D++ LP+L+A+VKETF         LPR+  + CEI  Y IPKGATLLVNVWAI+
Sbjct  343  MVTELDMSHLPYLEAVVKETF--------PLPRVATESCEIFNYHIPKGATLLVNVWAIS  394

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN   NPLEF P RFLPGGEK +VDIKGNDFEVIPFGAGRRIC+GMSLGI+MV LL A
Sbjct  395  RDPNEWANPLEFKPERFLPGGEKFDVDIKGNDFEVIPFGAGRRICAGMSLGIKMVQLLTA  454

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHAFDW+L NG + E LNM EAYGLTLQR VPL++HP+PRL PHLY+
Sbjct  455  TLVHAFDWELENGCNPEKLNMAEAYGLTLQREVPLLVHPRPRLSPHLYS  503



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+L A+VKET RLHP TPLSLPR+  + CEI  Y IPKGATLLVNVWAI 
Sbjct  339  LVTELDLPHLPYLNAVVKETLRLHPPTPLSLPRVAEESCEIFNYHIPKGATLLVNVWAIG  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGEK +VDI+GN+FEVIPFGAGRRIC GMSLGI++V LL+A
Sbjct  399  RDPKEWLDPLEFKPERFLPGGEKADVDIRGNNFEVIPFGAGRRICVGMSLGIKVVQLLIA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            +L HAFDW+L NG   + LNM+EAYGLTLQRAVPL +H  PRL  H+Y+
Sbjct  459  SLAHAFDWELENGYDPKKLNMDEAYGLTLQRAVPLSIHTHPRLSQHVYS  507



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  340  INESDLSQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  399

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KGNDFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  400  DPDQWSDPLTFRPERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTAT  459

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH F+W+L  G + E LNMEE YG+TLQRAVPL++HPK RL    Y L
Sbjct  460  LVHGFEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGL  508



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LPFL A++KETFRLHPSTPL+LPRM ++ C INGY IPK ATLLVNVWAIA
Sbjct  341  LVSESDLPHLPFLSAVIKETFRLHPSTPLALPRMASESCTINGYHIPKNATLLVNVWAIA  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   P+EF P RF+PGG+  ++D+KG+DFE+IPFGAGRRIC+GMSLG+RMV  + A
Sbjct  401  RDPAVWAAPVEFKPDRFMPGGDGAHLDVKGSDFEMIPFGAGRRICAGMSLGLRMVTFMTA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L NG   E L+MEEAYGLTLQRAVPLM+ P PRL    Y
Sbjct  461  TLVHGFDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVLPVPRLAKQAY  508



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+L A+VKET RLHP TPLSLPR+  + CEI  Y IPKGATLLVNVWAI 
Sbjct  334  LVTELDLPHLPYLNAVVKETLRLHPPTPLSLPRVAEESCEIFNYHIPKGATLLVNVWAIG  393

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPGGEK +VDI+GN+FEVIPFGAGRRIC GMSLGI++V LL+A
Sbjct  394  RDPKEWLDPLEFKPERFLPGGEKADVDIRGNNFEVIPFGAGRRICVGMSLGIKVVQLLIA  453

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            +L HAFDW+L NG   + LNM+EAYGLTLQRAVPL +H  PRL  H+Y+
Sbjct  454  SLAHAFDWELENGYDPKKLNMDEAYGLTLQRAVPLSIHTHPRLSQHVYS  502



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + ++ CEINGY IPKG+TLL N+WAIAR
Sbjct  340  INESDLSQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIAR  399

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP+  ++PL F P RFLPGGEK  VD+KGNDFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  400  DPDQWSDPLTFRPERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTAT  459

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            LVH F+W+L  G + E LNMEE YG+TLQRAVPL++HPK RL    Y L
Sbjct  460  LVHGFEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGL  508



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV++ DL  LPFLQA+VKETFRLHPSTPLSLPR     CE+ GY IP GATLLVNVWAIA
Sbjct  339  LVSDDDLAGLPFLQAVVKETFRLHPSTPLSLPRASTGSCEVGGYHIPGGATLLVNVWAIA  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P RFLPGGE  +VD++G DFE+IPFGAGRRIC+GM++G+RMV  L A
Sbjct  399  RDPAVWPCPLEFRPERFLPGGEHTHVDVRGTDFELIPFGAGRRICAGMTMGLRMVQFLTA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L  GQ+ E L+MEEA+GLTLQRAVPL   P PRL P  Y
Sbjct  459  TLVHAFDWALPEGQTPEKLDMEEAFGLTLQRAVPLQARPTPRLSPEAY  506



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  288  LVSEADLSQLPFLQAVIKEVFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PL+F P RFLPG EK NVDIKGNDFEV+PFGAGRRIC+G+SLG+RMV  + A
Sbjct  348  RDPLMWPDPLKFKPERFLPGNEKANVDIKGNDFEVVPFGAGRRICAGLSLGLRMVQFMTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  245
            TL+  F+W+L  GQ +E LNM+EAYGLTLQRA PLM+H
Sbjct  408  TLIPGFNWELPEGQVIEKLNMDEAYGLTLQRASPLMVH  445



>ref|XP_006579509.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Glycine 
max]
Length=365

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKET RLHP TPLSLPR     CEI  Y IPKGATLLVNVWAI 
Sbjct  192  LVTELDLPHLPYLQAVVKETLRLHPPTPLSLPRFAENSCEIFNYHIPKGATLLVNVWAIG  251

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RF PGGEK +VD+KGN+FE+IPFGAGRRIC GMSLG+++V LL+A
Sbjct  252  RDPKEWIDPLEFKPERFFPGGEKDDVDVKGNNFELIPFGAGRRICVGMSLGLKVVQLLIA  311

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL H+FDW+L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  312  TLAHSFDWELENGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  359



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + ESDL+ LP+LQA++KE FRLHP TPLSLP + A+ CEINGY IPKG+TLL N+WAIAR
Sbjct  342  INESDLSRLPYLQAVIKENFRLHPPTPLSLPHIAAESCEINGYHIPKGSTLLTNIWAIAR  401

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP   ++PL F P RFLPGGEK  VD+KG+DFE+IPFGAGRRIC+G+SLG+R + LL AT
Sbjct  402  DPEQWSDPLAFRPERFLPGGEKFGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQLLTAT  461

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            LVH F+W+L  G + E LNMEE YG+T+QRAVPL++HPKPRL  ++Y
Sbjct  462  LVHGFEWELAGGVTPEKLNMEETYGITVQRAVPLIVHPKPRLALNVY  508



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D++ L FLQAIVKETFRLHP+TPLSLPR+ ++ CE+ GY +PKG+ L VNVWAIA
Sbjct  334  LVTEMDISQLTFLQAIVKETFRLHPATPLSLPRIASESCEVKGYHVPKGSILFVNVWAIA  393

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            R   + T+PLEF P RFL  GEKPNV++K NDFE++PFG GRRIC+GMSLG+RMV+LL+A
Sbjct  394  RQSELWTDPLEFRPGRFLIPGEKPNVEVKPNDFEIVPFGGGRRICAGMSLGLRMVNLLIA  453

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV AFDW+L NG  +E LNMEE +G++LQR  PL++HP+PRL  H+Y
Sbjct  454  TLVQAFDWELANGLELEKLNMEEVFGISLQRVQPLLVHPRPRLARHVY  501



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  LPFLQAI+KETFRLHPSTPLSLPRM ++ C ING+ IPK ATLLVNVWAIA
Sbjct  340  LVAESDLPRLPFLQAIIKETFRLHPSTPLSLPRMASESCTINGFHIPKHATLLVNVWAIA  399

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V ++P+EF P RF+PGG+   +D+KG+DFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  400  RDPAVWSDPVEFKPSRFMPGGDGARLDVKGSDFEVIPFGAGRRICAGMSLGLRMVTFMTA  459

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW+L  G   E L+MEEAYGLTLQRAVPL + P  RL    Y
Sbjct  460  TLVHGFDWELPKGVVAEKLDMEEAYGLTLQRAVPLTVMPVQRLTARAY  507



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  L +L+A+VKETFRLHPSTPLSLPR+ A+ C+INGY IPKG TLLVNVWAIA
Sbjct  346  LVSELDLPQLTYLKALVKETFRLHPSTPLSLPRIAAENCDINGYHIPKGTTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP   T+PL F P RFLPGGEK  VD++GNDFEVIPFG+GRR+C GM LG+R V LL A
Sbjct  406  RDPAEWTDPLLFRPERFLPGGEKAEVDVRGNDFEVIPFGSGRRMCVGMRLGLRTVQLLTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +LVHAF++ L NG   E LNM+EAYGLTLQRA PLM+HP PRL  H+Y
Sbjct  466  SLVHAFNFGLANGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVY  513



>gb|AGT50321.1| flavonoid 3'-hydroxylase, partial [Meconopsis wilsonii]
Length=445

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI GYFIPK  TLL NVWAIA
Sbjct  288  LVSESDLSQLPFLQAVIKEVFRLHPSTPLSLPRVSVEDCEIEGYFIPKNTTLLTNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  348  RDPSMWPDPLKFKPERFLPGSEKANVDIKGNDFEVIPFGAGRRICAGMSLGLRMVQFMTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  245
            TL+H +DW+L +GQ +E LNM+EA  + L+RA PLM+H
Sbjct  408  TLIHGYDWELPDGQVIEKLNMDEANWVALRRASPLMVH  445



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   248 bits (632),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL +LPFL AIVKETFRLHPSTPLSLP M ++ CE+NGY IP+  T+L+N+WAI+
Sbjct  358  LVSEEDLPNLPFLHAIVKETFRLHPSTPLSLPHMSSESCEVNGYHIPQNTTVLINIWAIS  417

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V T+PLEF P RFLPGG   ++D+KGNDFE+IPFGAGRR+C+G+SLG+RMV L+ A
Sbjct  418  RDPAVWTDPLEFRPSRFLPGGGYEHIDVKGNDFELIPFGAGRRMCAGLSLGLRMVQLVTA  477

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVHAFDW L   Q  E L+MEEAYG+TLQR VPLM HP PRL    Y
Sbjct  478  TLVHAFDWALPARQRAEELDMEEAYGVTLQREVPLMAHPIPRLAQKAY  525



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  346  LVSESDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  405

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PLEF P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  406  RDPEAWPEPLEFRPARFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  465

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  466  TLVHALDWDLADGMTADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  514



>gb|AGT50315.1| flavonoid 3'-hydroxylase, partial [Meconopsis betonicifolia]
Length=452

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  288  LVSEADLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNITLLTNVWAIA  347

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PL F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  348  RDPLMWPDPLRFKPERFLPGNEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  407

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  227
            TL+H  +W+L  GQ +E LNM+EA    L+RA PLM+HPK RL+
Sbjct  408  TLIHGLNWELPEGQVIEKLNMDEANWFALRRASPLMVHPKLRLE  451



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE D++ L FLQAIVKETFRLHP+TPLSLPR+ ++ CE+ GY +PKG+ L VNVWAIA
Sbjct  334  LVTEMDISQLTFLQAIVKETFRLHPATPLSLPRIASESCEVKGYHVPKGSILFVNVWAIA  393

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            R   + T+PLEF P RFL  GEKPNV++K NDFE++PFG GRRIC+GMSLG+RMV+LL+A
Sbjct  394  RQSELWTDPLEFRPGRFLIPGEKPNVEVKPNDFEIVPFGGGRRICAGMSLGLRMVNLLIA  453

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLV AFDW+L NG   E LNMEE +G++LQR  PL++HP+PRL  H+Y
Sbjct  454  TLVQAFDWELANGLEPEKLNMEEVFGISLQRVQPLLVHPRPRLARHVY  501



>gb|ABC48911.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABC48914.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=313

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  170  LVTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  229

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  230  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  289

Query  358  TLVHAFDWDLVNGQSVETLNMEEA  287
            TLVHAF+W+L  GQ  E LNM+EA
Sbjct  290  TLVHAFNWELPEGQVAEKLNMDEA  313



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V++ DL  L +LQA+VKETFRLHP TPLSLPRM +  CE+NGY IPKG+TLLV+VWAI R
Sbjct  347  VSDVDLHQLVYLQAVVKETFRLHPPTPLSLPRMASDSCEVNGYHIPKGSTLLVDVWAIGR  406

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P+RFLP GEKP+VD+KGNDFEVIPFGAGRRIC G+SLG+RMV +L AT
Sbjct  407  DPKQWVDPLEFRPNRFLPNGEKPHVDVKGNDFEVIPFGAGRRICVGLSLGLRMVQMLTAT  466

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +VH+FDW L NG + + LNM+E YGLTL+RA PL++HP+PRL   +Y
Sbjct  467  IVHSFDWTLPNGLTPDKLNMDEHYGLTLRRAQPLIMHPRPRLLLGVY  513



>gb|ABC48912.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=313

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  170  LVTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  229

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  230  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  289

Query  358  TLVHAFDWDLVNGQSVETLNMEEA  287
            TLVHAF+W+L  GQ  E LNM+EA
Sbjct  290  TLVHAFNWELPEGQVAEKLNMDEA  313



>gb|AGT50310.1| flavonoid 3'-hydroxylase, partial [Meconopsis simplicifolia]
Length=468

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  312  LVSESDLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIDGYFIPKNTTLLTNVWAIA  371

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            R P +  +PL F P RFLPG EK NVDIKGNDF+VIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  372  RGPLIWPDPLRFKPERFLPGNEKANVDIKGNDFKVIPFGAGRRICAGLSLGLRMVQFMTA  431

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLML  248
            TL+H F+W+L  GQ +E L+M+EAYGLTLQRA PLM+
Sbjct  432  TLIHGFNWELPEGQVIEKLSMDEAYGLTLQRASPLMV  468



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKET RLHP TPLSLPR     CEI  Y IPKGATLLVNVWAI 
Sbjct  339  LVTELDLPHLPYLQAVVKETLRLHPPTPLSLPRFAENSCEIFNYHIPKGATLLVNVWAIG  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RF PGGEK +VD+KGN+FE+IPFGAGRRIC GMSLG+++V LL+A
Sbjct  399  RDPKEWIDPLEFKPERFFPGGEKDDVDVKGNNFELIPFGAGRRICVGMSLGLKVVQLLIA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL H+FDW+L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  459  TLAHSFDWELENGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  506



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKET RLHP TPLSLPR     CEI  Y IPKGATLLVNVWAI 
Sbjct  339  LVTELDLPHLPYLQAVVKETLRLHPPTPLSLPRFAENSCEIFNYHIPKGATLLVNVWAIG  398

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RF PGGEK +VD+KGN+FE+IPFGAGRRIC GMSLG+++V LL+A
Sbjct  399  RDPKEWIDPLEFKPERFFPGGEKDDVDVKGNNFELIPFGAGRRICVGMSLGLKVVQLLIA  458

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL H+FDW+L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  459  TLAHSFDWELENGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  506



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LP+L A++KETFRLHPSTPLSLPR  A  CE++GY IPKG TLLVNVWAI 
Sbjct  353  LVSESDLPRLPYLAAVIKETFRLHPSTPLSLPREAAGDCEVDGYSIPKGTTLLVNVWAIG  412

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLE+ P RFLPGG    VD+KG+DF +IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  413  RDPAMWPDPLEYRPARFLPGGTHAEVDVKGSDFGLIPFGAGRRICAGLSWGLRMVTLMTA  472

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TL+H FDW L NG++ + LNMEEAYGLTLQRAVPLM+ P PRL P  Y L
Sbjct  473  TLLHGFDWALANGETPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGL  522



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  345  LVSETDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  404

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  405  RDPEAWPEPLQFRPDRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  464

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  465  TLVHALDWDLADGMTADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYA  513



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E+DL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  347  LVSETDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  407  RDPEAWPEPLQFRPDRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  467  TLVHALDWDLADGMTADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYA  515



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHP+TPLSLPR+  + CEING++IPKG+TLLVN+WAI 
Sbjct  347  LVTDLDLKQLTYLQAIVKETFRLHPATPLSLPRIATESCEINGFYIPKGSTLLVNIWAIG  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDPN    PL F P RFL  GE PNVD+KG +FE+IPFGAGRRIC+GM+ G+RMV L+ A
Sbjct  407  RDPNTWAEPLVFRPERFLSDGESPNVDVKGRNFELIPFGAGRRICAGMNFGLRMVQLVTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TL+HAF+W+L  G+  E +NMEE YG++LQR VPL++HPKPRL   +Y
Sbjct  467  TLIHAFNWELPEGELPENMNMEEDYGISLQRTVPLVVHPKPRLDHEVY  514



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   244 bits (624),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  347  LVSESDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  407  RDPEAWPEPLQFRPDRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G +   L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  467  TLVHALDWDLADGMTANKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  515



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  LP+LQA+VKET RLHP TPLSLPR     CEI  Y IPKGATLLVNVWAI 
Sbjct  341  LVTELDLPHLPYLQAVVKETLRLHPPTPLSLPRFAENSCEIFNYHIPKGATLLVNVWAIG  400

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PLEF P RFLPG EK +VD+KGN+FE+IPFGAGRRIC GMSLG+++V LL+A
Sbjct  401  RDPKEWIDPLEFKPERFLPGNEKVDVDVKGNNFELIPFGAGRRICVGMSLGLKIVQLLIA  460

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TL H+FDW+L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y+
Sbjct  461  TLAHSFDWELENGTDPKRLNMDETYGITLQKAMPLSVHPHPRLSQHVYS  509



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  351  LVSESDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  410

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  411  RDPEAWPEPLQFRPARFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  470

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA +WDL +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  471  TLVHALEWDLADGVTAEKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  519



>gb|AAX51195.1| cytochrome p450 [Ageratina adenophora]
Length=214

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVTE DL  L F+QAIVKETFRLHPSTPLSLPR+ ++ CE++GY+IPKG+TLLVNVWAIA
Sbjct  72   LVTELDLNQLTFIQAIVKETFRLHPSTPLSLPRISSEACEVDGYYIPKGSTLLVNVWAIA  131

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + T+PLEF P RFLPGGEKPNVD++GNDFEVIPFGAGRRIC GM+LG+RMV LLVA
Sbjct  132  RDPEMWTDPLEFRPSRFLPGGEKPNVDVRGNDFEVIPFGAGRRICVGMTLGLRMVQLLVA  191

Query  358  TLVHAFDWDLVNGQSVETLNME  293
            TLV  FDW+L  G   E LNME
Sbjct  192  TLVQTFDWELAKGLEPEKLNME  213



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L +L A++KETFRLHPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  347  LVSESDLPRLTYLTAVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  407  RDPEAWPEPLQFRPDRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G +   L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  467  TLVHALDWDLADGMTAYKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  515



>gb|ABC48913.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=313

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LVT+ DL  L +LQAIVKETFRLHPSTPLSLPRM A+ CEINGY IPK ATLLVNVWAIA
Sbjct  170  LVTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIA  229

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP V   PLEF P+RFLPGGE+PN D++GNDFEVIPFGAGRRIC+GMSLG+RMVHLL A
Sbjct  230  RDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTA  289

Query  358  TLVHAFDWDLVNGQSVETLNMEEA  287
            TLVHAF+W+L  GQ  E  NM+EA
Sbjct  290  TLVHAFNWELPEGQVAEKRNMDEA  313



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  LP+L A++KETFRLHPSTPLSLPR  A+ CE++GY IPKGATLLVNVWAIA
Sbjct  357  LVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVWAIA  416

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP    +PL++ P RFLPG    +VD+KG DF +IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  417  RDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTLMTA  476

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            TLVH FDW L NG + + LNMEEAYGLTLQRAVPLM+ P PRL P  Y
Sbjct  477  TLVHGFDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAY  524



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL  L +L A++KETFR+HPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  347  LVSESDLPRLTYLTAVIKETFRMHPSTPLSLPRIAAEECEVDGFRIPAGTTLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  407  RDPEAWPEPLQFRPDRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  467  TLVHALDWDLADGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 135/168 (80%), Gaps = 4/168 (2%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            + E DL +L +LQ ++KETFRLHP TP    R+ ++ C+I GY IPKG+TLLVNVWAIAR
Sbjct  343  IKEEDLPNLTYLQTLIKETFRLHPPTP----RIASESCDIFGYHIPKGSTLLVNVWAIAR  398

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PL+F P RFL GGEK +VD+KGNDFEVIPFGAGRRIC GMSLGIRMV LL AT
Sbjct  399  DPKEWNDPLDFKPERFLQGGEKCDVDVKGNDFEVIPFGAGRRICVGMSLGIRMVQLLTAT  458

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            L H+F+W+L NG + +T+NMEEAYGLTLQRAVPL +HPK RL  H+Y+
Sbjct  459  LTHSFNWELENGLNEKTMNMEEAYGLTLQRAVPLSVHPKRRLSQHVYS  506



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V++ DL  L +LQA+VKETFRLHP TPLSLPRM +  CE+NGY IPKG+TLLV+VWAI R
Sbjct  351  VSDLDLPQLVYLQAVVKETFRLHPPTPLSLPRMASDSCEVNGYHIPKGSTLLVDVWAIGR  410

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P+RFLP GEKP+VD+KGNDFE IPFGAGRRIC G+SLG+RMV +L AT
Sbjct  411  DPKEWVDPLEFGPNRFLPDGEKPHVDVKGNDFEAIPFGAGRRICVGLSLGLRMVQMLTAT  470

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  215
            +VH+FDW L NG + + LNM+E YGLTL+RA PL++HP+PRL   +Y
Sbjct  471  IVHSFDWALPNGLTPDKLNMDEHYGLTLRRAQPLVVHPRPRLLLGVY  517



>gb|EMT22073.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=304

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV ESDL  L FL A++KETFRLHPSTPLSLPRM ++ CE+ GY IPKG  LLVNVW IA
Sbjct  134  LVAESDLPRLTFLNAVIKETFRLHPSTPLSLPRMASEECEVAGYRIPKGTELLVNVWGIA  193

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP +  +PLEF P RFLPGG   +VD+KG DF +IPFGAGRRIC+G+S G+R+V +  A
Sbjct  194  RDPALWPDPLEFRPARFLPGGTHADVDVKGGDFGLIPFGAGRRICAGLSWGLRVVTVTAA  253

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  209
            TLVH+FDW+L  GQ+ + LNMEEA+ L LQRAVPLM+HP PRL P  Y +
Sbjct  254  TLVHSFDWELPTGQTPDKLNMEEAFSLLLQRAVPLMVHPVPRLLPSAYEI  303



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -2

Query  715  VTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIAR  536
            V++ DL  L +LQA+VKETFRLHP TPLSLPRM +  CE+NGY IPKG+TLLV+VWAI R
Sbjct  321  VSDVDLHQLVYLQAVVKETFRLHPPTPLSLPRMASDSCEVNGYHIPKGSTLLVDVWAIGR  380

Query  535  DPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVAT  356
            DP    +PLEF P+RFLP GEKP+VD+KGNDFEVIPFGAGRRIC G+SLG+RMV +L AT
Sbjct  381  DPKQWVDPLEFRPNRFLPNGEKPHVDVKGNDFEVIPFGAGRRICVGLSLGLRMVQMLTAT  440

Query  355  LVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKP  236
            +VH+FDW L NG + + LNM+E YGLTL+RA PL++HP+P
Sbjct  441  IVHSFDWTLPNGLTPDKLNMDEHYGLTLRRAQPLIMHPRP  480



>gb|AGT50317.1| flavonoid 3'-hydroxylase, partial [Meconopsis zangnanensis]
Length=442

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI+GYFIPK  TLL NVWAIA
Sbjct  293  LVSESDLSQLPFLQAVIKEAFRLHPSTPLSLPRVSDEDCEIDGYFIPKNTTLLTNVWAIA  352

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP + ++PL+F P RFLPG EK NVDI GNDFEVIPFGAGRRIC+GMSLG+RMV  + A
Sbjct  353  RDPLMWSDPLKFKPERFLPGNEKANVDIMGNDFEVIPFGAGRRICAGMSLGLRMVQFMTA  412

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQ  269
            TL+H F+W+L  GQ +E LNM+EAYGLTLQ
Sbjct  413  TLIHGFNWELPEGQVIEKLNMDEAYGLTLQ  442



>gb|AGT50320.1| flavonoid 3'-hydroxylase, partial [Meconopsis paniculata]
Length=429

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + CEI GYFIPK  TLL NVWAIA
Sbjct  280  LVSESDLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCEIEGYFIPKNTTLLTNVWAIA  339

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  340  RDPSMWPDPLKFKPERFLPGSEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  399

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQ  269
            T +H F+W+L  GQ +E LNM+EAYGLTLQ
Sbjct  400  TSIHGFNWELPEGQVIEKLNMDEAYGLTLQ  429



>gb|AGT50322.1| flavonoid 3'-hydroxylase, partial [Meconopsis gracilipes]
Length=428

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+ESDL+ LPFLQA++KE FRLHPSTPLSLPR+  + C I GYFIPK  TLL NVWAIA
Sbjct  279  LVSESDLSQLPFLQAVIKEAFRLHPSTPLSLPRVSVEDCVIEGYFIPKNTTLLTNVWAIA  338

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP++  +PL+F P RFLPG EK NVDIKGNDFEVIPFGAGRRIC+G+SLG+RMV  + A
Sbjct  339  RDPSMWPDPLKFKPERFLPGSEKANVDIKGNDFEVIPFGAGRRICAGLSLGLRMVQFMTA  398

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQ  269
            TL+H F+W+L  GQ +E LNM+EAYGLTLQ
Sbjct  399  TLIHGFNWELPEGQVIEKLNMDEAYGLTLQ  428



>gb|AAV74194.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
 gb|AAV74195.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  718  LVTESDLTDLPFLQAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIA  539
            LV+E DL  L +L A++KETFR+HPSTPLSLPR+ A+ CE++G+ IP G TLLVNVWAIA
Sbjct  347  LVSELDLPRLTYLTAVIKETFRMHPSTPLSLPRIAAEECEVDGFRIPAGTTLLVNVWAIA  406

Query  538  RDPNVCTNPLEFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVA  359
            RDP     PL+F P RFLPGG    VD+KG+DFE+IPFGAGRRIC+G+S G+RMV L+ A
Sbjct  407  RDPEAWPEPLQFRPDRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTA  466

Query  358  TLVHAFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  212
            TLVHA DWDL +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  467  TLVHALDWDLADGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410