BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033L13

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    317   2e-102   Nicotiana sylvestris
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    311   3e-100   Nicotiana tomentosiformis
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    308   7e-99    Solanum lycopersicum
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    307   1e-98    Solanum tuberosum [potatoes]
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    305   6e-98    Gossypium arboreum [tree cotton]
gb|KJB10880.1|  hypothetical protein B456_001G230200                    301   2e-97    Gossypium raimondii
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    304   3e-97    Citrus sinensis [apfelsine]
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    303   4e-97    Vitis vinifera
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             303   6e-97    Citrus clementina [clementine]
gb|KJB10878.1|  hypothetical protein B456_001G230200                    302   1e-96    Gossypium raimondii
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    300   5e-96    Gossypium arboreum [tree cotton]
ref|XP_007049652.1|  O-Glycosyl hydrolases family 17 protein isof...    295   8e-96    
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           295   5e-95    Medicago truncatula
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    297   8e-95    
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    294   1e-94    Ricinus communis
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       296   2e-94    Morus notabilis
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             294   2e-94    
gb|KJB84083.1|  hypothetical protein B456_N004800                       296   2e-94    Gossypium raimondii
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           296   3e-94    Medicago truncatula
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    294   1e-93    Prunus mume [ume]
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    295   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_006386885.1|  3-glucanase family protein                         291   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   2e-92    Sesamum indicum [beniseed]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   2e-92    Populus euphratica
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   2e-92    Cucumis melo [Oriental melon]
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   2e-92    Cucumis sativus [cucumbers]
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    292   5e-92    
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    290   5e-92    Fragaria vesca subsp. vesca
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    290   6e-92    Cicer arietinum [garbanzo]
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    290   9e-92    Eucalyptus grandis [rose gum]
emb|CDP03931.1|  unnamed protein product                                287   2e-91    Coffea canephora [robusta coffee]
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         288   4e-91    Jatropha curcas
gb|KJB10879.1|  hypothetical protein B456_001G230200                    285   4e-90    Gossypium raimondii
dbj|BAA89481.1|  beta-1,3-glucanase                                     283   3e-89    Salix gilgiana
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    282   5e-89    
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             281   1e-88    Phaseolus vulgaris [French bean]
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    281   2e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002303070.2|  3-glucanase family protein                         280   3e-88    
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    280   5e-88    Arabis alpina [alpine rockcress]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    280   8e-88    Brassica rapa
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    292   2e-87    
emb|CDY28063.1|  BnaC05g44650D                                          278   2e-87    Brassica napus [oilseed rape]
emb|CDY45466.1|  BnaC09g12840D                                          278   2e-87    Brassica napus [oilseed rape]
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    278   3e-87    Camelina sativa [gold-of-pleasure]
emb|CDY24629.1|  BnaA05g30280D                                          277   5e-87    Brassica napus [oilseed rape]
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  274   8e-87    Medicago truncatula
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    276   9e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    276   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010906169.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    268   2e-86    Elaeis guineensis
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             276   2e-86    Eutrema salsugineum [saltwater cress]
ref|XP_003626949.1|  Beta-1 3-glucanase                                 276   2e-86    Medicago truncatula
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               275   2e-86    Arabidopsis lyrata subsp. lyrata
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               275   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             274   7e-86    Capsella rubella
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    274   9e-86    Nelumbo nucifera [Indian lotus]
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               274   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007134153.1|  hypothetical protein PHAVU_010G0238001g            269   2e-85    Phaseolus vulgaris [French bean]
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    272   4e-85    Populus euphratica
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    271   9e-85    Tarenaya hassleriana [spider flower]
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    271   2e-84    
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             270   3e-84    
emb|CDY08004.1|  BnaC03g35190D                                          269   8e-84    Brassica napus [oilseed rape]
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    268   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    264   8e-83    
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    266   1e-82    Brassica rapa
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    266   1e-82    Glycine max [soybeans]
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                266   1e-82    Erythranthe guttata [common monkey flower]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    265   2e-82    Glycine max [soybeans]
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    265   3e-82    
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    265   5e-82    Phoenix dactylifera
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          261   5e-81    
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    258   1e-80    
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    258   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         258   3e-79    Jatropha curcas
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    257   4e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            259   6e-79    
emb|CDO96794.1|  unnamed protein product                                256   8e-79    Coffea canephora [robusta coffee]
gb|EPS58986.1|  hypothetical protein M569_15824                         255   1e-78    Genlisea aurea
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             255   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    254   4e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    254   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    253   1e-77    Populus euphratica
ref|XP_002298669.2|  glucan endo-1 family protein                       251   1e-77    
gb|KJB28087.1|  hypothetical protein B456_005G026800                    251   7e-77    Gossypium raimondii
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    251   1e-76    Populus euphratica
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    249   3e-76    
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    249   5e-76    Vitis vinifera
dbj|BAJ88052.1|  predicted protein                                      248   1e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACR37660.1|  unknown                                                 239   3e-75    Zea mays [maize]
emb|CDX74052.1|  BnaA03g29950D                                          248   1e-74    
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   245   1e-74    Citrus sinensis [apfelsine]
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          245   2e-74    Sorghum bicolor [broomcorn]
gb|ACN28576.1|  unknown                                                 240   3e-74    Zea mays [maize]
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   5e-74    Brachypodium distachyon [annual false brome]
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    243   5e-74    
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             243   7e-74    
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          243   8e-74    
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           242   2e-73    Medicago truncatula
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    241   4e-73    
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    241   5e-73    
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    241   8e-73    Solanum tuberosum [potatoes]
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      240   1e-72    Zea mays [maize]
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    239   2e-72    
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         238   4e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    238   6e-72    Tarenaya hassleriana [spider flower]
dbj|BAK04571.1|  predicted protein                                      238   6e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY50110.1|  BnaC01g43580D                                          235   9e-71    Brassica napus [oilseed rape]
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             234   2e-70    
emb|CDY63754.1|  BnaAnng19080D                                          235   2e-70    Brassica napus [oilseed rape]
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   2e-70    Brassica rapa
emb|CDY06469.1|  BnaC06g11750D                                          234   3e-70    
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   3e-70    Brassica rapa
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             234   3e-70    Eutrema salsugineum [saltwater cress]
emb|CAA49513.1|  beta-1,3-glucanase homologue                           234   3e-70    Brassica napus [oilseed rape]
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    233   4e-70    Nicotiana tomentosiformis
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   4e-70    Nicotiana tomentosiformis
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    235   4e-70    
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    233   5e-70    Nicotiana sylvestris
emb|CDP15106.1|  unnamed protein product                                233   6e-70    Coffea canephora [robusta coffee]
emb|CDY67322.1|  BnaA03g57600D                                          225   6e-70    Brassica napus [oilseed rape]
emb|CDY59775.1|  BnaCnng35540D                                          233   6e-70    Brassica napus [oilseed rape]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    233   7e-70    Setaria italica
emb|CDY08310.1|  BnaA05g13090D                                          233   1e-69    Brassica napus [oilseed rape]
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             233   1e-69    
ref|NP_001063586.1|  Os09g0502200                                       233   1e-69    
gb|EEC84834.1|  hypothetical protein OsI_31928                          233   1e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    233   1e-69    Brassica rapa
emb|CDY18092.1|  BnaA01g23530D                                          233   1e-69    Brassica napus [oilseed rape]
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    232   2e-69    
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    232   2e-69    Cucumis melo [Oriental melon]
gb|EMT13087.1|  Putative glucan endo-1,3-beta-glucosidase A6            228   2e-69    
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    231   7e-69    Arabis alpina [alpine rockcress]
gb|KJB37880.1|  hypothetical protein B456_006G224700                    229   2e-68    Gossypium raimondii
emb|CDP15107.1|  unnamed protein product                                225   2e-68    Coffea canephora [robusta coffee]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    229   2e-68    Camelina sativa [gold-of-pleasure]
gb|KFK39673.1|  a6 anther-specific protein                              229   2e-68    Arabis alpina [alpine rockcress]
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    229   2e-68    Camelina sativa [gold-of-pleasure]
emb|CDY12371.1|  BnaC08g08340D                                          229   3e-68    Brassica napus [oilseed rape]
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   5e-68    
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   7e-68    
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    227   9e-68    
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          228   9e-68    Arabidopsis thaliana [mouse-ear cress]
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                227   1e-67    Erythranthe guttata [common monkey flower]
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    226   2e-67    Brassica rapa
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    226   4e-67    Brassica rapa
gb|ABK28569.1|  unknown                                                 226   5e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDY53213.1|  BnaC03g74070D                                          226   5e-67    Brassica napus [oilseed rape]
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               226   6e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CBI39414.3|  unnamed protein product                                222   8e-67    Vitis vinifera
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             225   1e-66    
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    222   1e-66    Setaria italica
emb|CDY27122.1|  BnaA08g07600D                                          225   1e-66    Brassica napus [oilseed rape]
dbj|BAK05423.1|  predicted protein                                      224   1e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM64490.1|  beta-1,3-glucanase, putative                            224   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             224   2e-66    Capsella rubella
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             223   3e-66    Capsella rubella
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             223   7e-66    Eutrema salsugineum [saltwater cress]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    223   1e-65    Tarenaya hassleriana [spider flower]
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   3e-65    Brassica rapa
emb|CDY12732.1|  BnaC04g29090D                                          221   4e-65    Brassica napus [oilseed rape]
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   4e-65    Camelina sativa [gold-of-pleasure]
emb|CDY01191.1|  BnaA04g06280D                                          220   6e-65    
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    219   2e-64    Camelina sativa [gold-of-pleasure]
gb|ADE76604.1|  unknown                                                 218   4e-64    Picea sitchensis
ref|NP_001168659.1|  uncharacterized protein LOC100382447               214   1e-63    Zea mays [maize]
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    216   3e-63    Camelina sativa [gold-of-pleasure]
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   8e-63    Zea mays [maize]
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   1e-62    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    214   1e-62    Zea mays [maize]
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       212   1e-61    Cucumis sativus [cucumbers]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    211   3e-61    Brachypodium distachyon [annual false brome]
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             203   4e-59    Brassica oleracea var. italica [asparagus broccoli]
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             202   1e-58    Brassica rapa var. perviridis [kabuna]
gb|EEC76519.1|  hypothetical protein OsI_14305                          200   3e-57    Oryza sativa Indica Group [Indian rice]
ref|NP_001051879.1|  Os03g0845600                                       200   3e-57    
ref|XP_001777261.1|  predicted protein                                  197   2e-56    
emb|CAK18899.1|  glucan 1,3-beta glucosidase                            189   3e-56    Cocos nucifera
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     195   8e-56    Eucalyptus grandis [rose gum]
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          194   8e-55    Sorghum bicolor [broomcorn]
dbj|BAE80092.1|  glycosyl hydrolase family 17                           192   1e-54    Silene latifolia
ref|XP_001780045.1|  predicted protein                                  191   6e-54    
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    192   2e-53    Brachypodium distachyon [annual false brome]
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    189   4e-53    
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          186   5e-52    Sorghum bicolor [broomcorn]
ref|NP_001062294.2|  Os08g0525800                                       185   2e-51    
dbj|BAC75423.1|  putative beta-1,3-glucanase                            183   8e-51    Oryza sativa Japonica Group [Japonica rice]
gb|EEC76518.1|  hypothetical protein OsI_14304                          173   3e-50    Oryza sativa Indica Group [Indian rice]
gb|EAZ07710.1|  hypothetical protein OsI_29967                          186   4e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_001784285.1|  predicted protein                                  179   1e-49    
emb|CAA49515.1|  beta-1,3-glucanase homologue                           167   2e-48    Brassica napus [oilseed rape]
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              173   3e-47    
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              173   3e-47    
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   2e-45    Glycine max [soybeans]
gb|KHG21190.1|  hypothetical protein F383_01641                         168   3e-45    Gossypium arboreum [tree cotton]
gb|KJB13749.1|  hypothetical protein B456_002G092600                    167   7e-45    Gossypium raimondii
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             167   9e-45    Selaginella moellendorffii
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             165   3e-44    Selaginella moellendorffii
gb|KJB62900.1|  hypothetical protein B456_009G442700                    165   3e-44    Gossypium raimondii
gb|ADU15553.1|  GLU                                                     165   3e-44    Gossypium hirsutum [American cotton]
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   5e-44    Glycine max [soybeans]
gb|KHG04965.1|  hypothetical protein F383_30444                         164   6e-44    Gossypium arboreum [tree cotton]
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   1e-43    Cicer arietinum [garbanzo]
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   2e-43    Glycine max [soybeans]
ref|XP_001781801.1|  predicted protein                                  162   3e-43    
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   162   3e-43    Medicago truncatula
gb|ABR16205.1|  unknown                                                 161   1e-42    Picea sitchensis
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      160   1e-42    Sesamum indicum [beniseed]
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     160   2e-42    Glycine soja [wild soybean]
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     160   3e-42    Cucumis melo [Oriental melon]
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     158   4e-42    Glycine soja [wild soybean]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   8e-42    
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    158   2e-41    Arabis alpina [alpine rockcress]
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   2e-41    Cucumis sativus [cucumbers]
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   2e-41    Cucumis sativus [cucumbers]
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    157   3e-41    
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     157   3e-41    Brassica rapa
emb|CDX92794.1|  BnaC07g40520D                                          157   3e-41    
gb|KHG21189.1|  hypothetical protein F383_01641                         157   6e-41    Gossypium arboreum [tree cotton]
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            155   2e-40    
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     155   2e-40    Solanum lycopersicum
dbj|BAF01977.1|  putative beta-1,3-glucanase                            151   3e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               155   3e-40    
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             154   3e-40    Phaseolus vulgaris [French bean]
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     154   3e-40    Populus euphratica
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   4e-40    Solanum tuberosum [potatoes]
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             154   4e-40    Citrus clementina [clementine]
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   4e-40    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   4e-40    Eucalyptus grandis [rose gum]
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     154   5e-40    Cucumis melo [Oriental melon]
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         154   5e-40    Jatropha curcas
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   8e-40    
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   9e-40    Camelina sativa [gold-of-pleasure]
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   1e-39    
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     153   1e-39    Nelumbo nucifera [Indian lotus]
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             153   1e-39    Phaseolus vulgaris [French bean]
emb|CDP14397.1|  unnamed protein product                                153   1e-39    Coffea canephora [robusta coffee]
gb|ACN39797.1|  unknown                                                 153   1e-39    Picea sitchensis
emb|CDY46679.1|  BnaA03g48290D                                          152   1e-39    Brassica napus [oilseed rape]
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                152   2e-39    Erythranthe guttata [common monkey flower]
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                152   2e-39    Erythranthe guttata [common monkey flower]
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             152   2e-39    Capsella rubella
gb|EPS68573.1|  hypothetical protein M569_06194                         152   2e-39    Genlisea aurea
gb|EPS59841.1|  hypothetical protein M569_14964                         152   3e-39    Genlisea aurea
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               151   4e-39    
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     151   4e-39    Nicotiana tomentosiformis
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   4e-39    Nicotiana sylvestris
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         151   4e-39    Jatropha curcas
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               151   4e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     151   5e-39    Vitis vinifera
gb|EPS73917.1|  hypothetical protein M569_00835                         151   5e-39    Genlisea aurea
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   8e-39    Solanum tuberosum [potatoes]
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     150   1e-38    Fragaria vesca subsp. vesca
ref|XP_001761806.1|  predicted protein                                  150   1e-38    
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                149   1e-38    Erythranthe guttata [common monkey flower]
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     150   1e-38    Sesamum indicum [beniseed]
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    150   1e-38    Ricinus communis
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                150   2e-38    Erythranthe guttata [common monkey flower]
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    149   2e-38    Camelina sativa [gold-of-pleasure]
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        149   2e-38    Arabidopsis lyrata subsp. lyrata
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   2e-38    Populus euphratica
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      150   2e-38    Fragaria vesca subsp. vesca
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             150   2e-38    Capsella rubella
emb|CDP13790.1|  unnamed protein product                                150   2e-38    Coffea canephora [robusta coffee]
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   2e-38    Camelina sativa [gold-of-pleasure]
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         149   2e-38    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               149   3e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        149   3e-38    Populus trichocarpa [western balsam poplar]
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               149   4e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-38    Populus euphratica
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   4e-38    Cucumis melo [Oriental melon]
gb|KHG05496.1|  hypothetical protein F383_30989                         149   4e-38    Gossypium arboreum [tree cotton]
gb|AAL77689.1|  AT5g55180/MCO15_13                                      149   4e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-38    Citrus sinensis [apfelsine]
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             148   4e-38    
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        149   4e-38    
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-38    Cucumis sativus [cucumbers]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             149   5e-38    
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  149   5e-38    Medicago truncatula
emb|CDY14214.1|  BnaA08g13450D                                          149   7e-38    
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   7e-38    
emb|CDP05678.1|  unnamed protein product                                148   8e-38    
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   8e-38    
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      148   1e-37    
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             147   1e-37    
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37    
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             147   1e-37    
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37    
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37    
gb|KJB10704.1|  hypothetical protein B456_001G216900                    145   1e-37    
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     147   2e-37    
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      147   2e-37    
emb|CDY18049.1|  BnaC07g04210D                                          146   2e-37    
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   2e-37    
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   2e-37    
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   2e-37    
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   3e-37    
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          146   3e-37    
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     146   3e-37    
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   3e-37    
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    146   3e-37    
ref|XP_001752749.1|  predicted protein                                  145   3e-37    
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   4e-37    
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             146   4e-37    
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             146   4e-37    
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   5e-37    
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        146   5e-37    
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   5e-37    
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   6e-37    
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             146   6e-37    
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             145   6e-37    
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   7e-37    
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   7e-37    
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   7e-37    
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         145   8e-37    
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    145   9e-37    
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   9e-37    
ref|XP_001772420.1|  predicted protein                                  145   9e-37    
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   9e-37    
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     145   1e-36    
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        145   1e-36    
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    145   1e-36    
gb|KJB10701.1|  hypothetical protein B456_001G216900                    145   1e-36    
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     144   1e-36    
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    145   1e-36    
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    145   1e-36    
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   1e-36    
emb|CDY19908.1|  BnaC09g31740D                                          144   1e-36    
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   1e-36    
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   2e-36    
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             144   2e-36    
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             144   2e-36    
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             144   2e-36    
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   2e-36    
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   2e-36    
gb|EPS73640.1|  hypothetical protein M569_01113                         144   2e-36    
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36    
emb|CDY36734.1|  BnaA03g11520D                                          144   2e-36    
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              143   3e-36    
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   3e-36    
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   3e-36    
ref|XP_001767901.1|  predicted protein                                  144   3e-36    
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   3e-36    
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              143   3e-36    
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    144   3e-36    
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   3e-36    
emb|CDY12009.1|  BnaC03g14350D                                          143   3e-36    
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   3e-36    
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      144   3e-36    
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   3e-36    
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   4e-36    
gb|KJB27172.1|  hypothetical protein B456_004G282300                    143   4e-36    
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    143   4e-36    
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        143   4e-36    
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             143   4e-36    
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   4e-36    
emb|CAN60692.1|  hypothetical protein VITISV_007558                     142   5e-36    
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    142   5e-36    
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   6e-36    
emb|CDY56498.1|  BnaAnng14330D                                          142   6e-36    
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   6e-36    
emb|CDY20780.1|  BnaA02g09200D                                          142   7e-36    
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             142   7e-36    
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   7e-36    
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      142   7e-36    
ref|XP_007017515.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    140   8e-36    
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             142   8e-36    
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    142   8e-36    
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   9e-36    
emb|CDP16794.1|  unnamed protein product                                142   9e-36    
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    142   9e-36    
emb|CDY06601.1|  BnaC02g13250D                                          142   9e-36    
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   142   1e-35    
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        142   1e-35    
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             142   1e-35    
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     142   1e-35    
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    142   1e-35    
emb|CDY17308.1|  BnaA10g09420D                                          141   1e-35    
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    142   1e-35    
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35    
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    142   2e-35    
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             141   2e-35    
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    141   2e-35    
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35    
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35    
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 141   2e-35    
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35    
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             141   2e-35    
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   3e-35    
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             141   3e-35    
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   3e-35    
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   3e-35    
emb|CAN61862.1|  hypothetical protein VITISV_043447                     140   3e-35    
ref|XP_007017516.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    140   3e-35    
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     141   4e-35    
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   4e-35    
gb|KHG29271.1|  hypothetical protein F383_14120                         141   4e-35    
ref|XP_007017514.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    140   4e-35    
ref|XP_006855690.1|  hypothetical protein AMTR_s00044p00136030          135   4e-35    
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          140   4e-35    
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         140   4e-35    
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      140   4e-35    
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   4e-35    
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     140   4e-35    
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35    
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35    
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35    
gb|KHG11479.1|  hypothetical protein F383_06303                         140   5e-35    
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   139   5e-35    
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35    
emb|CAB36529.1|  putative beta-1, 3-glucanase                           140   5e-35    
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35    
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   5e-35    
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35    
gb|KHG26459.1|  hypothetical protein F383_04538                         140   6e-35    
gb|KHG14816.1|  hypothetical protein F383_17797                         140   6e-35    
emb|CDM84006.1|  unnamed protein product                                140   6e-35    
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   6e-35    
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             140   7e-35    
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    139   8e-35    
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     140   8e-35    
dbj|BAJ85556.1|  predicted protein                                      139   8e-35    
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    140   9e-35    
gb|KJB22745.1|  hypothetical protein B456_004G064200                    139   1e-34    
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             139   1e-34    
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34    
gb|AAD26909.1|  putative beta-1,3-glucanase                             139   1e-34    
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34    
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           139   1e-34    
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     139   1e-34    
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   1e-34    
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34    
emb|CDY62033.1|  BnaC03g77660D                                          139   1e-34    
ref|XP_001784088.1|  predicted protein                                  139   1e-34    
gb|KJB54307.1|  hypothetical protein B456_009G028200                    139   1e-34    
gb|EEC71452.1|  hypothetical protein OsI_03677                          139   1e-34    
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34    
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        139   1e-34    
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   1e-34    
gb|ABD91576.1|  beta-1,3-glucanase                                      139   1e-34    
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      139   1e-34    
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          139   1e-34    
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   1e-34    
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      139   1e-34    
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      139   1e-34    
gb|ABD91577.1|  beta-1,3-glucanase                                      139   1e-34    
ref|NP_001044198.1|  Os01g0739700                                       139   1e-34    
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   1e-34    
emb|CBI26850.3|  unnamed protein product                                139   2e-34    
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     139   2e-34    
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               139   2e-34    
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34    
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   139   2e-34    
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34    
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      139   2e-34    
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     139   2e-34    
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34    
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    139   2e-34    
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34    
emb|CDP00829.1|  unnamed protein product                                139   2e-34    
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            137   2e-34    
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             138   2e-34    
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34    
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            138   2e-34    
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      138   2e-34    
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             138   2e-34    
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      138   2e-34    
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             138   2e-34    
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             138   3e-34    
gb|KJB54309.1|  hypothetical protein B456_009G028300                    138   3e-34    
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    137   3e-34    
ref|XP_004173544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-34    
dbj|BAH57260.1|  AT3G13560                                              138   3e-34    
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   3e-34    
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   3e-34    
ref|XP_010929487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-34    
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-34    
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             138   4e-34    
emb|CDP03239.1|  unnamed protein product                                138   4e-34    
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        137   4e-34    
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   4e-34    
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   5e-34    
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      137   5e-34    
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        137   5e-34    
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   5e-34    
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    137   5e-34    
gb|AFU52641.1|  beta-1,3-glucanase 6                                    137   5e-34    
gb|AFK37243.1|  unknown                                                 137   5e-34    
gb|KHN25369.1|  Glucan endo-1,3-beta-glucosidase 7                      135   6e-34    
gb|KJB27173.1|  hypothetical protein B456_004G282300                    137   6e-34    
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     137   6e-34    
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   7e-34    
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   7e-34    
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   7e-34    
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          137   7e-34    
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   7e-34    
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   7e-34    
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               137   8e-34    
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               137   8e-34    
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   8e-34    



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            +VDQIGASIYN+ATYNRNV+KKFT+K  VGTPA+PGV++PTL+FALYNENQKPGPGTERH
Sbjct  276  NVDQIGASIYNAATYNRNVIKKFTAKPPVGTPAKPGVIVPTLLFALYNENQKPGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGTNIY IDLSGKTP SE+ PLP+P  N+PYKGK+WCVV   A++T V+ AL+Y
Sbjct  336  FGLLYPNGTNIYEIDLSGKTPLSEYEPLPRPRNNEPYKGKIWCVVGRKASVTEVSGALAY  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGNRTC+ I+PGG CY PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA+ T +DPS
Sbjct  396  ACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLAIPTKSDPS  455

Query  177  YGACKYPSITL  145
            YGACK+PS+TL
Sbjct  456  YGACKFPSVTL  466



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            +VDQIGA+IYN+ATYNRNV+KKFT+K  VGTPA+PGVV+PTL+FALYNEN+KPGPGTERH
Sbjct  275  NVDQIGANIYNAATYNRNVIKKFTAKPPVGTPAKPGVVVPTLLFALYNENEKPGPGTERH  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGTNIY IDLSGKT  SE+ PLP+P  N+PYKGK+WCVV   A++T V+ AL+Y
Sbjct  335  FGLLYPNGTNIYGIDLSGKTSLSEYEPLPRPRNNEPYKGKIWCVVGRKASVTEVSGALAY  394

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGNRTC+ I+PGG CY PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA+ T +DPS
Sbjct  395  ACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLAIPTKSDPS  454

Query  177  YGACKYPSITL  145
            YGACK+PS+TL
Sbjct  455  YGACKFPSVTL  465



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 167/190 (88%), Gaps = 2/190 (1%)
 Frame = -3

Query  708  VDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHF  535
            VDQIGA+IYN+ATYNRNV+KKFT K  +GTPA+PGVV+PTL+FALYNENQKPGPGTERHF
Sbjct  275  VDQIGANIYNAATYNRNVIKKFTVKPPIGTPAKPGVVVPTLLFALYNENQKPGPGTERHF  334

Query  534  GVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYA  355
            G+LYPNGTNIY IDLSGKTPESE+  LP+   N+PY GK+WCVV+ +AN + +  A+SYA
Sbjct  335  GLLYPNGTNIYGIDLSGKTPESEYKALPRARNNEPYTGKIWCVVSRSANASELGGAMSYA  394

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CGQGNRTC+ IQPGG CYNPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL + T  DPSY
Sbjct  395  CGQGNRTCDEIQPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLTIPTKKDPSY  454

Query  174  GACKYPSITL  145
            G+CK+PS+TL
Sbjct  455  GSCKFPSVTL  464



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 2/190 (1%)
 Frame = -3

Query  708  VDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHF  535
            +DQIGA+IYN+ATYNRNV+KKFT+K  +GTPA+PGVV+PTL+FALYNENQKPGPGTERHF
Sbjct  275  MDQIGANIYNAATYNRNVIKKFTAKPPIGTPAKPGVVVPTLLFALYNENQKPGPGTERHF  334

Query  534  GVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYA  355
            G+LYPNGTN+Y IDLSGKTPESE+  LP+   N+PYKGK+WCVV   AN + +  A+SYA
Sbjct  335  GLLYPNGTNVYGIDLSGKTPESEYKALPRARNNEPYKGKIWCVVGRNANASELGGAMSYA  394

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CGQGNRTC+ I+PGG CYNPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL + T  DPSY
Sbjct  395  CGQGNRTCDEIRPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLTIPTKKDPSY  454

Query  174  GACKYPSITL  145
            G+CK+PS+TL
Sbjct  455  GSCKFPSVTL  464



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERH
Sbjct  271  DIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGTN+Y IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSY
Sbjct  331  FGLLYPNGTNVYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q+R  G TCYFNGLA +T  DPS
Sbjct  391  ACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQYRKTGATCYFNGLATQTAKDPS  450

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  451  FGHCKFPSVTL  461



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERH
Sbjct  196  DIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERH  255

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSY
Sbjct  256  FGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSY  315

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  DPS
Sbjct  316  ACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPS  375

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  376  FGHCKFPSVTL  386



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN+VKK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  276  DYDQIGANIYNAATYNRNIVKKLTAKRAIGTPARPGWVLPSFIFALYNENQKPGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+++Y IDLSG  PE E+ PLPKPT N+PYKGK+WCV A  AN TA++ ALSY
Sbjct  336  FGLLYPNGSHVYEIDLSGNAPEKEYEPLPKPTNNEPYKGKIWCVAAKVANTTALSSALSY  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C  P SL+  ASYAFSSYW+QFR LGGTCYFNGLA +TI DPS
Sbjct  396  ACSQGNKTCDPIQPGKPCAKPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLATQTIKDPS  455

Query  177  YGACKYPSITL  145
            +G+CK+PS+TL
Sbjct  456  HGSCKFPSVTL  466



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 165/191 (86%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN++K+  +K  VGTPARPG V+PT IF+LYNENQK GPGTERH
Sbjct  277  DIDQIGANIYNAATYNRNLIKRLNAKPPVGTPARPGSVLPTFIFSLYNENQKGGPGTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+LYPN +++Y IDL+G+TPESE+PPLP P  N+PYKGK+WCVVA  AN T +  AL+Y
Sbjct  337  WGLLYPNESSVYQIDLTGETPESEYPPLPAPENNEPYKGKIWCVVAKGANRTELGSALTY  396

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGN TC P+QPG  CY P SL+RHAS+AFSSYWAQFRS GGTCYFNGLAV+T+ DPS
Sbjct  397  ACGQGNGTCEPVQPGRKCYKPVSLVRHASFAFSSYWAQFRSTGGTCYFNGLAVQTMKDPS  456

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  457  YGSCKFPSVTL  467



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN+VKK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  276  DYDQIGANIYNAATYNRNIVKKLTAKPAIGTPARPGWVLPSFIFALYNENQKPGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+++Y IDLSG  PE E+ PLPKPT N+PYKGK+WCV A  AN TA++ ALSY
Sbjct  336  FGLLYPNGSHVYEIDLSGNAPEKEYGPLPKPTNNEPYKGKIWCVAAKVANTTALSSALSY  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C  P SL+  ASYAFSSYW+QFR LGGTCYFNGLA +TI DPS
Sbjct  396  ACSQGNKTCDPIQPGKPCAKPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLATQTIKDPS  455

Query  177  YGACKYPSITL  145
            +G+CK+PS+TL
Sbjct  456  HGSCKFPSVTL  466



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERH
Sbjct  271  DIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSY
Sbjct  331  FGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  DPS
Sbjct  391  ACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPS  450

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  451  FGHCKFPSVTL  461



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNV+KK T+K  VGTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  274  DIDQIGANIYNAATYNRNVIKKLTAKPPVGTPARPGRVLPSFIFALYNENQKPGPGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+Y IDLSGKTP+S + PLPKPT N+PYKGK+WCV A   N + +  ALSY
Sbjct  334  FGLLYPNGSNVYAIDLSGKTPDSAYEPLPKPTNNEPYKGKIWCVAARGVNASELGSALSY  393

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+QF+  G TCYFNGLA  T  DPS
Sbjct  394  ACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQFKKTGATCYFNGLATPTAKDPS  453

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  454  FGRCKFPSVTL  464



>ref|XP_007049652.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93809.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=328

 Score =   295 bits (756),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN +KK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  138  DIDQIGANIYNAATYNRNAIKKLTAKPAIGTPARPGWVLPSFIFALYNENQKPGPGTERH  197

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+Y IDLSG+TP+S+F PLPKP  N+PYKGK+WCV A   N + +  ALSY
Sbjct  198  FGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKIWCVAARGVNASELGSALSY  257

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+Q +  G TCYFNGLA +T  DPS
Sbjct  258  ACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQTGATCYFNGLATQTAKDPS  317

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  318  FGHCKFPSVTL  328



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            DVDQIGA+++N+ATYNRN VKK   K  VGTPARPG+++P+ +FAL+NEN KPGPGTERH
Sbjct  196  DVDQIGANVFNAATYNRNFVKKVMKKPIVGTPARPGLILPSFLFALFNENIKPGPGTERH  255

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+ +Y IDLSGKTPE EFP LP P  N+PYKGK+WCV    +N+TA+ +AL+Y
Sbjct  256  FGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEALTY  315

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC+P+QPG  C+ P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  DPS
Sbjct  316  ACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPS  375

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  376  YGSCKFPSVTL  386



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   297 bits (761),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN +KK T+K  +GTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  271  DIDQIGANIYNAATYNRNAIKKLTAKPAIGTPARPGWVLPSFIFALYNENQKPGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+Y IDLSG+TP+S+F PLPKP  N+PYKGK+WCV A   N + +  ALSY
Sbjct  331  FGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKIWCVAARGVNASELGSALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+Q +  G TCYFNGLA +T  DPS
Sbjct  391  ACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQTGATCYFNGLATQTAKDPS  450

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  451  FGHCKFPSVTL  461



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVK+ T+K  +GTPARPG  +PT IFALYNENQKPGPGTERH
Sbjct  196  DFDQIGANIYNAATYNRNVVKRLTTKPAIGTPARPGSGLPTFIFALYNENQKPGPGTERH  255

Query  537  FGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+LYPNG+NIY IDLSG+T +SE+  PLP PT N+PYKGK+WCVVA  AN TAVA AL+
Sbjct  256  FGLLYPNGSNIYEIDLSGETLDSEYKEPLPVPTNNEPYKGKIWCVVAKGANKTAVAGALT  315

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YAC QGN+TC+PIQPG  C+ P SL  HASYAFSSYWAQF+ +GGTC FNGLA +T+ DP
Sbjct  316  YACSQGNKTCDPIQPGKQCFKPESLYWHASYAFSSYWAQFKKIGGTCQFNGLATQTVMDP  375

Query  180  SYGACKYPSITL  145
            S+G CK PS+TL
Sbjct  376  SFGHCKLPSVTL  387



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 163/194 (84%), Gaps = 5/194 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVKK ++K  VGTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  277  DIDQIGANIYNAATYNRNVVKKLSAKPPVGTPARPGSVLPSFIFALYNENQKPGPGTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAVADA  367
            FG+LYP+G NIYPI+LSG+TP S++PPLP P  N PYKGK+WCVVA  A   N T +A A
Sbjct  337  FGLLYPSGKNIYPINLSGETPLSDYPPLPAPENNTPYKGKIWCVVAKEAMRGNKTELAAA  396

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            LSYAC QGN+TC+ IQPGG C  P+SL+R ASYAFSSYWAQF+ LGG CYFNGLAV+T  
Sbjct  397  LSYACSQGNKTCDAIQPGGICSRPDSLVRRASYAFSSYWAQFKKLGGGCYFNGLAVQTTK  456

Query  186  DPSYGACKYPSITL  145
            DPSYG CKY S+TL
Sbjct  457  DPSYGYCKYASVTL  470



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I N+ATYNRNVVKKF +K  VGTPARPG V+P+ +FALYNEN+KPGP TER+
Sbjct  197  DYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGSVLPSFLFALYNENKKPGPSTERN  256

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+YPIDLSGKTPESE+ PLP  T N PYKG +WC+VA  AN +AVA ALSY
Sbjct  257  FGLLYPNGSNVYPIDLSGKTPESEYGPLPVATNNVPYKGPIWCLVAKGANRSAVASALSY  316

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPGG C+ P+SL+ HASYAFS+YWAQFR +GG+CYF GLA +TI DPS
Sbjct  317  ACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRKVGGSCYFGGLATQTIKDPS  376

Query  177  YGACKYPSITL  145
            YG+CK+P   L
Sbjct  377  YGSCKFPGAKL  387



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNV+KK T+K  VGTPARPG V+P+ IFALYNENQKPGPGTERH
Sbjct  274  DIDQIGANIYNAATYNRNVIKKLTAKPPVGTPARPGRVLPSFIFALYNENQKPGPGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+Y IDLSGKTP+S + PLPKPT ++PYKGKVWCV A   N + +  ALSY
Sbjct  334  FGLLYPNGSNVYGIDLSGKTPDSAYEPLPKPTNDEPYKGKVWCVAARRVNASELGSALSY  393

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQ G  C+ P+SL+ HASYAFSSYW+QF+  G TCYFNGLA  T  DPS
Sbjct  394  ACSQGNKTCDPIQSGKECFKPDSLVWHASYAFSSYWSQFKKTGATCYFNGLATPTAKDPS  453

Query  177  YGACKYPSITL  145
            +G CK+PS+TL
Sbjct  454  FGRCKFPSVTL  464



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            DVDQIGA+++N+ATYNRN VKK   K  VGTPARPG+++P+ +FAL+NEN KPGPGTERH
Sbjct  273  DVDQIGANVFNAATYNRNFVKKVMKKPIVGTPARPGLILPSFLFALFNENIKPGPGTERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+ +Y IDLSGKTPE EFP LP P  N+PYKGK+WCV    +N+TA+ +AL+Y
Sbjct  333  FGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEALTY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC+P+QPG  C+ P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  DPS
Sbjct  393  ACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPS  452

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  453  YGSCKFPSVTL  463



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I N+ATYNRNVVKKF +K  VGTPARPG V+P+ +FALYNEN+KPGP TER+
Sbjct  272  DYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGSVLPSFLFALYNENKKPGPSTERN  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+YPIDLSGKTPESE+ PLP  T N PYKG +WC+VA  AN +AVA ALSY
Sbjct  332  FGLLYPNGSNVYPIDLSGKTPESEYGPLPAATNNVPYKGPIWCLVAKGANRSAVASALSY  391

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPGG C+ P+SL+ HASYAFS+YWAQFR++GG+CYF GLA +TI DPS
Sbjct  392  ACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRNVGGSCYFGGLATQTIKDPS  451

Query  177  YGACKYPSITL  145
            +G+CK+P   L
Sbjct  452  FGSCKFPGAKL  462



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            DVDQIGA+I+N+ATYNRN++++ TSK  +GTPARPGVVIPT IFALYNENQK GPGTERH
Sbjct  274  DVDQIGANIFNAATYNRNLIRRMTSKPAIGTPARPGVVIPTFIFALYNENQKGGPGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT++Y +DL+GK PE ++ PLP P  N+PYKGK+WCVVA  AN TA+  A+ Y
Sbjct  334  WGLLNPDGTSVYEVDLTGKRPEFDYKPLPAPLNNEPYKGKIWCVVARGANRTALGSAIKY  393

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGN TC  I+PG  CY P SL+RHASYAFSSYWAQFR  GGTCYFNGLAV+T  DP 
Sbjct  394  ACGQGNGTCEEIRPGSDCYEPVSLVRHASYAFSSYWAQFRKFGGTCYFNGLAVQTTKDPG  453

Query  177  YGACKYPSITL  145
            +G+CKYPS+TL
Sbjct  454  HGSCKYPSVTL  464



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYNSAT+NRNV+KK T+K  +GTPARPG VIP++IFALYNENQKPGPGTERH
Sbjct  274  DIDQIGANIYNSATFNRNVIKKLTTKPAIGTPARPGWVIPSIIFALYNENQKPGPGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+LYPNGT IY IDLSG TP SE+  PLP PT N+PYKGK+WC+VA   N TAV DALS
Sbjct  334  FGLLYPNGTKIYEIDLSGDTPLSEYTKPLPAPTNNEPYKGKIWCMVAKGVNETAVGDALS  393

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YAC QGN+TC+ IQ G  CY P+SL  HASYAFSSYWAQF+  GGTC FNGLA  T  DP
Sbjct  394  YACSQGNKTCDAIQTGKECYKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGLATMTPKDP  453

Query  180  SYGACKYPSITL  145
            S+G CK+P  TL
Sbjct  454  SFGHCKFPGTTL  465



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I N+ATYNRNVVKKF +K  VGTPARPGVV+P+ IFAL+NEN KPGP TER+
Sbjct  273  DFDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGVVLPSFIFALFNENTKPGPSTERN  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+++YPIDLSGKTP SE+PPLP    N+PY+G +WC+VA  AN +AVA ALSY
Sbjct  333  FGLLYPNGSHVYPIDLSGKTPLSEYPPLPAAKNNKPYEGPIWCIVAKGANRSAVASALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPGG C+ P+SL  HASYAFS+YWAQFR  GG+CYF GLA +TI DPS
Sbjct  393  ACSQGNKTCDPIQPGGKCFKPDSLFWHASYAFSAYWAQFRKAGGSCYFGGLATQTIKDPS  452

Query  177  YGACKYPSITL  145
            YG+CK+P   L
Sbjct  453  YGSCKFPGAKL  463



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 6/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQ+GA+IYN+ATYNRNVVKKF +K  +GTPARPG VIPT+IFALYNENQKPGPGTER+
Sbjct  275  DPDQLGANIYNAATYNRNVVKKFMAKPPIGTPARPGAVIPTMIFALYNENQKPGPGTERN  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+++YPIDLSGKT  S++PPL KP  N    GK+WCVVA  AN TA+  ALSY
Sbjct  335  FGLLYPNGSHVYPIDLSGKTQVSDYPPLAKPANN----GKLWCVVAEGANKTALTGALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC+PIQPGG CY PNSLI+HASYAFSSYWAQ R+ G TC F+GLAV    DPS
Sbjct  391  ACSQGNRTCDPIQPGGKCYKPNSLIKHASYAFSSYWAQMRAAGATCSFSGLAVMISKDPS  450

Query  177  YGACKYPSITL  145
            YGACKYPS+ L
Sbjct  451  YGACKYPSVNL  461



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYNSAT+NRNVVKK T+K  +GTPARPG VIP++IFALYNENQKPGPGTERH
Sbjct  274  DIDQIGANIYNSATFNRNVVKKLTTKPAIGTPARPGWVIPSIIFALYNENQKPGPGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+LYPNGT IY IDLSG TP SE+  PLP PT N+PYKGK+WC+VA   N TAV DALS
Sbjct  334  FGLLYPNGTKIYEIDLSGDTPLSEYKKPLPAPTNNEPYKGKIWCMVAKGVNETAVRDALS  393

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YAC QGN TC+ IQ G  CY P+SL  HASYAFSSYWAQF+  GGTC FNGLA  T  DP
Sbjct  394  YACSQGNGTCDAIQTGKKCYKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGLATMTPKDP  453

Query  180  SYGACKYPSITL  145
            S+G CK+P +TL
Sbjct  454  SFGHCKFPGVTL  465



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I+N+A YNRN+VK+ TSK  VGTPARPG V+PT+IF+LYNEN+K GPGTERH
Sbjct  273  DYDQIGANIHNAAVYNRNIVKRMTSKPPVGTPARPGRVLPTIIFSLYNENEKGGPGTERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYP+G  +Y +DLSG T E++F PLP+  TN+PYKG++WCVV    N++ V  ALSY
Sbjct  333  FGLLYPSGKAVYEMDLSGSTAETKFKPLPEAETNEPYKGRIWCVVGKGVNMSEVVGALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC PI+ GG CY P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA +TI DPS
Sbjct  393  ACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKIGGTCYFNGLATQTIKDPS  452

Query  177  YGACKYPSITL  145
            YG CK+PS+TL
Sbjct  453  YGKCKFPSVTL  463



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGASI+N+A YNRN+VK+ TSK  VGTPARPG ++PT+IF+LYNENQKPGPGTERH
Sbjct  273  DYDQIGASIHNAAVYNRNIVKRVTSKPPVGTPARPGRMLPTIIFSLYNENQKPGPGTERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYP G  +Y +DLSG   E++F PLP+   N+PYKGK+WCVV    N++ V  ALSY
Sbjct  333  FGLLYPKGKAVYEMDLSGSRAETKFKPLPEAERNEPYKGKIWCVVGKGVNMSDVVGALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC PI+ GG CY P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA +TI DPS
Sbjct  393  ACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKVGGTCYFNGLATQTIKDPS  452

Query  177  YGACKYPSITL  145
            YG CK+PS+TL
Sbjct  453  YGKCKFPSVTL  463



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I N+ATYNRNVVKKF +K  VGTPARPG V+P+ +FAL+NEN KPGP TER+
Sbjct  325  DYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGAVLPSFVFALFNENTKPGPSTERN  384

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG LYPNG+N+YPIDLSGKTPESE+ PLP  T N+PYKG +WC+VA  AN +AVA ALSY
Sbjct  385  FGFLYPNGSNVYPIDLSGKTPESEYAPLPVATNNEPYKGPIWCMVAKGANQSAVASALSY  444

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPGG C+ P+SL  HASYAFS+YW+QFR  GG+CYF GLA +TI DPS
Sbjct  445  ACSQGNKTCDPIQPGGKCFKPDSLAWHASYAFSAYWSQFRKAGGSCYFGGLATQTIKDPS  504

Query  177  YGACKYPSITL  145
            YG+CK+P   L
Sbjct  505  YGSCKFPGAKL  515



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIG +I+N+ATYNRNV+KKFT+K  VGTPARPGVV+P+ IFALYNEN KPGPGTER+
Sbjct  273  DYDQIGTNIHNAATYNRNVIKKFTAKPPVGTPARPGVVLPSFIFALYNENMKPGPGTERN  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+Y IDL+GKTP  EF PLP  T N+PY G +WC+V   AN TAVA+ALSY
Sbjct  333  FGLLYPNGSNVYEIDLTGKTPVLEFKPLPPATNNKPYPGPIWCLVKEGANKTAVAEALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPGG C+ PN+L +HASYAFS+YWAQFR  GG+C F GLAV+TI DPS
Sbjct  393  ACSQGNKTCDPIQPGGKCFKPNTLAQHASYAFSAYWAQFRKAGGSCSFGGLAVQTIKDPS  452

Query  177  YGACKYP  157
            YG+CKYP
Sbjct  453  YGSCKYP  459



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+++N+ATYNRN ++K   K  VGTPARPG+++P+ +FAL+NEN KPGPGTER+
Sbjct  273  DIDQIGANVFNAATYNRNFIRKVMKKPVVGTPARPGLILPSFLFALFNENIKPGPGTERN  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+ +Y IDL GKTPES+FP LP P  N+PYKGK+WCV A  +NLT + +ALSY
Sbjct  333  FGLLYPNGSRVYEIDLFGKTPESDFPALPPPENNEPYKGKIWCVAARGSNLTELGEALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC+ +QPG  C+ P S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  DPS
Sbjct  393  ACSQGNRTCDAVQPGKKCFKPESIFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPS  452

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  453  YGSCKFPSVTL  463



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   290 bits (741),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK +++  +GTPARPG V+P+ +FALYNENQK GPGTERH
Sbjct  276  DYDQIGANIYNAATYNRNVVKKLSARPAIGTPARPGWVLPSFMFALYNENQKTGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPN + +Y IDLSG+TP++E+  LP PT N+PY+GK+WCVVA  AN +A+A ALSY
Sbjct  336  FGLLYPNDSFVYDIDLSGETPDTEYGKLPAPTNNEPYEGKIWCVVAKRANRSALASALSY  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC PIQPG AC+   SL+R ASYAFSSYWAQFR  GG+CYFNGLA +TI DPS
Sbjct  396  ACSQGNATCGPIQPGKACHRKGSLVRQASYAFSSYWAQFRKTGGSCYFNGLATQTIEDPS  455

Query  177  YGACKYPSITL  145
            YG+C++P++TL
Sbjct  456  YGSCEFPAVTL  466



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  636  KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPP  457
            K+GTPARPGVV+P  IFALYNENQKPGPGTERHFG+LYPNGT +Y IDLSGKTPESE+ P
Sbjct  255  KIGTPARPGVVLPAFIFALYNENQKPGPGTERHFGLLYPNGTRVYEIDLSGKTPESEYEP  314

Query  456  LPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRH  277
            LPKPT N+PYKGK+WCVV   AN TA+A AL YACGQGN TC+PIQPGG CY PNSL+ H
Sbjct  315  LPKPTNNEPYKGKIWCVVGEGANRTALAAALGYACGQGNGTCDPIQPGGKCYEPNSLVHH  374

Query  276  ASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  145
            AS+AFSSYWAQFR +GGTCYF+GLA +TI DPSYG+CK+PS+TL
Sbjct  375  ASFAFSSYWAQFRKVGGTCYFSGLATQTIRDPSYGSCKFPSVTL  418



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVK+ T+K  +GTPARPG VIP+ IFA+YNENQKPGPGTERH
Sbjct  273  DIDQIGANIYNAATYNRNVVKRLTAKPAIGTPARPGSVIPSFIFAMYNENQKPGPGTERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+LYPNG+ +Y IDLSG+  ESE+  PLP P  N PY GK+WCVVA  AN TA+ DAL 
Sbjct  333  FGLLYPNGSKVYDIDLSGEKTESEYTKPLPAPINNAPYTGKIWCVVAKGANRTALGDALG  392

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YAC QGN+TC+PIQPG  C+ P+S++ HASYAFSS+WAQ R  G TCYFNGLA +T  DP
Sbjct  393  YACSQGNKTCDPIQPGKKCFKPDSVVWHASYAFSSFWAQMRQAGATCYFNGLATQTTKDP  452

Query  180  SYGACKYPSITL  145
            S+G CK+PS++L
Sbjct  453  SFGHCKFPSVSL  464



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 151/180 (84%), Gaps = 2/180 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQKPGPGTERH
Sbjct  271  DIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQKPGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ ALSY
Sbjct  331  FGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  DPS
Sbjct  391  ACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAKDPS  450



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +Q GA+ YNSATYNRNVVKK T+   +GTPARPGV IP  IF+LYNENQKPGPGTERH
Sbjct  287  DFEQFGANTYNSATYNRNVVKKLTTIPAIGTPARPGVAIPAFIFSLYNENQKPGPGTERH  346

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+ YPNGT ++ IDLSGKTP S +  PLP PT N+PYKGK+WCVVA  AN +AV DAL+
Sbjct  347  FGLYYPNGTEVFEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCVVAKEANRSAVKDALA  406

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC QGN+TC+ IQPG  CY P SL RHASYAFSSYWA+F+ +GG C FNGLA  T  DP
Sbjct  407  WACSQGNKTCDEIQPGKECYKPVSLFRHASYAFSSYWAEFKKIGGVCSFNGLATTTFKDP  466

Query  180  SYGACKYPSITL  145
            S+G CK+PS+TL
Sbjct  467  SFGQCKFPSVTL  478



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I N+ATYNRNVVKKF +K  VGTPARPGVV P+ +FAL+NEN K GP TER+
Sbjct  273  DYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGVVFPSFVFALFNENTKTGPSTERN  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+++YPIDLSGKTP SE+PPLP    N+P KG +WC+VA  AN +AVA ALSY
Sbjct  333  FGLLYPNGSHVYPIDLSGKTPVSEYPPLPAAKNNKPXKGPIWCMVAKGANRSAVASALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQPGG C+ P++L  HASYAFS+YWAQFR  GG+CYF GLA +TI DPS
Sbjct  393  ACSQGNKTCDPIQPGGKCFKPDTLSWHASYAFSAYWAQFRKAGGSCYFGGLATQTIKDPS  452

Query  177  YGACKYPSITL  145
            YG+CK+P   L
Sbjct  453  YGSCKFPGAKL  463



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA++YN+ATYNRN +KK T K  VGTPARPG ++P+ +FAL+NENQK GPGTERH
Sbjct  275  DLDQIGANVYNAATYNRNFIKKVTRKPRVGTPARPGSLLPSFLFALFNENQKSGPGTERH  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ ++ IDLSGKTPES+F PLP P  N+ +KGK+WCV A   N+T +A ALSY
Sbjct  335  FGLLHPNGSRVFDIDLSGKTPESDFQPLPAPENNEKFKGKIWCVAARRDNVTELAAALSY  394

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQ  G C+ P S+  HASYAFS+YWAQF+ +G TCYFNGLA +T  DPS
Sbjct  395  ACSQGNGTCDPIQTRGKCFKPGSVFWHASYAFSAYWAQFKKIGATCYFNGLATQTAKDPS  454

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  455  YGSCKFPSVTL  465



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA++YN+ATYNRN+V++  +K  VGTPA PGVV+PT IFAL+NENQK G GTERH
Sbjct  274  DIDQIGANVYNAATYNRNLVQRLNAKPLVGTPAMPGVVLPTFIFALFNENQKGGQGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPA--ANLTAVADAL  364
            +G+ YP   ++YPIDL+G+T  + +P LPKP  N+PYKGK+WCVVA A  AN+TA+ DA+
Sbjct  334  WGLFYPTEAHVYPIDLTGETDLASYPALPKPKNNEPYKGKIWCVVAEAKGANMTALGDAV  393

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC  IQP G CYNP SLI HA+YAFSSYWAQF+S G TC+FNGLAV+T  D
Sbjct  394  TYACGQGNGTCAAIQPKGLCYNPKSLIYHANYAFSSYWAQFKSQGATCFFNGLAVQTTKD  453

Query  183  PSYGACKYPSITL  145
            PS+G CKYPS+TL
Sbjct  454  PSHGKCKYPSVTL  466



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +Q+GA+IYNSATYNRNVVKK T+   +GTPA+PGVVIP  IF+LYNENQKPGPGTER 
Sbjct  274  DFEQLGANIYNSATYNRNVVKKLTTIPAIGTPAQPGVVIPAFIFSLYNENQKPGPGTERQ  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+ YPNGT ++ IDLSGKTP S +  PLP PT N+PYKGK+WC+VA  AN +AV DAL+
Sbjct  334  FGLYYPNGTEVFEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANRSAVKDALA  393

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC QGN+TC+ IQPG  CY P SL  HASYAFSSYWA+F+ +GG C FNGLA  T+ DP
Sbjct  394  WACSQGNKTCDEIQPGKGCYKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGLATTTVKDP  453

Query  180  SYGACKYPSITL  145
            S+G CK+PS+TL
Sbjct  454  SFGQCKFPSVTL  465



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK T++  +GTPARPG+V+P+ IFALYNENQK GPGTERH
Sbjct  273  DYDQIGANIYNAATYNRNVVKKLTAEPPIGTPARPGLVLPSFIFALYNENQKTGPGTERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  333  FGLLHPNGSQVYEIELSGKTTEFK-DSLPAPENNELYKGKIWCVVAKGANWTQLRDALSY  391

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPS
Sbjct  392  ACSQGNNTCEPIQTGGLCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIKDPS  451

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  452  YGRCEFPSVTL  462



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ IFALYNENQK GPGTERH
Sbjct  312  DYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFIFALYNENQKTGPGTERH  371

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  372  FGLLHPNGSQVYEIELSGKTTEYK-EALPGPENNEGYKGKIWCVVAKGANWTQLGDALSY  430

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP 
Sbjct  431  ACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPG  490

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  491  YGRCEFPSVTL  501



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = -3

Query  711   DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
             D+DQIGA+IYN+ATYNRN VKK T K  VGTPARPG +IP+ IF+LYNEN KPG GTERH
Sbjct  1052  DLDQIGANIYNAATYNRNFVKKVTKKPSVGTPARPGSIIPSFIFSLYNENLKPGLGTERH  1111

Query  537   FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
             FG+LYPNG+++Y IDLSGKT  SEF PLP P   + YKGK WCVVA  AN TAVA+ALSY
Sbjct  1112  FGLLYPNGSSVYEIDLSGKTLASEFKPLPPP---ENYKGKAWCVVAEGANETAVAEALSY  1168

Query  357   ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             AC QGNRTC+P+QPG  C+ P S+I HASYAFSSYWAQFR++GGTC FNGLA++   DPS
Sbjct  1169  ACSQGNRTCDPVQPGKPCFEPVSVIGHASYAFSSYWAQFRNVGGTCQFNGLAIQIAKDPS  1228

Query  177   YGACKYPSITL  145
             YG+CKYPS+TL
Sbjct  1229  YGSCKYPSVTL  1239



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  ++  VG+PARPG V+P+ IFALYNENQK GPGTERH
Sbjct  271  DYDQIGANIYNAATYNRNVVKKLAAEPPVGSPARPGKVLPSFIFALYNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  331  FGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP 
Sbjct  390  ACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPG  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  ++  VG+PARPG V+P+ IFALYNENQK GPGTERH
Sbjct  271  DYDQIGANIYNAATYNRNVVKKLAAEPPVGSPARPGKVLPSFIFALYNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  331  FGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP 
Sbjct  390  ACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPG  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK GPGTERH
Sbjct  272  DYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  332  FGLLHPNGTQVYGIDLSGKTTEYG-GALPAPENNEVYKGKIWCVVAKGANWTQLGEALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPS
Sbjct  391  ACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPS  450

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  451  YGRCEFPSVTL  461



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ IFALYNENQK GPGTERH
Sbjct  271  DYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFIFALYNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  331  FGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEGYKGKIWCVVAKGANWTQLGDALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+ I+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI DP 
Sbjct  390  ACSQGNNTCDSIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKDPG  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+I+N+ TYNRN VKK T K  VGTPARPG ++P+ IFALYNEN K G GTERH
Sbjct  196  DLDQIGANIHNAGTYNRNFVKKVTKKPPVGTPARPGSILPSFIFALYNENLKTGLGTERH  255

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+ IY IDLSGKTPE E+ PLP P     YKGK WCVVA  AN TAV +ALSY
Sbjct  256  FGLLYPNGSRIYEIDLSGKTPEYEYKPLPPP---DDYKGKAWCVVAEGANKTAVVEALSY  312

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC  +QPG  C+ P+S++ HASYAFSSYWAQFR +GGTC FNGLA +   DPS
Sbjct  313  ACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAEDPS  372

Query  177  YGACKYPSITL  145
            YG+CKYPS+ L
Sbjct  373  YGSCKYPSVIL  383



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I+N+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK GPGTERH
Sbjct  272  DYDQIGANIFNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  332  FGLLHPNGTQVYGIDLSGKTTEYG-GELPAPENNEVYKGKIWCVVAKGANWTQLGEALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPS
Sbjct  391  ACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPS  450

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  451  YGRCEFPSVTL  461



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA++YN+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK GPGTERH
Sbjct  272  DYDQIGANVYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  332  FGLLHPNGTQVYGIDLSGKTTEYG-GALPVPENNEVYKGKIWCVVAKGANWTQLGEALSY  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPS
Sbjct  391  ACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPS  450

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  451  YGRCEFPSVTL  461



>ref|XP_010906169.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Elaeis 
guineensis]
Length=222

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 151/191 (79%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  IFALYNENQKPGPGTERH
Sbjct  31   DLDQIGANIYNAATYNRNLARRLSERPALGTPARPGAVMPVFIFALYNENQKPGPGTERH  90

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAVADA  367
            +G+LYPN T +Y +DL+G+ P+S + PLP P  N+PYKGK+WCV      + N TAV  A
Sbjct  91   WGLLYPNATRVYEVDLTGRLPDSAYGPLPLPDNNEPYKGKIWCVFGGGGKSVNATAVGSA  150

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            ++YACGQG+ TCN IQPGG CY P SL   ASYAF+SYW QFR  GGTCYFNGLAV+T  
Sbjct  151  IAYACGQGSGTCNAIQPGGQCYRPGSLTARASYAFNSYWQQFRRSGGTCYFNGLAVQTAQ  210

Query  186  DPSYGACKYPS  154
            DPSYG+CK+PS
Sbjct  211  DPSYGSCKFPS  221



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNV+KKF ++  VGTPARPG V+P  IFALYNENQK GPGTERH
Sbjct  280  DYDQIGANIYNAATYNRNVIKKFAAEPPVGTPARPGEVLPAFIFALYNENQKTGPGTERH  339

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  340  FGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSY  398

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG C+ P+  I HASYAFSSYWA FR  G TC FNGLA +TI DPS
Sbjct  399  ACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSFNGLATQTIKDPS  458

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  459  YGRCEFPSVTL  469



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+I+N+ TYNRN VKK T K  VGTPARPG ++P+ IFALYNEN K G GTERH
Sbjct  276  DLDQIGANIHNAGTYNRNFVKKVTKKPPVGTPARPGSILPSFIFALYNENLKTGLGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+ IY IDLSGKTPE E+ PLP P     YKGK WCVVA  AN TAV +ALSY
Sbjct  336  FGLLYPNGSRIYEIDLSGKTPEYEYKPLPPP---DDYKGKAWCVVAEGANKTAVVEALSY  392

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC  +QPG  C+ P+S++ HASYAFSSYWAQFR +GGTC FNGLA +   DPS
Sbjct  393  ACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAEDPS  452

Query  177  YGACKYPSITL  145
            YG+CKYPS+ L
Sbjct  453  YGSCKYPSVIL  463



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK GPGTERH
Sbjct  271  DYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  331  FGLLHPNGTQVYGIDLSGKTTEYK-ESLPAPENNEFYKGKIWCVVAKGANWTQLGDALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNNTCDPIQRGGPCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK GPGTERH
Sbjct  272  DYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT   E   LP P  N  YKGK+WCVVA  AN T + DALSY
Sbjct  332  FGLLHPNGTQVYGIDLSGKTEYKE--SLPAPENNDLYKGKIWCVVAKGANWTQLGDALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK G GTERH
Sbjct  271  DYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQKTGQGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT E +   LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  331  FGLLHPNGTQVYGIDLSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTELGEALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN+TC+PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNKTCDPIQSGGPCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+I+N+ATYNRN++++ TSK   GTPARPGVVIPT IFALYNENQK GPGTERH
Sbjct  274  DIDQIGANIFNAATYNRNLIRRMTSKPPAGTPARPGVVIPTFIFALYNENQKGGPGTERH  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G++ P+GT +Y +DL+GK PE++F  LP P  N+ YKGK+WCVVA  AN T +  A+ +
Sbjct  334  WGLMNPDGTPVYEVDLNGKRPENDFKSLPAPLNNELYKGKIWCVVADGANSTELESAIEF  393

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC  GN TC+ I+PG  CY+P SL+ HASYAFSSYWAQF+  GGTCYFNGLAV+T  DPS
Sbjct  394  ACRLGNNTCDAIRPGSECYHPVSLVSHASYAFSSYWAQFKQSGGTCYFNGLAVQTTEDPS  453

Query  177  YGACKYPSITL  145
             G+CK+PS+TL
Sbjct  454  NGSCKFPSVTL  464



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK GPGTERH
Sbjct  272  DYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGK    E   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  332  FGLLHPNGTQVYGIDLSGKMEYKE--SLPAPDNNELYKGKIWCVVAKGANWTQLGDALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|XP_007134153.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
 gb|ESW06147.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
Length=335

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ+GA+++N+ATYNRN+VK+ T    +GTPARPG V+P  IF+LYNEN KPG G+ERH
Sbjct  148  DLDQVGANVHNAATYNRNIVKRLTRNPVLGTPARPGSVLPAFIFSLYNENLKPGLGSERH  207

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+ +Y IDLSG TPESE  P+P P  +  YKGK WCVVA  AN+T VA ALSY
Sbjct  208  FGLLYPNGSRVYDIDLSGNTPESELAPVP-PAMD--YKGKAWCVVAEGANVTEVAAALSY  264

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            +C QGN TC+PIQPG  C+ P+S+  HA YAFS+YWAQFR +GGTCYFNGLA +T  DPS
Sbjct  265  SCSQGNGTCDPIQPGHPCFKPDSVTSHADYAFSAYWAQFRRVGGTCYFNGLATQTAKDPS  324

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  325  YGSCKFPSVTL  335



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 151/191 (79%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +Q GA+IYNSATYNRNVVKK  +   +GTPA+PGVVIP  IF+LYNENQKPGPGTER 
Sbjct  274  DFEQFGANIYNSATYNRNVVKKLATIPVIGTPAQPGVVIPAFIFSLYNENQKPGPGTERQ  333

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVADALS  361
            FG+ YPNGT +  IDLSGKTP S +  PLP PT N+PYKGK+WC+VA  AN +AV DAL+
Sbjct  334  FGLYYPNGTEVLEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANRSAVKDALA  393

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC QGN TC+ IQPG  CY P SL  HASYAFSSYWA+F+ +GG C FNGLA  T+ DP
Sbjct  394  WACSQGNTTCDKIQPGKGCYKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGLATTTVKDP  453

Query  180  SYGACKYPSIT  148
            S+G CK+PS+T
Sbjct  454  SFGQCKFPSVT  464



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   271 bits (693),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I+N+A YNRNVVKK T+   VGTPARPG V+P+ IF+LYNENQKPGPGTERH
Sbjct  271  DYDQIGANIHNAAIYNRNVVKKLTADPPVGTPARPGRVLPSFIFSLYNENQKPGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+ +PNGT +Y IDLSGK  E E   LP+P  N+PYKG++WCVVA  AN T + +ALSY
Sbjct  331  FGMYHPNGTRVYDIDLSGKRTEYE-DVLPEPENNEPYKGRIWCVVAKGANWTELGEALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC PI+PGG C  P+ ++ HASYAFSSYWAQ R  G TC+FNGLA +TI DPS
Sbjct  390  ACSQGNNTCAPIRPGGECSKPDLIVLHASYAFSSYWAQSRKSGATCFFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 153/194 (79%), Gaps = 6/194 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+++N+A YNRN+ ++  ++  VGTPARPG V+P  +F+LYNENQKPGPGTERH
Sbjct  280  DLDQIGANVHNAAIYNRNLARRLAARPAVGTPARPGAVMPVFVFSLYNENQKPGPGTERH  339

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVAD  370
            +G+LYPNG+ +Y +DLSG+ P   +PPLP P  N+PYKGK+WCV       AAN T V  
Sbjct  340  WGLLYPNGSKVYEVDLSGRRPLDSYPPLPPPDNNEPYKGKIWCVFGGDRKAAANATTVGA  399

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            AL+YACGQGN TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F+GLAV+T 
Sbjct  400  ALAYACGQGNGTCDAIRPGGPCYKPNTLLAHASYAFNSYWQQFRQAGGTCFFDGLAVQTK  459

Query  189  NDPSYGACKYPSIT  148
             DPSYG CKY S+T
Sbjct  460  TDPSYGTCKYASLT  473



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 152/192 (79%), Gaps = 4/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNV+KKF ++  VGTPARPG V+P  IFALYNENQK GPGTERH
Sbjct  280  DYDQIGANIYNAATYNRNVIKKFAAEPPVGTPARPGEVLPAFIFALYNENQKTGPGTERH  339

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DALSY
Sbjct  340  FGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDALSY  398

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG C+ P+  I HASYAFSSYWA FR  G TC FNGLA +TI DP+
Sbjct  399  ACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSFNGLATQTIKDPT  458

Query  177  -YGACKYPSITL  145
             YG C++PS+TL
Sbjct  459  GYGRCEFPSVTL  470



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA++YN+ATYNRNVVKK +++  VGTPARPG V+P+ IFAL+NENQK GPGTERH
Sbjct  271  DYDQIGANVYNAATYNRNVVKKLSAEPPVGTPARPGKVLPSFIFALFNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  331  FGLLHPNGSRVYEIELSGETTEYK-ETLPAPENNEVYKGKIWCVVAKGANWTQLGEALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNNTCDPIKPGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            +G C++PS+TL
Sbjct  450  FGRCEFPSVTL  460



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 151/191 (79%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+I+N+ATYNRNVVKK T    VGTPARPG V+P  IF+LYNENQKPGPGTERH
Sbjct  271  DYDQIGANIFNAATYNRNVVKKLTIDPPVGTPARPGRVLPAFIFSLYNENQKPGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+  PNG  +Y +DLSGKT E E   LP+P  N+PYKGK+WCVVA  AN T + +ALSY
Sbjct  331  FGLYNPNGNPVYDMDLSGKTTEYE-DVLPEPGNNEPYKGKIWCVVAKGANWTELGEALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+PGG C  P  ++ HAS+AFSSYWA+FR  G TC+FNGLA +T+ DPS
Sbjct  390  ACSQGNNTCDPIRPGGPCNKPEFILTHASFAFSSYWAEFRKSGATCHFNGLATQTVKDPS  449

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  450  YGRCEFPSVTL  460



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 149/191 (78%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  +FALYNENQKPGPGTERH
Sbjct  198  DLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQKPGPGTERH  257

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAVADA  367
            +G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       AN T V  A
Sbjct  258  WGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEVGAA  317

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            ++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFNGLAV+T  
Sbjct  318  IAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQ  377

Query  186  DPSYGACKYPS  154
            DPS+G+CKYPS
Sbjct  378  DPSHGSCKYPS  388



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA++YN+ATYNRNVVKK ++   VGTPARPG V+P+ IFAL+NENQK GPGTERH
Sbjct  271  DYDQIGANVYNAATYNRNVVKKLSAVPPVGTPARPGKVLPSFIFALFNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  331  FGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKGANWTQLGEALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+ GG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIKDPS  449

Query  177  YGACKYPSITL  145
            +G C++PS+TL
Sbjct  450  FGRCEFPSVTL  460



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+I+N+ATYNRN +KK T K  +GTPARPG  +P+ +FAL+NENQKPGPGTERH
Sbjct  277  DLDQIGANIFNAATYNRNFIKKVTRKPWLGTPARPGSALPSFLFALFNENQKPGPGTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y +DLSG+TPE+ F PLP P  N+ +KG++WCV A   N TA+A AL+Y
Sbjct  337  FGLLHPNGSRVYDVDLSGETPEAGFRPLPVPENNEKFKGEIWCVAARPHNATALAAALAY  396

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQP G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T  DPS
Sbjct  397  ACSQGNGTCDPIQPKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPS  456

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  457  YGSCKFPSVTL  467



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 151/191 (79%), Gaps = 8/191 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +QIGA+I+N+ATYNRNVVKKF +K   GTPARP  VIP++IFALYNENQKPG GTER+
Sbjct  275  DPNQIGANIHNAATYNRNVVKKFMAKPPYGTPARPYTVIPSMIFALYNENQKPGQGTERN  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNG+N+YPIDLSGKT +S +PPLP P        K+WCV    ANL A+  A+SY
Sbjct  335  FGLLYPNGSNVYPIDLSGKTRDSRYPPLPNPNR------KLWCVAVKGANLRAMGGAMSY  388

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGNRTC+PIQPGG C+NPNSL  HASYAFSSYWAQ    G TC+F+GLA  T  DPS
Sbjct  389  ACSQGNRTCDPIQPGGKCFNPNSLAVHASYAFSSYWAQLWKEGATCFFDGLAFMTSKDPS  448

Query  177  YGACKYPSITL  145
            +G+CK+PSI +
Sbjct  449  FGSCKFPSIDI  459



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+ YN+ATYNRN +KK T K  VGTPARPG  +P+ +FAL+NENQKPGP TERH
Sbjct  277  DLDQIGANTYNAATYNRNFIKKVTKKPRVGTPARPGSALPSFLFALFNENQKPGPSTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y +DLSG+TPE+EF PLP P  N+ +KG++WCV A   N TA+  AL+Y
Sbjct  337  FGLLHPNGSRVYDVDLSGETPEAEFRPLPVPENNEKFKGRIWCVAARRDNATALTAALAY  396

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PIQ  G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T  DPS
Sbjct  397  ACSQGNGTCDPIQSKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPS  456

Query  177  YGACKYPSITL  145
            YG+CK+PS+TL
Sbjct  457  YGSCKFPSVTL  467



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 149/191 (78%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  +FALYNENQKPGPGTERH
Sbjct  276  DLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQKPGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAVADA  367
            +G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       AN T V  A
Sbjct  336  WGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEVGAA  395

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            ++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFNGLAV+T  
Sbjct  396  IAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQ  455

Query  186  DPSYGACKYPS  154
            DPS+G+CKYPS
Sbjct  456  DPSHGSCKYPS  466



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 149/191 (78%), Gaps = 5/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  +FALYNENQKPGPGTERH
Sbjct  279  DLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQKPGPGTERH  338

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAVADA  367
            +G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       AN T V  A
Sbjct  339  WGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEVGAA  398

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            ++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFNGLAV+T  
Sbjct  399  IAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQ  458

Query  186  DPSYGACKYPS  154
            DPS+G+CKYPS
Sbjct  459  DPSHGSCKYPS  469



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D+DQIGA++YN+A YNRN V+K  S +GTP RP   I   IF+LYNEN K GPGTERH+G
Sbjct  275  DLDQIGANVYNAAHYNRNFVRKLRSNMGTPMRPNQTIFAYIFSLYNENLKGGPGTERHWG  334

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC  352
            +LYPNG+ +Y +DL+G+TP S++ PLP+P  N+ YKGK+WCVV P AN+TA+  ALSYAC
Sbjct  335  LLYPNGSRVYEVDLTGRTPNSKYAPLPEPKNNEQYKGKIWCVVVPGANVTALGPALSYAC  394

Query  351  GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  172
             Q N TCN IQ G  C+ PN+L+ HASYAF+SYW  FR  GGTC+FNGLAV+T  +PSYG
Sbjct  395  SQANDTCNAIQRGKKCFMPNTLVSHASYAFNSYWQMFRGTGGTCFFNGLAVQTAINPSYG  454

Query  171  ACKYPSIT  148
            +CK+P+++
Sbjct  455  SCKFPTLS  462



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN++KK TSK  +GTPARPG +IPT IF+LY+ENQK GPGTERH
Sbjct  199  DFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTFIFSLYDENQKTGPGTERH  258

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA +A+L A+  AL Y
Sbjct  259  WGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARSADLLALTSALGY  318

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA +TI +PS
Sbjct  319  ACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTIINPS  378

Query  177  YGACKYPSITL  145
             G C++PS+TL
Sbjct  379  RGNCRFPSVTL  389



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 149/194 (77%), Gaps = 6/194 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+++N+ATYNRN+ ++   +   GTPARPG  +P  IF+LYNE++KPGPGTERH
Sbjct  261  DLDQIGANVHNAATYNRNLARRMAVRPAAGTPARPGAAMPVFIFSLYNEDRKPGPGTERH  320

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVV----APAANLTAVAD  370
            +G+L P+G  +Y +DLSG+ P   +PPLP P  + PY GK+WCV+       AN TAV  
Sbjct  321  WGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCVLDAEGKATANTTAVGA  380

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            AL+YACGQG  TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F+GLAV+T 
Sbjct  381  ALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFRQAGGTCFFDGLAVQTK  440

Query  189  NDPSYGACKYPSIT  148
             DPSYG+CKYPS+T
Sbjct  441  ADPSYGSCKYPSLT  454



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA+I+N+ATYNRN+VKK T+   +GTPARPG +IPT IF+LYNEN+K GPGTERH
Sbjct  289  DIDQAGANIHNAATYNRNLVKKMTANPPMGTPARPGTMIPTFIFSLYNENRKDGPGTERH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +GV   NG  IY IDLSG+  ESE+ PLP+   N+PYKGK+WCVV   A L  V   LS 
Sbjct  349  WGVFNENGKAIYDIDLSGQRQESEYEPLPEGINNRPYKGKLWCVVRREAGLMEVERELST  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             C QGN TC  + PG  CY P S+I HASYAFSSYWAQFRS G +CYFNGLA +T  DPS
Sbjct  409  VCSQGNETCEALAPGNDCYEPISVIWHASYAFSSYWAQFRSQGASCYFNGLAKQTTTDPS  468

Query  177  YGACKYPSITL  145
            +G+CK+PS+T+
Sbjct  469  HGSCKFPSVTV  479



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 149/194 (77%), Gaps = 6/194 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+++N+ATYNRN+ ++   +   GTPARPG  +P  IF+LYNE++KPGPGTERH
Sbjct  275  DLDQIGANVHNAATYNRNLARRMAVRPAAGTPARPGAAMPVFIFSLYNEDRKPGPGTERH  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVV----APAANLTAVAD  370
            +G+L P+G  +Y +DLSG+ P   +PPLP P  + PY GK+WCV+       AN TAV  
Sbjct  335  WGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCVLDAEGKATANTTAVGA  394

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            AL+YACGQG  TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F+GLAV+T 
Sbjct  395  ALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFRQAGGTCFFDGLAVQTK  454

Query  189  NDPSYGACKYPSIT  148
             DPSYG+CKYPS+T
Sbjct  455  ADPSYGSCKYPSLT  468



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            DVDQ+GA+IYN+ATYNRN+++K T+K  +GTPARPG+VIPT IF+LY ENQK GPGTERH
Sbjct  362  DVDQVGANIYNAATYNRNLIRKMTAKPPLGTPARPGLVIPTFIFSLYEENQKTGPGTERH  421

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ NGT IY IDL+GK   S++ PLP    N PYKGKVWC VAP ANL  ++ AL+Y
Sbjct  422  WGLLHSNGTAIYDIDLTGKRLASDYKPLPPAQNNVPYKGKVWCEVAPGANLMNLSSALTY  481

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC Q N+TC  + PG  CY P S+  H+SYAFSSYWA+FRS G TCYF+GLA +T  +PS
Sbjct  482  ACSQDNQTCAALSPGKECYEPISVFWHSSYAFSSYWAKFRSQGATCYFSGLARQTTVNPS  541

Query  177  YGACKYPSITL  145
             G CK+PS+ L
Sbjct  542  RGRCKFPSVIL  552



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 144/191 (75%), Gaps = 22/191 (12%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+IYN+ATYNRNVVKKFT+    GTPARPGV I   IFALYNENQKPG GTERH
Sbjct  276  DIDQIGANIYNAATYNRNVVKKFTAMPSAGTPARPGVNISVNIFALYNENQKPGAGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+LYPNGT++Y IDLSG TP+S + PLP+PT N+PYKGK+WCV                
Sbjct  336  FGLLYPNGTSVYDIDLSGHTPDSTYSPLPQPTNNKPYKGKLWCV----------------  379

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
                 NRTC  I+PGG CY PN L+ HASYAFS+YWAQFRS G TC+FNGLAV+T  DPS
Sbjct  380  ----DNRTCEAIRPGGKCYKPNWLVLHASYAFSAYWAQFRSSGATCFFNGLAVQTTKDPS  435

Query  177  YGACKYPSITL  145
            Y +C++PS+ L
Sbjct  436  YLSCQFPSVNL  446



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 148/190 (78%), Gaps = 7/190 (4%)
 Frame = -3

Query  705  DQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            DQ+GA+IYN+ATYNRN VKKF++   VG P+RPG VIP  IFAL+NEN+KPGPGTERHFG
Sbjct  268  DQLGANIYNAATYNRNAVKKFSANPPVGIPSRPGAVIPATIFALFNENKKPGPGTERHFG  327

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTAVADALSYA  355
             LYP+G  +YPIDLSGKTP S +PPL KP +N    G++WCVVA    N T++  AL+YA
Sbjct  328  QLYPDGKFVYPIDLSGKTPISAYPPLRKPASN----GRLWCVVANGVRNATSLTAALTYA  383

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CG GN TC+ I+PGG C+ P+SLIRHASY FSSYWAQF + G TC FNGLA  T  DPSY
Sbjct  384  CGNGNGTCDGIRPGGKCFRPDSLIRHASYGFSSYWAQFSAQGATCSFNGLATLTSKDPSY  443

Query  174  GACKYPSITL  145
            G CKYPS+ L
Sbjct  444  GYCKYPSVNL  453



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GASIYN+ATYNRN+V K T +  +GTPARPG+ IP  IF+LY+ENQK GPGTERH
Sbjct  276  DIGETGASIYNAATYNRNLVTKMTGQPLIGTPARPGLFIPAFIFSLYDENQKTGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+PNGT+IY IDL+GK   S++ PLP    + PY+GK WCV  P  NLT +  AL++
Sbjct  336  WGLLHPNGTSIYQIDLTGKRASSDYEPLPATHNDMPYEGKSWCVATPDVNLTELERALTF  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC  + PG  CY P S+I HAS+AFSSYWA+FRS G  CYFNGLAV+T +DPS
Sbjct  396  ACSQGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAKFRSQGANCYFNGLAVQTTSDPS  455

Query  177  YGACKYPSITL  145
             G C++PS+T+
Sbjct  456  RGLCQFPSVTI  466



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 151/193 (78%), Gaps = 6/193 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+++N+ATYNRN+V++  ++   GTPARPG ++P  IF+LYNENQKPGPGTERH
Sbjct  281  DLDQIGANVHNAATYNRNLVQRMAARPAAGTPARPGALMPVFIFSLYNENQKPGPGTERH  340

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVAD  370
            +G+LYP+G   Y +DLSG+ P + +P LP P  N+PYKG++WCV       A+N TAV  
Sbjct  341  WGLLYPHGKMAYDVDLSGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATAVGA  400

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            AL+YACGQGN TC+ I+PGG C+ PN+++ HASYAF+SYW  FR  G TC+F+GLA++T 
Sbjct  401  ALAYACGQGNGTCDGIRPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLALQTK  460

Query  189  NDPSYGACKYPSI  151
             DPSYG+CKY S+
Sbjct  461  TDPSYGSCKYRSL  473



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 151/193 (78%), Gaps = 6/193 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+++N+ATYNRN+V++  ++   GTPARPG ++P  IF+LYNENQKPGPGTERH
Sbjct  282  DLDQIGANVHNAATYNRNLVQRMAARPAAGTPARPGALMPVFIFSLYNENQKPGPGTERH  341

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVAD  370
            +G+LYP+G   Y +DLSG+ P + +P LP P  N+PYKG++WCV       A+N TAV  
Sbjct  342  WGLLYPHGKMAYDVDLSGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATAVGA  401

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            AL+YACGQGN TC+ I+PGG C+ PN+++ HASYAF+SYW  FR  G TC+F+GLA++T 
Sbjct  402  ALAYACGQGNGTCDGIRPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLALQTK  461

Query  189  NDPSYGACKYPSI  151
             DPSYG+CKY S+
Sbjct  462  TDPSYGSCKYRSL  474



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GASIYN+ATYNRN+V K T +  +GTPARPG+ IP  IF+LY+ENQK GPGTERH
Sbjct  276  DIGETGASIYNAATYNRNLVTKMTGRPQIGTPARPGLFIPAFIFSLYDENQKTGPGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+PNGT+IY IDL+GK   S++ PLP    + PY+GK WCV AP  NLT +  AL++
Sbjct  336  WGLLHPNGTSIYQIDLTGKRASSDYEPLPATQNDMPYEGKSWCVAAPDVNLTELERALNF  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC +GN TC  + PG  CY P S+I HAS+AFSSYWA+FRS G  CYFNGLAV+T  +PS
Sbjct  396  ACSKGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAKFRSQGANCYFNGLAVQTTRNPS  455

Query  177  YGACKYPSITL  145
             G C++PS+T+
Sbjct  456  RGLCQFPSVTI  466



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN+V+K T+    GTPARPG +IPT IFALY+EN+K GPGTERH
Sbjct  226  DIDEAGANIKNAATYNRNLVRKMTASNPTGTPARPGSLIPTFIFALYDENRKTGPGTERH  285

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+PNGT+IY IDL+GK   S++  LP    N PYKGK+WC+ AP  NLT +  AL++
Sbjct  286  WGLLHPNGTSIYQIDLTGKRASSDYETLPPAQNNVPYKGKLWCIAAPEVNLTELESALTF  345

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+ + PG  CY P S+  HASYAFSSYWA+FRS G  CYFNGLA +T ++PS
Sbjct  346  ACNQGNGTCDSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTSNPS  405

Query  177  YGACKYPSITL  145
             G+C++PS+T+
Sbjct  406  RGSCQFPSVTI  416



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQIGA+I N+ATYNR +V+K T+K  +GTPARPG VIPT IF+LY+ENQK GP TERH
Sbjct  272  DIDQIGANINNAATYNRKLVQKMTAKPPLGTPARPGSVIPTFIFSLYDENQKTGPTTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  NGT+IY IDL+GK P S + PLP    N PYKGK+WC VAP A+   ++ ALSY
Sbjct  332  WGLLRSNGTSIYEIDLTGKRPLSSYKPLPAARNNVPYKGKIWCEVAPGADAMNLSLALSY  391

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGN+TC  + PG  CY P S+  HASYAFSSYWA+FR  G TC FNGLA +T  +PS
Sbjct  392  ACGQGNQTCAALNPGKQCYEPVSVFWHASYAFSSYWARFRKQGATCNFNGLARQTRANPS  451

Query  177  YGACKYPSITL  145
             G C +PS+TL
Sbjct  452  RGHCSFPSVTL  462



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 147/191 (77%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN+V+K T+    GTPARPG +IPT IFALY+EN K GPGTERH
Sbjct  285  DIDEAGANIKNAATYNRNLVRKMTASNPTGTPARPGALIPTFIFALYDENTKTGPGTERH  344

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+PNGT+IY IDL+GK   S++  LP    N PYKGK+WC+ AP  NLT +  AL++
Sbjct  345  WGLLHPNGTSIYQIDLTGKRASSDYETLPPAHNNVPYKGKLWCIAAPEVNLTELERALTF  404

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+ + PG  CY P S+  HASYAFSSYWA+FRS G  CYFNGLA +T ++PS
Sbjct  405  ACNQGNGTCDSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTSNPS  464

Query  177  YGACKYPSITL  145
             G+C++PS+T+
Sbjct  465  RGSCQFPSVTI  475



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA+ YN+ATYNRN+V K TS   +GTPARPG+ I T IF+LY+ENQKPGPGTERH
Sbjct  278  DIDQPGANAYNAATYNRNLVMKMTSNPPLGTPARPGIEILTFIFSLYDENQKPGPGTERH  337

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  NG   Y +DL+G  PE+ +  LPKP+ N PYKGK+WCV    A+LT +  AL +
Sbjct  338  WGLLSNNGKPTYEVDLTGTRPETSYAILPKPSNNHPYKGKLWCVADSRASLTDLGPALDF  397

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGN TCN + PG  CY P S+  HASYAFSSYWA+FR+ G  CYF+GLAV+T  DPS
Sbjct  398  ACGQGNGTCNELAPGKGCYQPVSISAHASYAFSSYWAKFRNAGAVCYFDGLAVQTTTDPS  457

Query  177  YGACKYPSITL  145
            +G+C++PS+ L
Sbjct  458  HGSCQFPSVLL  468



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            DVDQ GA++YN+A  N+N++KK T+K  VGTPARPG+ IPT IFALYNENQK GPGTERH
Sbjct  285  DVDQPGANVYNAALXNQNLIKKMTAKPAVGTPARPGMTIPTFIFALYNENQKRGPGTERH  344

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  NG  +Y +DL+G+  ES    LP P  N+PY+GK+WCVVA   N   +  AL Y
Sbjct  345  WGLLDCNGKPVYGVDLTGEL-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPEQLVSALIY  403

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+ + PG  CY P SL+ HASYAFSSYWA+FRSLG  CYFNGLAV+T  DPS
Sbjct  404  ACSQGNGTCDALMPGKECYEPFSLLSHASYAFSSYWAKFRSLGANCYFNGLAVQTTEDPS  463

Query  177  YGACKYPSITL  145
             G+CK+P++TL
Sbjct  464  RGSCKFPTVTL  474



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 141/190 (74%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D DQIGA++ N+A YNRN+  +     GTPARPG  +P  +F+LYNEN KPGPGTERH+G
Sbjct  296  DYDQIGANVRNAAVYNRNLAARMARNPGTPARPGARMPVFVFSLYNENLKPGPGTERHWG  355

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + YPNGT +Y +DL+G+ P   +PPLP P  + PYKG++WCV+A  A    N TAV DAL
Sbjct  356  LYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWCVLAAHAGRKLNETAVGDAL  415

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR  G TCYFN LA +TI D
Sbjct  416  TYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNNLAEQTIKD  475

Query  183  PSYGACKYPS  154
            PS+G+CK+ S
Sbjct  476  PSHGSCKFRS  485



>gb|ACR37660.1| unknown [Zea mays]
Length=225

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 138/190 (73%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +QIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  31   DYNQIGGNVHNAAIYNRNLAARMAKNPGTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWG  90

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N TAV +AL
Sbjct  91   LYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLNETAVGNAL  150

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            SYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN LA +TI D
Sbjct  151  SYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNNLAEQTIKD  210

Query  183  PSYGACKYPS  154
            PS+G+C++PS
Sbjct  211  PSHGSCRFPS  220



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA++YN+ATYNRNVVKK ++   VGTPARPG V+P+ IFAL+NENQK GPGTERH
Sbjct  271  DYDQIGANVYNAATYNRNVVKKLSAVPPVGTPARPGKVLPSFIFALFNENQKTGPGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T + +ALSY
Sbjct  331  FGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKGANWTQLGEALSY  389

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+PI+ GG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA +TI DPS
Sbjct  390  ACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIKDPS  449



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN++KK TSK  +GTPARPG +IPT IF+LY+ENQK GPGTERH
Sbjct  278  DFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTFIFSLYDENQKTGPGTERH  337

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA  A+L A+  AL Y
Sbjct  338  WGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARGADLLALTSALGY  397

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA +TI +PS
Sbjct  398  ACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTIINPS  457



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 141/190 (74%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D DQIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  289  DYDQIGGNVHNAAIYNRNLAARMVKNPGTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWG  348

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WC+++ AA    N TAV +AL
Sbjct  349  LYYANGTAVYEIDLTGRRPLWSYPPLPAPENNTPYKGPIWCLLSAAASNKLNETAVGNAL  408

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC+ IQPG  CY PN+ + HASYAF+SYW QFR +G TCYFN LA +TI D
Sbjct  409  TYACGQGNGTCDAIQPGKNCYMPNTTVAHASYAFNSYWQQFRKIGATCYFNNLAEQTIKD  468

Query  183  PSYGACKYPS  154
            PS+G+CK+PS
Sbjct  469  PSHGSCKFPS  478



>gb|ACN28576.1| unknown [Zea mays]
Length=335

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 138/190 (73%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +QIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  141  DYNQIGGNVHNAAIYNRNLAARMAKNPGTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWG  200

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N TAV +AL
Sbjct  201  LYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLNETAVGNAL  260

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            SYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN LA +TI D
Sbjct  261  SYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNNLAEQTIKD  320

Query  183  PSYGACKYPS  154
            PS+G+C++PS
Sbjct  321  PSHGSCRFPS  330



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 138/189 (73%), Gaps = 3/189 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D DQIG +  N+A YNRN+  +     GTPARPG  +P  +F+LYNEN KPGPGTERH+G
Sbjct  286  DYDQIGGNARNAAVYNRNLAARMARNPGTPARPGAKMPVFVFSLYNENLKPGPGTERHWG  345

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAVADALS  361
            + YP+GT +Y IDL+G+ P   +PPLP P  N PYKG +WCV+A      N TAV DAL+
Sbjct  346  LYYPDGTEVYQIDLTGRRPLWAYPPLPAPENNTPYKGPIWCVLATHGRKLNETAVGDALT  405

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR +G TCYFN LA +TI DP
Sbjct  406  YACGQGNGTCDAVQPGGECFQPNTGEAHASYAFNSYWQQFRKIGATCYFNNLAEQTIKDP  465

Query  180  SYGACKYPS  154
            S+G+CK+ S
Sbjct  466  SHGSCKFHS  474



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK  ++   GTPARPGVVIPT IF+LY+ENQK GPGTERH
Sbjct  251  DIDEPGANINNAATYNRNLIKKMMAEPPAGTPARPGVVIPTFIFSLYDENQKAGPGTERH  310

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ NG  +Y IDL+ K P S + PLP PT N+PYKGK+WCV    AN+T +  ALS 
Sbjct  311  WGLLHANGDAVYEIDLTEKRPASTYGPLPLPTNNRPYKGKLWCVARIDANVTDLGSALSS  370

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC + N  C+ + PG  C+ P S  RHASYAFS+YWA+FRS G TCYF+GLA +T+ DPS
Sbjct  371  AC-RVNGMCDILMPGRECHEPASTFRHASYAFSAYWARFRSRGATCYFDGLAEQTVGDPS  429

Query  177  YGACKYPSITL  145
             G+CK+PS+TL
Sbjct  430  RGSCKFPSVTL  440



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN++KK TSK  +GTPARPG +IPT IF+LY+ENQK GPGTERH
Sbjct  278  DFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTFIFSLYDENQKTGPGTERH  337

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA  A+L A+  AL Y
Sbjct  338  WGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARGADLLALTSALGY  397

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            ACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA +TI +P
Sbjct  398  ACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTIINP  456



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            DVDQIGA+IYN+A YNRN+++K TS+ GTP RP   + T IF+LYNE+QKPG GTERH+G
Sbjct  282  DVDQIGANIYNAAHYNRNLIRKLTSREGTPMRPNQTMFTYIFSLYNEDQKPGRGTERHWG  341

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC  352
            +LYPNG+ ++ IDL+G+  +SE+ PLP+P  N+ +KGK+WCVV   AN++AV  AL +AC
Sbjct  342  LLYPNGSRVFEIDLNGRKLDSEYEPLPEPVNNEEFKGKIWCVVVHGANVSAVGPALDHAC  401

Query  351  GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  172
             QGN TC+ I+ G  CY PN+++ HASYAF++YW +FR  GGTCYF+GLA +T  DPS  
Sbjct  402  AQGNGTCDAIKSGRECYEPNTIVGHASYAFNAYWQRFRKSGGTCYFDGLAEQTAVDPSEF  461

Query  171  ACKYPS  154
            +  YP+
Sbjct  462  SNLYPT  467



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+++ GA+IYN+ATYNRN++++ T+K  +GTPARPGV I T +F+L++ENQKPGPGTERH
Sbjct  272  DIEETGANIYNAATYNRNLIQRMTAKPPIGTPARPGVPITTFLFSLFDENQKPGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ +GT IY +DL+GK   +++ PL  P  N PYKGKVWCV A  AN   +A AL+Y
Sbjct  332  WGLLHTDGTPIYDLDLTGKKTNTDYAPLQAPKNNVPYKGKVWCVAAEGANEIELAAALTY  391

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC   N TC+ + PG  CY P S+  HASY FS+YWAQF+S G TCYFNGLA +T  DPS
Sbjct  392  ACNVANMTCDALSPGNECYEPVSIPLHASYVFSTYWAQFKSSGATCYFNGLATETTKDPS  451

Query  177  YGACKYPSITL  145
              +CK+PS+ L
Sbjct  452  RNSCKFPSVIL  462



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 145/193 (75%), Gaps = 4/193 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK GPGTERH
Sbjct  285  DIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQKTGPGTERH  344

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ +GT IY IDL+GK    ++ PLP+   N PYKG VWCVVA   N   +  AL+ 
Sbjct  345  WGLLHADGTPIYDIDLAGKRRLEDYEPLPEANNNSPYKGSVWCVVAKGVNNDELGSALTN  404

Query  357  AC--GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
             C  G GN TC+ + PG  CY P S I HASYAFSSYWA+FRS G TCYFNGLA +T  D
Sbjct  405  LCNSGAGNGTCDALSPGKECYEPVSEILHASYAFSSYWAKFRSHGATCYFNGLAEQTTVD  464

Query  183  PSYGACKYPSITL  145
            PS+G+CK+PS+TL
Sbjct  465  PSHGSCKFPSVTL  477



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 4/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D D+IGA+IYN+ATYNRN++++  SK  +GTPARPG+ IPT IF+LY+ENQK GPGTERH
Sbjct  273  DYDEIGANIYNAATYNRNLIRRIVSKPAIGTPARPGLAIPTFIFSLYDENQKEGPGTERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVADALS  361
            +G+L PNG  +Y IDL+G+T ++EF  LP+PT N PY GK+WCVV     N   +  AL 
Sbjct  333  WGMLNPNGRPMYDIDLTGQTLDTEFIDLPQPTNNGPYHGKLWCVVTNDTMNEMDLGQALE  392

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC + N TC+ I PG +CY P S++ HA+YAFSSYWA++R  G TCYFNGLAV+T  DP
Sbjct  393  FAC-RRNETCDDISPGKSCYQPVSIVSHANYAFSSYWAKYREDGETCYFNGLAVQTNVDP  451

Query  180  SYGACKYPSITL  145
            S+G+CK+P ++L
Sbjct  452  SHGSCKFPYVSL  463



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 149/193 (77%), Gaps = 5/193 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D D+IGA+IYN+ATYNRN++++  SK  +GTPARPG+ IPT IF+LY+ENQK GPGTERH
Sbjct  279  DYDEIGANIYNAATYNRNLIRRVVSKPPIGTPARPGLTIPTFIFSLYDENQKEGPGTERH  338

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA--PAANLTAVADAL  364
            +G+L+PNG  +Y IDL+G+T +SEF  LP+PT N P+ GK+WCVV      N   +  AL
Sbjct  339  WGMLHPNGRPMYDIDLTGQTLDSEFIDLPQPTNNGPFHGKLWCVVTNDHTMNEMDLGQAL  398

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
             +AC + N TC+ I PG +CY P S++ HA+YAFSSYWA+++  G TCYFNGLAV+T  D
Sbjct  399  EFAC-RRNETCDEISPGKSCYQPVSIVSHANYAFSSYWAKYKEDGETCYFNGLAVQTNVD  457

Query  183  PSYGACKYPSITL  145
            PS+G+CK+P ++L
Sbjct  458  PSHGSCKFPYVSL  470



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 138/190 (73%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +QIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  285  DYNQIGGNVHNAAIYNRNLAARMAKNPGTPVRPGAKMPVFVFSLYNEDLKPGPGTERHWG  344

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N TAV +AL
Sbjct  345  LYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLNETAVGNAL  404

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            SYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN LA +TI D
Sbjct  405  SYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNNLAEQTIKD  464

Query  183  PSYGACKYPS  154
            PS+G+C++PS
Sbjct  465  PSHGSCRFPS  474



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+++ GA+I+N+ TYNRN++++ T+K  +GTPARPGV IPT IF+L+NENQKPGPGTERH
Sbjct  272  DIEEPGANIFNAPTYNRNLIQRMTTKPPIGTPARPGVTIPTFIFSLFNENQKPGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +GT IY +DL+GK   ++F  LP P  N P+KGKVWCV A  AN   +A ALSY
Sbjct  332  WGLLETDGTPIYDLDLTGKKHITDFASLPAPENNVPFKGKVWCVAAKGANEIELASALSY  391

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC + N TC  + PG  CY P S+  HASY FS++WA+F++ G TCYFNGLA +T  DPS
Sbjct  392  ACNEVNMTCEALSPGNECYEPVSVTDHASYVFSTFWAKFKTTGATCYFNGLAEQTTKDPS  451

Query  177  YGACKYPSITL  145
               CK+PS+T+
Sbjct  452  RPFCKFPSVTI  462



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 135/191 (71%), Gaps = 24/191 (13%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK GPGTERH
Sbjct  272  DYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQKTGPGTERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L+PNGT +Y IDLSGKT   E   LP P  N  YKGK+WCV                
Sbjct  332  FGLLHPNGTQVYGIDLSGKTEYKE--SLPAPENNDLYKGKIWCV----------------  373

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
                GN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI DPS
Sbjct  374  ----GNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIKDPS  429

Query  177  YGACKYPSITL  145
            YG C++PS+TL
Sbjct  430  YGRCEFPSVTL  440



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+IGAS++N+ATYNRN++K+ T+   VGTPARPG+ IPT +F+L++EN+KPGPGTERH
Sbjct  290  DIDEIGASVHNAATYNRNLIKRMTANPPVGTPARPGLSIPTFVFSLFDENRKPGPGTERH  349

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT +Y +D +GK   S + PLP P  N PYKG VWCV    A++ A+ +AL +
Sbjct  350  WGILRPSGTPVYEVDFTGKKQVSGYGPLPAPDNNVPYKGNVWCVANEGADMAALGEALRF  409

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFRS    CYF+GLA +T  +P 
Sbjct  410  ACGRSNDTCQALAPGRECYEPVSVTWHASYAFSSYWAQFRSQNARCYFDGLARETTTNPG  469

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  470  NDRCKFPSVTL  480



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D DQIGA++ N+A YNRN+  +     GTPARPG  +P  +F+LYNEN KPGPGTERH+G
Sbjct  344  DYDQIGANVRNAAVYNRNLAARMARNPGTPARPGARMPVFVFSLYNENLKPGPGTERHWG  403

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + YPNGT +Y +DL+G+ P   +PPLP P  + PYKG++WCV+A  A    N TAV DAL
Sbjct  404  LYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWCVLAAHAGRKLNETAVGDAL  463

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR  G TCYFN LA +TI D
Sbjct  464  TYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNNLAEQTIKD  523

Query  183  PSYGA  169
            PS  A
Sbjct  524  PSKHA  528



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I+N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIDETGANIFNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L PNGT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  AL +
Sbjct  346  WGILNPNGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NEQCKFPSVTL  476



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 143/193 (74%), Gaps = 4/193 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK GPGTERH
Sbjct  260  DIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQKTGPGTERH  319

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ +GT IY IDL+GK    ++ PLP+   N PYKG VWCVVA   N   +  AL+ 
Sbjct  320  WGLLHADGTPIYDIDLTGKRRLEDYKPLPEANNNSPYKGMVWCVVAKGVNNDELDSALNN  379

Query  357  AC--GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
             C    GN TC+ + PG  CY P S I HASYAFSSYWA+F S G TCYF+GLA +T  D
Sbjct  380  LCSSSSGNGTCDALSPGKECYEPVSEILHASYAFSSYWAKFWSHGATCYFDGLAEQTTVD  439

Query  183  PSYGACKYPSITL  145
            PS+G+CK+PS+TL
Sbjct  440  PSHGSCKFPSVTL  452



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQKPG GTERH
Sbjct  288  DIDETGANILNAATYNRNLIKKMTANPPLGTPARPGLPIPTFLFSLFNENQKPGSGTERH  347

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+   +  AL +
Sbjct  348  WGILNPDGTQIYDIDFSGTKPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDF  407

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  408  ACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  467

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  468  NERCKFPSVTL  478



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQKPG GTERH
Sbjct  288  DIDETGANILNAATYNRNLIKKMTANPPLGTPARPGLPIPTFLFSLFNENQKPGSGTERH  347

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+   +  AL +
Sbjct  348  WGILNPDGTQIYEIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDF  407

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  408  ACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  467

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  468  NERCKFPSVTL  478



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+IGA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH
Sbjct  289  DIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +AL  
Sbjct  349  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRM  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P 
Sbjct  409  ACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH
Sbjct  289  DIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN T + +AL  
Sbjct  349  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANETELEEALRM  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P 
Sbjct  409  ACARSNTTCAALAPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK G GT+RH
Sbjct  289  DIDETGANILNAATYNRNLIKKMTANPPIGTPARPGLPIPTFVFSLFNENQKSGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +AL  
Sbjct  349  WGLLHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRL  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGQSNTTCAALAPGRECYEPVSIYWHASYAVSSYWAQFRTQDVRCYFNGLAHETTINPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+IGA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH
Sbjct  284  DIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRH  343

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +AL  
Sbjct  344  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRM  403

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P 
Sbjct  404  ACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPG  463

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  464  NDRCKFPSVTL  474



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 144/192 (75%), Gaps = 4/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN+V++ TS+  +GTPARP   IPT IF+LY+ENQK GPGTERH
Sbjct  250  DYDQIGANIYNAATYNRNLVRRLTSQPLIGTPARPESTIPTFIFSLYDENQKEGPGTERH  309

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVADALS  361
            +G+L PNG  IY IDL+G+  E+EF  LP P  N P+ GK+WCV+A    N   +  AL 
Sbjct  310  WGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQALE  369

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC + +  C+ + PG +CY P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T  DP
Sbjct  370  FACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTVDP  428

Query  180  SYGACKYPSITL  145
            S+G+CK+P ++L
Sbjct  429  SHGSCKFPYVSL  440



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 144/192 (75%), Gaps = 4/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN+V++ TS+  +GTPARP   IPT IF+LY+ENQK GPGTERH
Sbjct  280  DYDQIGANIYNAATYNRNLVRRLTSQPLIGTPARPESTIPTFIFSLYDENQKEGPGTERH  339

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANLTAVADALS  361
            +G+L PNG  IY IDL+G+  E+EF  LP P  N P+ GK+WCV+A    N   +  AL 
Sbjct  340  WGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQALE  399

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC + +  C+ + PG +CY P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T  DP
Sbjct  400  FACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTVDP  458

Query  180  SYGACKYPSITL  145
            S+G+CK+P ++L
Sbjct  459  SHGSCKFPYVSL  470



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 135/189 (71%), Gaps = 3/189 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +QIG +++N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  330  DYEQIGGNVHNAAIYNRNLAARMAKNPGTPARPGAKMPVFVFSLYNEDLKPGPGTERHWG  389

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAVADALS  361
            + Y NGT +YPIDL+G  P   +PPLP P  + PYKG VWCV+A      NLTAV DAL+
Sbjct  390  LYYANGTAVYPIDLTGARPLWSYPPLPPPENDTPYKGPVWCVLADRGGKLNLTAVGDALA  449

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YACGQGN TC  IQPG  C+ PN+   HASYAF+SYW Q R  G TCYFN LA +T  DP
Sbjct  450  YACGQGNGTCATIQPGRECFQPNTTAAHASYAFNSYWQQLRKNGATCYFNNLAEETTKDP  509

Query  180  SYGACKYPS  154
            S+G+CK+ S
Sbjct  510  SHGSCKFHS  518



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 143/192 (74%), Gaps = 4/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D DQIGA+IYN+ATYNRN+V++ TS+  +GTPARPG  IPT IF+LY+ENQK GPGTERH
Sbjct  280  DYDQIGANIYNAATYNRNLVRRLTSQPPIGTPARPGSTIPTFIFSLYDENQKEGPGTERH  339

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANLTAVADALS  361
            +G+L PNG  IY IDL+G+  ESE   LP P  N P+ GK+WCV+A    N   +  AL 
Sbjct  340  WGLLQPNGKAIYDIDLTGEISESELSKLPVPKNNGPFHGKLWCVLAKDIVNEKDLGQALE  399

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            +AC + +  C+ + P  +CY P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T  DP
Sbjct  400  FACKR-DGICDELSPEKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTLDP  458

Query  180  SYGACKYPSITL  145
            S+G+CK+P ++L
Sbjct  459  SHGSCKFPYVSL  470



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 143/192 (74%), Gaps = 3/192 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA+I+N+A YNRN+V+K T+   +GTPA+PGVVIPT IF+LY+EN+K G GTERH
Sbjct  279  DIDQPGANIHNAAIYNRNLVRKVTATPPIGTPAQPGVVIPTFIFSLYDENRKFGRGTERH  338

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L PNG   Y IDL+G   ES +P LP+PT N+P+KGK+WCVVAP + +T +   L+ 
Sbjct  339  WGLLQPNGLPNYEIDLTGVQSESNYPTLPQPTNNKPFKGKIWCVVAPGSRITDLGPVLNS  398

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR-SLGGTCYFNGLAVKTINDP  181
             C + N  C+ + PG  CY P SL+ HASYA SSYWA+ R S G TCYFNG A +T  DP
Sbjct  399  VCKEDNGACDALAPGKECYEPVSLVAHASYALSSYWAKHRDSAGATCYFNGFAEQTTRDP  458

Query  180  SYGACKYPSITL  145
            S+G CK+PS++L
Sbjct  459  SHGPCKFPSVSL  470



>emb|CDY67322.1| BnaA03g57600D [Brassica napus]
Length=221

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NENQKPG GTERH
Sbjct  31   DIDETGANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERH  90

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  91   WGILNPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNF  150

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  151  ACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPG  210

Query  177  YGACKYPSITL  145
               C +PS+TL
Sbjct  211  NEHCTFPSVTL  221



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NENQKPG GTERH
Sbjct  284  DIDETGANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERH  343

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+   +  AL +
Sbjct  344  WGILNPDGTQIYDIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDF  403

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  404  ACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  463

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  464  NERCKFPSVTL  474



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 137/190 (72%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D DQIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ K GPGTERH+G
Sbjct  290  DYDQIGGNVHNAAIYNRNLAARMAKNPGTPLRPGAKMPVFVFSLYNEDLKGGPGTERHWG  349

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADAL  364
            + Y NGT +YPIDL+G+ P   +PPLP    N PYKG +WCV++ AA    N TAV +AL
Sbjct  350  LYYANGTAVYPIDLTGRRPLWSYPPLPALENNTPYKGPIWCVLSAAASKKLNETAVGNAL  409

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC  IQPG  CY PN+ + HASYAF+SYW QFR  G TCYFN LA +TI +
Sbjct  410  AYACGQGNGTCAAIQPGEKCYLPNTTVAHASYAFNSYWQQFRKTGATCYFNNLAEQTIKN  469

Query  183  PSYGACKYPS  154
            PS+G+CK+ S
Sbjct  470  PSHGSCKFRS  479



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH
Sbjct  289  DIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN   + +AL  
Sbjct  349  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEALRM  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  +P 
Sbjct  409  ACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRSQNVQCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK GPGT+RH
Sbjct  288  DIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKSGPGTQRH  347

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+G+ IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + + L  
Sbjct  348  WGILHPDGSPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEETLRM  407

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC Q N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  408  ACAQSNTTCAALAPGRECYEPVSIYWHASYALSSYWAQFRNQSIQCYFNGLAHETTTNPG  467

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  468  NDRCKFPSVTL  478



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 134/190 (71%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +QIG + +N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  288  DYEQIGCNAHNAAIYNRNLAARMARSPGTPARPGAKMPVFVFSLYNEDLKPGPGTERHWG  347

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVADAL  364
            + Y NGT +YP+DL+G  P   +P LP P  + PYKG VWCV+A       N TAV DAL
Sbjct  348  LYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKGPVWCVLAGRRGEKLNETAVGDAL  407

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC+ IQPGG C+ PN+   HASYAF+SYW Q R  G TCYFN LA +T  D
Sbjct  408  AYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSYWQQLRKTGATCYFNNLAEETTKD  467

Query  183  PSYGACKYPS  154
            PS+G+CK+ S
Sbjct  468  PSHGSCKFHS  477



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 134/190 (71%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +QIG + +N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPGPGTERH+G
Sbjct  285  DYEQIGCNAHNAAIYNRNLAARMARSPGTPARPGAKMPVFVFSLYNEDLKPGPGTERHWG  344

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTAVADAL  364
            + Y NGT +YP+DL+G  P   +P LP P  + PYKG VWCV+A       N TAV DAL
Sbjct  345  LYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKGPVWCVLAGRRGEKLNETAVGDAL  404

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACGQGN TC+ IQPGG C+ PN+   HASYAF+SYW Q R  G TCYFN LA +T  D
Sbjct  405  AYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSYWQQLRKTGATCYFNNLAEETTKD  464

Query  183  PSYGACKYPS  154
            PS+G+CK+ S
Sbjct  465  PSHGSCKFHS  474



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I+N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NEN+KPG GTERH
Sbjct  286  DIDETGANIFNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENRKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  AL +
Sbjct  346  WGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NEQCKFPSVTL  476



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I+N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NEN+KPG GTERH
Sbjct  286  DIDETGANIFNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENRKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  AL +
Sbjct  346  WGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NEQCKFPSVTL  476



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK GPGTERH
Sbjct  275  DIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQKTGPGTERH  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP--AANLTAVADAL  364
            +G+L+ +GT IY +DL+GK P  ++ PLP+   N+PYKG VWCVVA   + N   +  A+
Sbjct  335  WGLLHADGTPIYDVDLTGKRPLEDYEPLPEEQNNRPYKGAVWCVVAKGVSVNDEELGSAV  394

Query  363  SYACGQGNR--TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            + AC  GN   TC+ + PG  CY P SL  HASYAFSSYWA+FRS G TC+FNGLA +T 
Sbjct  395  NNACIAGNATGTCDALSPGKECYEPVSLTWHASYAFSSYWAKFRSQGATCHFNGLAEQTS  454

Query  189  NDPSYGACKYPSITL  145
             DPS+G+CK+PS+  
Sbjct  455  LDPSHGSCKFPSVIF  469



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA++ N+ATYNRN+VK+ T+K  VGTPARPGVVIPT IFAL++ENQKPG GTERH
Sbjct  277  DIEQPGANLLNAATYNRNLVKRITAKPTVGTPARPGVVIPTFIFALFDENQKPGSGTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L  +  A+  
Sbjct  337  WGLLRSDGSPNYQIDLTGKESSVEYDPLPVVENNAPFRGRLWCVAARGVDLMELEAAVDD  396

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA +T  DPS
Sbjct  397  VCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTVDPS  456

Query  177  YGACKYPSITL  145
             G+C++PS+T 
Sbjct  457  NGSCRFPSVTF  467



>gb|EMT13087.1| Putative glucan endo-1,3-beta-glucosidase A6 [Aegilops tauschii]
Length=362

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 129/179 (72%), Gaps = 4/179 (2%)
 Frame = -3

Query  705  DQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVL  526
            DQ+GA++ N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPGPGTERH+G+ 
Sbjct  146  DQVGANVRNAAVYNRNLAARMARNPGTPARPGARMPVFVFSLYNEDLKPGPGTERHWGLY  205

Query  525  YPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTAVADALSY  358
            Y NGT +YP+DL+G+ P   +PPLP    + PYKG +WCV+A  A    N TAV DAL+Y
Sbjct  206  YANGTAVYPVDLTGRRPLWAYPPLPAADNDTPYKGPIWCVLAAHAGRKLNETAVGDALTY  265

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            ACGQGN TC  IQPGG C+ PN+   HASYAF+SYW QFR  G TCYFN LA +TI DP
Sbjct  266  ACGQGNGTCGAIQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNNLAEQTIKDP  324



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQKPG GT+RH
Sbjct  289  DIDETGANVLNAATYNRNLIKKMTASPPIGTPARPGLPIPTFVFSLFNENQKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +GVL+P+GT IY ID +G+   + F PLPKPT N PYKG+VWCV    AN T + + L  
Sbjct  349  WGVLHPDGTPIYDIDFTGQKNLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEETLRI  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAQFRNESIQCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>gb|KJB37880.1| hypothetical protein B456_006G224700 [Gossypium raimondii]
Length=462

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 138/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ+GA+IYN+ATYNRN+++K TSK  +G+P  PG++IPT I +LY+EN+K GP TERH
Sbjct  272  DIDQVGANIYNAATYNRNLIRKMTSKQPLGSPKSPGLIIPTFISSLYDENRKIGPETERH  331

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+ NGT +Y IDL+G    SE+ PLP    N PYKGK+WC VAP  N  ++  ALS 
Sbjct  332  WGMLHTNGTPVYEIDLTGNRKISEYKPLPPAVNNVPYKGKLWCEVAPWVNEMSLPAALSN  391

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             C   N TC  + PG  CY P S++ HASYAFSSYWA+FRS G  C FNGLA +T  DPS
Sbjct  392  VCSIDNETCAALAPGKDCYEPVSVVWHASYAFSSYWAKFRSQGAICSFNGLARETTVDPS  451

Query  177  YGACKYPSITL  145
             G C +PS+T+
Sbjct  452  RGRCNFPSVTV  462



>emb|CDP15107.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 137/189 (72%), Gaps = 2/189 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA+ YN+ATYNRN+V++ +++  +GTPARP V IPT I+AL++E+Q PG GT RH
Sbjct  140  DIDQPGANRYNAATYNRNLVRRMSAEPPIGTPARPSVFIPTFIYALFDEDQIPGRGTARH  199

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            FG+L  N   +Y +DL+GK  E ++PPLP P+ N+P+KG +WCVVA  AN+  +   L  
Sbjct  200  FGILQANSWPVYDLDLTGKLGEGDYPPLPLPSNNEPFKGNLWCVVASEANIMELVPQLES  259

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             C  GN  C+ + PG  CY P ++  HASYAFSSYW +FRS G  C+FNGLAV +  DPS
Sbjct  260  VCSLGNGICDALSPGNDCYEPVTIRAHASYAFSSYWVKFRSRGAACHFNGLAVLSTTDPS  319

Query  177  YGACKYPSI  151
            +G+CK+PS+
Sbjct  320  HGSCKFPSV  328



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQKPG GT+RH
Sbjct  289  DIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN   + D L  
Sbjct  349  WGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEDTLRT  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA++ N+ATYNRN+++K T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  284  DIDETGANVLNAATYNRNLIRKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERH  343

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P + F  LPKP+ N P+KG VWCVVA  A+   +  AL++
Sbjct  344  WGILNPDGTPIYEIDFSGTRPVNSFGSLPKPSNNVPFKGNVWCVVAEGASEAELGQALNF  403

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  404  ACGESNATCAALAPGRECYEPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPG  463

Query  177  YGACKYPSITL  145
               CK+PS+T+
Sbjct  464  NERCKFPSVTM  474



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I+N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQKPG GT+RH
Sbjct  289  DIDETGANIFNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN   + + L  
Sbjct  349  WGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEETLRT  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARP + IPT +F+L+NENQK G GT+RH
Sbjct  289  DIDETGANILNAATYNRNLIKKMTAIPPIGTPARPALPIPTFVFSLFNENQKSGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN   + +AL  
Sbjct  349  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEALRI  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY+P S+  HASYA SSYWAQFR+    CYFNGLA ++  +P 
Sbjct  409  ACGRSNTTCAALAPGKECYDPVSIYWHASYAVSSYWAQFRTQNVGCYFNGLAHESTINPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 145/195 (74%), Gaps = 6/195 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK GPGTERH
Sbjct  275  DIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQKTGPGTERH  334

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP--AANLTAVADAL  364
            +G+L+ +GT IY +DL+GK    ++ PLP+   N+PYKG VWCVVA   + N   +  A+
Sbjct  335  WGLLHADGTPIYDVDLTGKRVLEDYEPLPEEQNNRPYKGAVWCVVAKGVSVNDEELGSAV  394

Query  363  SYACGQGNR--TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            + AC  GN   TC+ + PG  CY P SL  HAS+AFSSYWA+FRS G TC+FNGLA +T 
Sbjct  395  NNACIAGNASGTCDALSPGKECYEPVSLTWHASFAFSSYWAKFRSQGATCHFNGLAEQTS  454

Query  189  NDPSYGACKYPSITL  145
             DPS+G+CK+PS+  
Sbjct  455  LDPSHGSCKFPSVIF  469



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 138/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQKPG GT+RH
Sbjct  289  DIDETGANILNAATYNRNLIKKMTTSPPIGTPSRPGLPIPTFVFSLFNENQKPGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN   + + L  
Sbjct  349  WGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEETLRT  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA++ N+ATYNRN+VK+ T+K  VGTPARP VVIPT IF+L++ENQKPG GTERH
Sbjct  271  DMEQPGANLLNAATYNRNLVKRITAKPTVGTPARPKVVIPTFIFSLFDENQKPGSGTERH  330

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L  +   +  
Sbjct  331  WGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLWCVAARGVDLMELGATVDD  390

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA +T  DPS
Sbjct  391  VCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTTDPS  450

Query  177  YGACKYPSITL  145
             G+C++PS+T 
Sbjct  451  NGSCRFPSVTF  461



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK ++   +GTP+RPG+ IPT +F+L+NENQK G GT+RH
Sbjct  288  DIDETGANILNAATYNRNLIKKMSASPPIGTPSRPGLPIPTFVFSLFNENQKSGSGTQRH  347

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+G+ IY +D +G+TP + F PLPKPT N PYKG+VWCV    AN T + + L  
Sbjct  348  WGILHPDGSPIYDVDFTGQTPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEETLRM  407

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC Q N TC  + PG  CY P S+  HASYA +SYWAQFR+    C+FNGLA +T  +P 
Sbjct  408  ACAQSNTTCAALAPGRECYEPVSIYWHASYALNSYWAQFRNQSIQCFFNGLAHETTTNPG  467

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  468  NDRCKFPSVTL  478



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 141/191 (74%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D D+ GA+ YN+ATY  N+V K TS   +GTPA+PG+ IPT +F+LY+ENQKPGPGTERH
Sbjct  282  DFDEPGANAYNAATYVSNLVAKVTSDPPIGTPAKPGIEIPTFVFSLYDENQKPGPGTERH  341

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L   G+ IY +DL+G + E+    L +P+ N PY GK+WCVVA  A+   +  AL +
Sbjct  342  WGLLSNTGSPIYEVDLTGTSHENN-TKLSEPSNNGPYNGKIWCVVASTASPDDLGPALEF  400

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC+ + PG  CY P S++ HASYAFSS+WAQFRS G +CYF GLAV+TI DP 
Sbjct  401  ACRQGNGTCDQLAPGKECYEPISIVSHASYAFSSFWAQFRSAGASCYFGGLAVQTITDPG  460

Query  177  YGACKYPSITL  145
            +G+C++PS+ L
Sbjct  461  HGSCEFPSVLL  471



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NENQKPG GTERH
Sbjct  290  DIDETGANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERH  349

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  350  WGILKPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNF  409

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  410  ACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPG  469

Query  177  YGACKYPSITL  145
               C +PS+TL
Sbjct  470  NEHCTFPSVTL  480



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 137/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK G GT+RH
Sbjct  289  DIDETGANILNAATYNRNLIKKMTAIPPIGTPARPGLPIPTFVFSLFNENQKSGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG++WCV    A    + +AL  
Sbjct  349  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEAELEEALRM  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HA YA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG+   S F  LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  346  WGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 133/191 (70%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTP RPG  IPT +F+L+NENQKPG GTERH
Sbjct  290  DIDETGANILNAATYNRNLIKKMTANPPIGTPVRPGSPIPTFLFSLFNENQKPGSGTERH  349

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  350  WGILNPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNF  409

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  410  ACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPG  469

Query  177  YGACKYPSITL  145
               C +PS+TL
Sbjct  470  NEHCTFPSVTL  480



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG+   S F  LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  346  WGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -3

Query  657  VVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSG  484
            ++   T+K  VGTPARPG+ IPT IFALYNENQK GPGTERH+G+L  NG  +Y +DL+G
Sbjct  204  MLDSMTAKPAVGTPARPGMTIPTFIFALYNENQKRGPGTERHWGLLDCNGKPVYGVDLTG  263

Query  483  KTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  304
            +  ES    LP P  N+PY+GK+WCVVA   N   +  AL YAC QGN TC+ + PG  C
Sbjct  264  EL-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPEQLVSALIYACSQGNGTCDALMPGKEC  322

Query  303  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  145
            Y P SL+ HASYAFSSYWA+FRSLG  CYFNGLAV+T  DPS G+CK+P++TL
Sbjct  323  YEPFSLLSHASYAFSSYWAKFRSLGANCYFNGLAVQTTEDPSRGSCKFPTVTL  375



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ +IGA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIHEIGANILNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG    S F  LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  346  WGILNPDGTPIYDIDFSGTRSVSSFGTLPKPSNNVPFKGNVWCVAVDGADEAELGLALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRNNETCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTINPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 136/192 (71%), Gaps = 10/192 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  + GA++ N+ATYNRN+  + +   GTPARPG  +P  +F+LYNE+QKPGPGTERH+G
Sbjct  199  DAGESGANVRNAATYNRNLAARMSKNPGTPARPGAKMPVFLFSLYNEDQKPGPGTERHWG  258

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLP--KPTTNQPYKGKVWCVVA----PAANLTAVAD  370
            + YPN T +Y +DL+G+ P   +PPLP    T + P     WCV+A     AAN TAV  
Sbjct  259  LYYPNQTRVYEVDLTGQRPSRSYPPLPPAGDTDSSP----AWCVLASGEGKAANETAVQA  314

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
            AL YAC QG+ TC  IQPGGAC+ P++L  HASYAF+SYW QFR+ GGTC+FNGLA  T 
Sbjct  315  ALEYACQQGSGTCAAIQPGGACHEPDTLDAHASYAFNSYWQQFRNAGGTCFFNGLAEATT  374

Query  189  NDPSYGACKYPS  154
             DPS+G+CK+ S
Sbjct  375  KDPSHGSCKFQS  386



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 137/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NEN+K G GT+RH
Sbjct  289  DIDETGANILNAATYNRNLIKKMTAIPPIGTPARPGLPIPTFVFSLFNENKKSGSGTQRH  348

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG++WCV    A    + +AL  
Sbjct  349  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEAELEEALRM  408

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HA YA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  409  ACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLAHETTTNPG  468

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  469  NDRCKFPSVTL  479



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 138/189 (73%), Gaps = 5/189 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  Q GA++ N+A YNR++ ++  + VGTPARP   +P  +F+LYNEN KPG GTERH+G
Sbjct  283  DPGQAGANVRNAALYNRHLARRMHNNVGTPARPRSNMPVFVFSLYNENLKPGAGTERHWG  342

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPA---ANLTAVADALS  361
            + YPNGT +Y IDL+G+     +PPLP P  N+  K + WCV+A      N TAVADAL+
Sbjct  343  MFYPNGTWVYQIDLTGRRTARSYPPLPPPD-NKTAKLE-WCVLAGGGKPVNETAVADALN  400

Query  360  YACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
            YAC QG  TC  IQPGGACY PN+L  HASYAF++YW QF+  GG+CYFNGLAVKT  DP
Sbjct  401  YACQQGTGTCAAIQPGGACYEPNTLDAHASYAFNAYWQQFKGTGGSCYFNGLAVKTNKDP  460

Query  180  SYGACKYPS  154
            SYG+CK+PS
Sbjct  461  SYGSCKFPS  469



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 135/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG    S F  LPKP+ N P+KG VWCV    A+   +  AL++
Sbjct  346  WGILNPDGTPIYDIDFSGTRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK G GT+RH
Sbjct  288  DIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQKSGSGTQRH  347

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN++ + + L  
Sbjct  348  WGILHPDGIPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVDGANVSELEETLRT  407

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             C + N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  +P 
Sbjct  408  TCSRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVQCYFNGLAHETTTNPG  467

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  468  NDRCKFPSVTL  478



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA++ N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIHETGANVLNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID +G  P S F  LPKP  N P+KG VWCV    A+   +  AL++
Sbjct  346  WGILNPDGTPIYEIDFTGTRPVSSFGELPKPDNNVPFKGNVWCVAIDGASEAELGQALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNETCAALAPGKECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 135/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA++ N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  284  DIDETGANVPNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERH  343

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT IY ID SG    + F  +PKP+ N P+KG VWCVV   A+   +  AL +
Sbjct  344  WGILNPDGTRIYEIDFSGTRQVNSFGSMPKPSNNVPFKGNVWCVVVEGASEAELGQALEF  403

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  404  ACGRSNVTCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPG  463

Query  177  YGACKYPSITL  145
               CK+PS++L
Sbjct  464  NERCKFPSVSL  474



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+IGAS+ N+ATYNRN++KK T+   +GTPARPG VIPT +F+L++EN+KPGPGTERH
Sbjct  294  DIDEIGASVRNAATYNRNLIKKMTADPPIGTPARPGSVIPTFVFSLFDENRKPGPGTERH  353

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP-----YKGKVWCVVAPAANLTAVA  373
            +G+L P+GT +Y ID +G+ P S + P  KP           K + WCVV   A++ A+ 
Sbjct  354  WGILRPSGTPVYEIDFTGRKPVSGYGPPAKPGNGGVGVAPCKKRRAWCVVKEGADVAALG  413

Query  372  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  193
             AL +ACG+ N TC+ + PG  CY P ++  HASYAFSSYWAQFRS    CYFNGLA +T
Sbjct  414  QALGFACGRSNETCSALAPGRECYQPVTITWHASYAFSSYWAQFRSQNARCYFNGLARET  473

Query  192  INDPSYGACKYPSITL  145
              DP  G CK+PS+ L
Sbjct  474  TVDPGNGRCKFPSVAL  489



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L++E+QK G GT+RH
Sbjct  290  DIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLAIPTFVFSLFDEDQKSGSGTQRH  349

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG VWCV    A+   + +AL  
Sbjct  350  YGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEAQLEEALRM  409

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA  T  +P 
Sbjct  410  ACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTVNPG  469

Query  177  YGACKYPSITL  145
               CK+P +TL
Sbjct  470  NDRCKFPGVTL  480



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 135/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L++ENQK G GT+RH
Sbjct  290  DIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLAIPTFVFSLFDENQKSGSGTQRH  349

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKP  N PYKG VWCV    A+   + +AL  
Sbjct  350  YGILHPDGTPIYDIDFTGEKPLTGFNPLPKPKNNVPYKGIVWCVPVEGASEAQLEEALRM  409

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA  T  +P 
Sbjct  410  ACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTINPG  469

Query  177  YGACKYPSITL  145
               CK+P +TL
Sbjct  470  NDRCKFPGVTL  480



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DIHETGANILNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A    +  AL++
Sbjct  346  WGILDHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  406  ACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L++E+QK G GT+RH
Sbjct  290  DIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLSIPTFVFSLFDEDQKSGSGTQRH  349

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG VWCV    A+   + +AL  
Sbjct  350  YGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEAQLEEALRM  409

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA  T  +P 
Sbjct  410  ACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTVNPG  469

Query  177  YGACKYPSITL  145
               CK+P +TL
Sbjct  470  NDRCKFPGVTL  480



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DILETGANILNAATYNRNLIKKLTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A    +  AL++
Sbjct  346  WGILNHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGSVWCVAVDGAGEAELGQALNF  405

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGL+ +T  +P 
Sbjct  406  ACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLSRETTTNPG  465

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  466  NERCKFPSVTL  476



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 137/187 (73%), Gaps = 4/187 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q+GA+I+N+A YNR ++++  +   +GTP RP   IPT IF+L+NENQK G GTERH
Sbjct  276  DLNQLGANIFNAAHYNRRIIRRMLADPPLGTPRRPNQFIPTYIFSLFNENQKTGLGTERH  335

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+LYPNG+ +Y IDL+G+  +SE+ P   P    PYKGK+WCVV   AN++A+  A++Y
Sbjct  336  WGLLYPNGSRLYEIDLTGELQDSEYKP--LPPPPPPYKGKLWCVVDANANVSALPSAITY  393

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            AC QGN TC  IQPG  CY PN++I HASYAF+SYW QF++ GGTCYFNG A     DPS
Sbjct  394  ACSQGNNTCVAIQPGKPCYQPNTVIDHASYAFNSYWQQFKNSGGTCYFNGAATLVTKDPS  453

Query  177  YGACKYP  157
               C+YP
Sbjct  454  SKICRYP  460



>ref|NP_001168659.1| uncharacterized protein LOC100382447 [Zea mays]
 gb|ACN29077.1| unknown [Zea mays]
Length=384

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 136/188 (72%), Gaps = 11/188 (6%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  + GA++ N+ATYNRN+  + ++  GTPARPG  +P  +F+LYNE++KPGPG+ERH+G
Sbjct  199  DAGEAGANVRNAATYNRNLALRMSNSPGTPARPGAEVPVFLFSLYNEDRKPGPGSERHWG  258

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP----AANLTAVADAL  364
            + YPNG+ +Y +DL+G+   S +PPLP   +        WCV+A     AAN TAV+ A+
Sbjct  259  LYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAANETAVSAAV  311

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YAC  G+RTC  IQPGGAC+ P++L  HASYAF++YW QFRS GGTC+F+GLA  T  D
Sbjct  312  AYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAETTTED  371

Query  183  PSYGACKY  160
            PS+G CK+
Sbjct  372  PSHGLCKF  379



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 4/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQKPG GTERH
Sbjct  286  DILETGANILNAATYNRNLIKKLTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERH  345

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A    +  AL++
Sbjct  346  WGILNHDGTPIYEIDFSGTI--SSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQALNF  403

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  +P 
Sbjct  404  ACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPG  463

Query  177  YGACKYPSITL  145
               CK+PS+TL
Sbjct  464  NERCKFPSVTL  474



>ref|XP_008669802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Zea 
mays]
 tpg|DAA38972.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=472

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 138/193 (72%), Gaps = 4/193 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D+DQ GA++ N+ATYNRN+ ++  S  GTP RPGV +P ++FAL+NE+ K GP TERH+G
Sbjct  279  DLDQFGANVRNAATYNRNLARRLASGAGTPRRPGVPVPAMVFALFNEDLKWGPDTERHWG  338

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTAVADALSYA  355
            + YPNG+ +Y +DL+G+ P + +PPLP  T +QPY+G +WCVV  A  N TAV + ++  
Sbjct  339  LFYPNGSAVYEVDLTGRRPLASYPPLPPATNDQPYRGPLWCVVRTAGINETAVREQVAAV  398

Query  354  CGQG---NRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            C      +  C+P++PGGAC+ PN++  HASY FS++W +F    G CYF+G  ++T  D
Sbjct  399  CDDDEAEDALCDPVRPGGACFLPNTVAAHASYVFSAHWNRFSEDYGACYFDGWGMETTID  458

Query  183  PSYGACKYPSITL  145
            PS+G+CK+PSI L
Sbjct  459  PSHGSCKFPSIHL  471



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA++YN+A YNRN+V+K  +   +GTPARPG +IPT +F+LYNE+ K GP TERH
Sbjct  284  DLDQPGANVYNAAIYNRNLVQKVLADPPLGTPARPGTIIPTFLFSLYNEDLKDGPKTERH  343

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L P+GT +YPIDL+G   ++ F PL +P  N  YKGKVWCVV   AN+T +  AL  
Sbjct  344  WGLLKPDGTPVYPIDLTGA--QTNFGPLRQPENNMGYKGKVWCVVDKMANITELGPALRR  401

Query  357  ACGQGNRTCN-PIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDP  181
             C + N TC   + PG  CY P S++ HAS+AF++YWA+FR  G  CYF GLA  T  +P
Sbjct  402  TCSRLNETCELSLGPGKHCYEPVSVVWHASFAFNAYWAKFRDSGEICYFGGLASLTTRNP  461

Query  180  SYGACKYPSITL  145
            S+G+C +PS+T+
Sbjct  462  SHGSCHFPSVTI  473



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 136/188 (72%), Gaps = 11/188 (6%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  + GA++ N+ATYNRN+  + ++  GTPARPG  +P  +F+LYNE++KPGPG+ERH+G
Sbjct  297  DAGEAGANVRNAATYNRNLALRMSNSPGTPARPGAEVPVFLFSLYNEDRKPGPGSERHWG  356

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP----AANLTAVADAL  364
            + YPNG+ +Y +DL+G+   S +PPLP   +        WCV+A     AAN TAV+ A+
Sbjct  357  LYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAANETAVSAAV  409

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YAC  G+RTC  IQPGGAC+ P++L  HASYAF++YW QFRS GGTC+F+GLA  T  D
Sbjct  410  AYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAETTTED  469

Query  183  PSYGACKY  160
            PS+G CK+
Sbjct  470  PSHGLCKF  477



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D++Q GA++ N+ATYNRN+VK+ T+K  VGTPARP VVIPT IF+L++ENQKPG GTERH
Sbjct  277  DMEQPGANLLNAATYNRNLVKRITAKPTVGTPARPKVVIPTFIFSLFDENQKPGSGTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L  +   +  
Sbjct  337  WGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLWCVAARGVDLMELGATVDD  396

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
             CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA +T  DP+
Sbjct  397  VCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTTDPN  456



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 136/190 (72%), Gaps = 3/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVV-IPTLIFALYNENQKPGPGTERHF  535
            D+DQ GA++ N+ATYNRNV +   S  GTP RPG++ +P  +FAL+NE+ K GPGTERH+
Sbjct  281  DLDQFGANVRNAATYNRNVARHLASGAGTPRRPGMMRMPAFVFALFNEDLKGGPGTERHW  340

Query  534  GVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            G+ YPN + +Y +DLSG+ T  S +PPLP  T + PY GK+WC+    AN TAV + ++ 
Sbjct  341  GLFYPNSSAVYEVDLSGRRTAASSYPPLPPATNDAPYPGKLWCMTKKLANGTAVREQVAA  400

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF-RSLGGTCYFNGLAVKTINDP  181
            AC      C+P++PGG C+ P+++  HASY FS++W +F +  GG CYF GLAV+T  DP
Sbjct  401  ACKDEAALCDPVRPGGRCHLPDTVAAHASYVFSAHWNRFSKQYGGWCYFAGLAVETTIDP  460

Query  180  SYGACKYPSI  151
            S+G+C+YPS+
Sbjct  461  SHGSCRYPSV  470



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+IGA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH
Sbjct  236  DIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRH  295

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +AL  
Sbjct  296  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEALRM  355

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  235
            AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS
Sbjct  356  ACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRS  396



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+D+ GA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+KPG GT+RH
Sbjct  236  DIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQRH  295

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN   + +AL  
Sbjct  296  WGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEALRM  355

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  235
            AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS
Sbjct  356  ACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRS  396



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 136/191 (71%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D+DQ GA+  N+ATYNRN+ +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G
Sbjct  282  DLDQFGANARNAATYNRNMARHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWG  341

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSY  358
            + +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN TAV + +  
Sbjct  342  LFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEA  401

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDP  181
            AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GLA++T  DP
Sbjct  402  ACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDP  461

Query  180  SYGACKYPSIT  148
            S+G+CK+PS+T
Sbjct  462  SHGSCKFPSVT  472



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 136/191 (71%), Gaps = 3/191 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D+DQ GA+  N+ATYNRN+ +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G
Sbjct  282  DLDQFGANARNAATYNRNMARHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWG  341

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSY  358
            + +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN TAV + +  
Sbjct  342  LFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEA  401

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDP  181
            AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GLA++T  DP
Sbjct  402  ACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDP  461

Query  180  SYGACKYPSIT  148
            S+G+CK+PS+T
Sbjct  462  SHGSCKFPSVT  472



>ref|XP_001777261.1| predicted protein [Physcomitrella patens]
 gb|EDQ57916.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 131/200 (66%), Gaps = 14/200 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKF--TSKVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +Q+G ++ N+ATYNR +V+K   TSKVGTP +PGV IPT IFAL+NENQK G GTE+H
Sbjct  253  DANQLGCNLANAATYNRRLVRKMVSTSKVGTPLKPGVYIPTFIFALFNENQKTGQGTEKH  312

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPK------------PTTNQPYKGKVWCVVAPA  394
            +G+LYPNGTN+Y ID++G   + ++ PL              P  N P     WCV  P 
Sbjct  313  WGLLYPNGTNVYSIDMTGTLSDGQYTPLSDNPIFTTAPPPTLPPGNVPSTTGTWCVAKPG  372

Query  393  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  214
             N   +  AL +ACG G   C P+Q GG+CYNP++++ H+SYAF+SY+ + ++ GG+C F
Sbjct  373  MNPPMLQAALDFACGPGGADCQPLQVGGSCYNPDTILDHSSYAFNSYYQRTKAAGGSCNF  432

Query  213  NGLAVKTINDPSYGACKYPS  154
             G A  T  DPS+  CK+P+
Sbjct  433  GGAATLTTTDPSHDTCKFPT  452



>emb|CAK18899.1| glucan 1,3-beta glucosidase [Cocos nucifera]
Length=179

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  552  GTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLT  382
            GTERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV      + N T
Sbjct  4    GTERHWGLLYPNATRVYEVDLTGRLPDAGYGPLPPPGNNKPYKGKIWCVFGRRGKSVNAT  63

Query  381  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  202
            AV  A+SYACGQG  TC+ IQPGG CY P+SL  HASYAF+SYW QFR  GGTCYFNGLA
Sbjct  64   AVGSAISYACGQGKGTCDAIQPGGPCYRPDSLTAHASYAFNSYWQQFRRSGGTCYFNGLA  123

Query  201  VKTINDPSYGACKYPSI  151
            V+   DPSYG+CK+PSI
Sbjct  124  VQAAQDPSYGSCKFPSI  140



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 21/172 (12%)
 Frame = -3

Query  654  VKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGK  481
            +KK T++  VGTPARP   +   IFAL+NENQKPGP TERHFG+LYPNG+ +Y IDL GK
Sbjct  266  IKKLTARPPVGTPARPRRAMQGFIFALFNENQKPGPTTERHFGLLYPNGSKVYQIDLRGK  325

Query  480  TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACY  301
            T  S + PLP+PT N+ YKG ++                   C QGN TC  I+PG AC+
Sbjct  326  TTSSGYEPLPEPTNNKQYKGPMY-------------------CSQGNNTCEAIRPGKACH  366

Query  300  NPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  145
            NP+  + HA+YAFSSYWA+FR+ G +C+ NGLA +TI DPS+G+CK+PS+ L
Sbjct  367  NPDLSLFHANYAFSSYWAEFRNSGASCFLNGLATQTIKDPSHGSCKFPSVAL  418



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 136/190 (72%), Gaps = 10/190 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  + GA++ N+ATYNRN+  + +   GTPARPG  +P  +F+LYNE+QKPG G+ERH+G
Sbjct  298  DAGEAGANVRNAATYNRNLAARMSKNPGTPARPGAKVPVFLFSLYNEDQKPGAGSERHWG  357

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLP--KPTTNQPYKGKVWCVVAP--AANLTAVADAL  364
            + YPNG+ +Y +DL+G+   S +PPLP    T + P     WCV+    AAN TAVA A+
Sbjct  358  LYYPNGSRVYEVDLTGR--RSSYPPLPPADDTDSAP----AWCVLGSKAAANETAVAAAV  411

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YAC QG+ TC  IQPGGAC+ P+ +  HASYAF++YW QFR  GGTC+F+GLAV T  D
Sbjct  412  AYACQQGSGTCAAIQPGGACHEPDMMDAHASYAFNAYWQQFRGAGGTCFFDGLAVTTTKD  471

Query  183  PSYGACKYPS  154
            PS+G+CK+ S
Sbjct  472  PSHGSCKFAS  481



>dbj|BAE80092.1| glycosyl hydrolase family 17 [Silene latifolia]
Length=439

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA++YN+ATYNRN++KK  ++  +GTPARPG +IP  +F+LY+EN K GP TERH
Sbjct  273  DLDQPGANVYNAATYNRNLIKKIVAEPPLGTPARPGTIIPAFLFSLYDENLKDGPETERH  332

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G++ PNGT +Y IDL+G   ++EF PLP  T N PYKG+VWCVV  +AN+T +   ++ 
Sbjct  333  WGLVKPNGTPVYQIDLTGT--QTEFDPLPNATNNMPYKGEVWCVVQRSANMTELGSMVTN  390

Query  357  ACGQGNRTCN-PIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  214
             C + N TC   I PG  CY P S++ HASY FS+YWAQFR  G  C F
Sbjct  391  LCSRLNGTCEAAIGPGNDCYQPVSILWHASYTFSAYWAQFRRHGTYCQF  439



>ref|XP_001780045.1| predicted protein [Physcomitrella patens]
 gb|EDQ55148.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 128/199 (64%), Gaps = 14/199 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +Q G ++ N+ATYNR +V+K  S   VGTP RPGV IPT IFAL+NE+QK G GTE+H
Sbjct  253  DANQAGCNLANAATYNRRLVRKMVSPTNVGTPMRPGVYIPTFIFALFNEDQKTGQGTEKH  312

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPL---------PKPTTN---QPYKGKVWCVVAPA  394
            +G+LYPNGTN+Y ID++G   + ++ PL         P PT +    P     WCV    
Sbjct  313  WGLLYPNGTNVYSIDMTGMLSDGQYSPLSDNPVFTSAPPPTFSPGLVPSTSGTWCVAKSG  372

Query  393  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  214
                 +  AL +ACG G   C P+Q GG+C+NPN++  H+SYAF+SY+ + ++ GG+C F
Sbjct  373  IGQEMLQGALDFACGAGGADCQPLQAGGSCFNPNTIHDHSSYAFNSYYQKTKAAGGSCNF  432

Query  213  NGLAVKTINDPSYGACKYP  157
             G A+ +  DPS+G CK+P
Sbjct  433  GGAAMLSTTDPSHGTCKFP  451



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 123/185 (66%), Gaps = 6/185 (3%)
 Frame = -3

Query  696  GASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPN  517
            GAS+ N+A YNRN+  +  +  GTP RPG  +P  +F+LYNE++KPG GTERH+G+ YPN
Sbjct  297  GASVGNAAIYNRNLAARMATSPGTPLRPGEKMPVFVFSLYNEDKKPGAGTERHWGLFYPN  356

Query  516  GTNIYPIDLSGK------TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYA  355
            GT +Y +DL G+       P     P P    + P +  +WCV+ P  +  AVA AL+YA
Sbjct  357  GTAVYQVDLGGRRRSYPPLPSPPPSPSPSTPPSPPAEQGLWCVLLPGKDEKAVAAALNYA  416

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CGQG+ TC  IQPG  C+ PN+L  HASYAF+SYW QFR  G +C FNGLA  T  DPS+
Sbjct  417  CGQGSGTCAAIQPGAVCFEPNTLDAHASYAFNSYWQQFRKSGASCSFNGLATTTTTDPSH  476

Query  174  GACKY  160
            G+CK+
Sbjct  477  GSCKF  481


 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  417  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  238
            VWCV+AP  +  AV  AL+YACGQG  TC  IQPGGAC+ PN+L  HASYAF+SYW QFR
Sbjct  500  VWCVLAPGKDEKAVEAALNYACGQGQGTCAAIQPGGACFEPNTLDAHASYAFNSYWQQFR  559

Query  237  SLGGTCYFNGLAVKTINDPSYGACKYPS  154
              GG+C FNGLAV T  DPS+G+CK+PS
Sbjct  560  KTGGSCSFNGLAVTTTADPSHGSCKFPS  587



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D+DQ GA+IYN+ATYNRN++KK T+K  +GTPARPGVVIPT IF+LYNEN+K GPGTERH
Sbjct  277  DLDQPGANIYNAATYNRNLIKKMTAKPPIGTPARPGVVIPTFIFSLYNENRKTGPGTERH  336

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L  NGT IY IDLSGK  +SE+  LP+P  N+PYKGK+WC+ A  A+LT +  A+++
Sbjct  337  WGLLNANGTAIYEIDLSGKQADSEYRALPQPNNNKPYKGKLWCIAAQGADLTELGTAVTF  396

Query  357  ACGQGNRTCNPIQPGGAC  304
            AC QGN TC+ + PGG  
Sbjct  397  ACSQGNGTCDALAPGGKV  414



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 129/194 (66%), Gaps = 5/194 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARP-GVVIPTLIFALYNENQKPGPGTERHF  535
            D+DQ GA++ N+ATYNRN+ +   S  GTP RP   V P ++FAL+NE+ K GPGTERH+
Sbjct  289  DLDQFGANVRNAATYNRNLARHLASGAGTPRRPRARVAPAMVFALFNEDLKWGPGTERHW  348

Query  534  GVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTN-QPYKGKVWCVVAPA---ANLTAVADA  367
            G+ YPNG+ +Y +DL+G+       P   P +N +PY G +WCVVA      N TAV   
Sbjct  349  GLFYPNGSAVYEVDLTGRRRSLPSYPPLPPASNDRPYPGPLWCVVATDKGPVNETAVRAQ  408

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            ++ AC      C+P++PGGAC+ P+++  HASY FS++W +F    G CYF G AV+T  
Sbjct  409  VAAACADVPGLCDPVRPGGACFLPDTVSAHASYVFSAHWNRFSEDYGGCYFAGFAVETTV  468

Query  186  DPSYGACKYPSITL  145
            DPS+G+CK+PSI L
Sbjct  469  DPSHGSCKFPSILL  482



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 123/183 (67%), Gaps = 5/183 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D++GA+++N+ATYNRN+  +     GTPARPG  IP  +F+LYNEN+KPGPGTERH+G
Sbjct  285  DADELGANVHNAATYNRNLAARMAKNPGTPARPGAEIPVFLFSLYNENRKPGPGTERHWG  344

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVAPAAN----LTAVADA  367
            + YPN T +Y +DL+G+ P + +PPL          G  VWCV+A         TAVA A
Sbjct  345  LYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAANETAVAAA  404

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            + YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFNGLA KT  
Sbjct  405  VEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFNGLAEKTTI  464

Query  186  DPS  178
            DPS
Sbjct  465  DPS  467



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 123/183 (67%), Gaps = 5/183 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D++GA+++N+ATYNRN+  +     GTPARPG  IP  +F+LYNEN+KPGPGTERH+G
Sbjct  285  DADELGANVHNAATYNRNLAARMAKNPGTPARPGAEIPVFLFSLYNENRKPGPGTERHWG  344

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVAPAAN----LTAVADA  367
            + YPN T +Y +DL+G+ P + +PPL          G  VWCV+A         TAVA A
Sbjct  345  LYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAANETAVAAA  404

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            + YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFNGLA KT  
Sbjct  405  VEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFNGLAEKTTI  464

Query  186  DPS  178
            DP+
Sbjct  465  DPT  467



>gb|EEC76518.1| hypothetical protein OsI_14304 [Oryza sativa Indica Group]
Length=175

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = -3

Query  657  VVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKT  478
            + +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G+ +PNG+ +Y +DL+G+ 
Sbjct  1    MARHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRR  60

Query  477  PESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGAC  304
            P + +PPLP P TN  PY GK+WCVV A AAN TAV + +  AC      C P++ GG C
Sbjct  61   PPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGEC  120

Query  303  YNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDPSYGACKYPSIT  148
            Y PN++  HASY FS++W +F  + GG CYF GLA++T  DPS+G+CK+PS+T
Sbjct  121  YLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDPSHGSCKFPSVT  173



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   186 bits (473),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 127/185 (69%), Gaps = 5/185 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D++GA+++N+ATYNRN+  +     GTPARPG  IP  +F+LYNEN+KPGPGTERH+G
Sbjct  285  DADELGANVHNAATYNRNLAARMAKNPGTPARPGAEIPVFLFSLYNENRKPGPGTERHWG  344

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVA----PAANLTAVADA  367
            + YPN T +Y +DL+G+ P + +PPL          G  VWCV+A     AAN TAVA A
Sbjct  345  LYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAANETAVAAA  404

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            + YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFNGLA KT  
Sbjct  405  VEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFNGLAEKTTI  464

Query  186  DPSYG  172
            DP++ 
Sbjct  465  DPTFA  469



>ref|XP_001784285.1| predicted protein [Physcomitrella patens]
 gb|EDQ50891.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKF--TSKVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            DV+Q GA++ N+A YNR +V K   T+ VGTPARPGV+IPT IF+L+NEN KPG G+ER+
Sbjct  246  DVNQTGATVDNAALYNRRLVLKVLSTTHVGTPARPGVIIPTYIFSLFNENLKPGVGSERN  305

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPP----LPKPTTNQPYKGKVWCVVAPAANLTAVAD  370
            +G+LYP+ T +Y +DL+G+  + ++ P       P++        WCV + AA+   + +
Sbjct  306  WGLLYPDLTPVYAVDLTGQLLDHQYAPNSVSTGPPSSPSSAGSGSWCVSSAAADPVTLEN  365

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
             L+YAC      C  +QPG +C+ PN++  HAS+AF+SYW ++RS GG+C F+G A  T 
Sbjct  366  GLNYACNANEEFCAALQPGQSCHLPNTVASHASWAFNSYWQKYRSAGGSCSFDGAATLTS  425

Query  189  NDPSYGACKYP  157
             DPS+G C +P
Sbjct  426  IDPSFGTCLFP  436



>emb|CAA49515.1| beta-1,3-glucanase homologue [Brassica napus]
Length=139

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = -3

Query  561  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  382
            PG GTERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T
Sbjct  1    PGSGTERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANET  60

Query  381  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  202
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  61   ELGQALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  120

Query  201  VKTINDPSYGACKYPSITL  145
             +T  +P    CK+PS+TL
Sbjct  121  RETTTNPGNEQCKFPSVTL  139



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 120/196 (61%), Gaps = 16/196 (8%)
 Frame = -3

Query  699  IGASIYNSATYNRNVVKKFTSK------VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            +GAS+ N+A YNR +V +   K       GTP RPG +I T IFAL+NE+QKPG  TER+
Sbjct  252  VGASLANAADYNRRLVLRILGKNRKNKNHGTPRRPGRLIDTYIFALFNEDQKPGAATERN  311

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKP----TTNQPYKGKVWCVV-APAANLTAVA  373
            +G+LYPNG+ +Y IDL+GKTP    P    P    T N   +G+ WCV  A   +   V 
Sbjct  312  WGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSRQGQ-WCVAKADYVSTADVQ  370

Query  372  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  193
            DA+ YACG G   C  IQPG ACY PN +  HASYAF+SYW + +  GGTC FNG A  T
Sbjct  371  DAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYWQKMKRSGGTCAFNGFAKLT  430

Query  192  INDPSYGACKYPSITL  145
              DPS    K+ S +L
Sbjct  431  SVDPS----KFRSFSL  442



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 120/196 (61%), Gaps = 16/196 (8%)
 Frame = -3

Query  699  IGASIYNSATYNRNVVKKFTSK------VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            +GAS+ N+A YNR +V +   K       GTP RPG +I T IFAL+NE+QKPG  TER+
Sbjct  252  VGASLANAADYNRRLVLRILGKNRKNKNHGTPRRPGRLIDTYIFALFNEDQKPGAATERN  311

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKP----TTNQPYKGKVWCVV-APAANLTAVA  373
            +G+LYPNG+ +Y IDL+GKTP    P    P    T N   +G+ WCV  A   +   V 
Sbjct  312  WGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSRQGQ-WCVAKADYVSTADVQ  370

Query  372  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  193
            DA+ YACG G   C  IQPG ACY PN +  HASYAF+SYW + +  GGTC FNG A  T
Sbjct  371  DAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYWQKMKRSGGTCAFNGFAKLT  430

Query  192  INDPSYGACKYPSITL  145
              DPS    K+ S +L
Sbjct  431  SVDPS----KFRSFSL  442



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 119/191 (62%), Gaps = 7/191 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A+YN N+VK+  S  GTP +P   +   +FAL+NENQK GP +ER++G
Sbjct  271  DSNEIGASPDNAASYNGNLVKRVLSGSGTPLKPNESLDVFLFALFNENQKTGPTSERNYG  330

Query  531  VLYPNGTNIYPIDLSGKTP-----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  367
            + YP+   +Y I L+ + P     +S+ P     TT+   KG+ WCV    ++   + +A
Sbjct  331  LFYPSQKKVYDIQLTAEAPPSGVGKSQVPVSGDVTTSS--KGQTWCVANGGSSEKKLQNA  388

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            L+YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTCYF G A     
Sbjct  389  LNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGTCYFGGTAYVVTQ  448

Query  186  DPSYGACKYPS  154
             P YG C++P+
Sbjct  449  PPKYGNCEFPT  459



>gb|KHG21190.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=470

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 118/198 (60%), Gaps = 13/198 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  ++GAS  N+A YN N+V++  +  GTP RP   +   IFAL+NENQKPGP +ER++G
Sbjct  272  DAGEVGASQDNAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYG  331

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVWCVVAPAAN  388
            + YPN   +Y I LS K       P P    NQ               G+ WC+ +P A 
Sbjct  332  LFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNGGGVSKATSGQTWCMASPNAE  390

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
               + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   + G+C+F+G
Sbjct  391  AEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSG  450

Query  207  LAVKTINDPSYGACKYPS  154
             A  +   PS+G C++P+
Sbjct  451  TAYVSTQRPSFGNCQFPT  468



>gb|KJB13749.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
 gb|KJB13750.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
Length=470

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 118/198 (60%), Gaps = 13/198 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  ++GAS  N+A YN N+V++  +  GTP RP   +   IFAL+NENQKPGP +ER++G
Sbjct  272  DAAEVGASQDNAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYG  331

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVWCVVAPAAN  388
            + YPN   +Y I LS K       P P    NQ               G+ WC+ +P A 
Sbjct  332  LFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNWGGVSKATSGQTWCMASPNAE  390

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
               + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   + G+C+F+G
Sbjct  391  AEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSG  450

Query  207  LAVKTINDPSYGACKYPS  154
             A  +   PS+G C++P+
Sbjct  451  TAYVSTQPPSFGNCQFPT  468



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 115/190 (61%), Gaps = 8/190 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++ GA+  N+ATYNR +V+K     GTP RP   I T IFALYNEN KPGPGTERH+G
Sbjct  277  DENERGATRSNAATYNRRLVRKVIEGRGTPKRPNSAIATFIFALYNENLKPGPGTERHWG  336

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTT----NQPYKGKVWCVVAPAANLTAVADAL  364
            +LYP+G  +Y IDL+G+  +S++  +P+P +    N       WCV  P A+ +++   L
Sbjct  337  LLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAVVNSSSSSSSWCVARPDADTSSLQREL  396

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
               C Q    C  IQ G +C+ PN++I HASYAF+  W +       C F+  A  T  +
Sbjct  397  DRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAFNRRWIR----ENQCSFSSTAALTKIN  452

Query  183  PSYGACKYPS  154
            PSYG+C +PS
Sbjct  453  PSYGSCIFPS  462



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 114/190 (60%), Gaps = 8/190 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++ GA+  N+ATYNR +V+K     GTP RP   I T IFALYNEN KPGPG ERH+G
Sbjct  277  DENERGATRSNAATYNRRLVRKVVEGRGTPKRPNSAIETFIFALYNENLKPGPGIERHWG  336

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTT----NQPYKGKVWCVVAPAANLTAVADAL  364
            +LYP+G  +Y IDL+G+  +S++  +P+P +    N       WCV  P A+ +++   L
Sbjct  337  LLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAVVNSSSSSSSWCVARPDADTSSLQREL  396

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
               C Q    C  IQ G +C+ PN++I HASYAF+  W +       C F+  A  T  +
Sbjct  397  DRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAFNRRWIR----ENQCSFSSTAALTKIN  452

Query  183  PSYGACKYPS  154
            PSYG+C +PS
Sbjct  453  PSYGSCIFPS  462



>gb|KJB62900.1| hypothetical protein B456_009G442700 [Gossypium raimondii]
Length=469

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 119/195 (61%), Gaps = 9/195 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+ GAS  N+A+YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  273  DQDEKGASESNAASYNGNLVRKVLTGNGTPLRPQDPLNVYLFALFNENQKPGPTSERNYG  332

Query  531  VLYPNGTNIYPIDLSGKTPES-EFPPL-----PKPTTNQPYKGKV---WCVVAPAANLTA  379
            + YPN   +Y I L+ +  ++ E  P+     P P   +  K KV   WCV    A+   
Sbjct  333  LFYPNEQKVYTIPLTKEEVKTGESTPVNTNTSPAPVAGEVSKAKVGQTWCVANEKADEKK  392

Query  378  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  199
            +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F+G A 
Sbjct  393  LQAALDYACGEGEADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEFDGAAY  452

Query  198  KTINDPSYGACKYPS  154
                 P+YG C++P+
Sbjct  453  VVTQRPTYGNCEFPT  467



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 121/195 (62%), Gaps = 9/195 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+IGAS  N+A+YN N+V+K  +  GTP RP   +   +FAL+NEN+KPGP +ER++G
Sbjct  273  DEDEIGASESNAASYNGNLVRKVLTGNGTPLRPQDPLNVYLFALFNENKKPGPTSERNYG  332

Query  531  VLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVVAPAANLTA  379
            + YPN   +Y I L+ +  ++ +  P+   T+  P  G+V        WCV    A+   
Sbjct  333  LFYPNEQKVYNIPLTKEEAKTGQSTPVNSNTSQVPVAGEVSKAKVGQTWCVANGKADEKK  392

Query  378  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  199
            +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +   + GTC F G A 
Sbjct  393  LQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRVTGTCEFGGAAY  452

Query  198  KTINDPSYGACKYPS  154
                 P+YG+C++P+
Sbjct  453  VVSQRPTYGSCEFPT  467



>ref|XP_006595830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 119/203 (59%), Gaps = 17/203 (8%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG
Sbjct  267  DSNEVGASVENAAAYNGNLVRKILTAAGTPLRPKADLTVYLFALFNENQKPGPTSERNFG  326

Query  531  VLYPNGTNIYPIDLS----------------GKTPESEFP-PLPKPTTNQPYKGKVWCVV  403
            + YP+   +Y + L+                G   + E P P+     ++   G  WCV 
Sbjct  327  LFYPDERRVYNVPLTVEELKDYHDRPSAPVNGGGQKKETPAPVVSGGVSKSTTGNTWCVA  386

Query  402  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  223
             P A+   +  AL +ACG+G   C PIQ G  CY+PN+L+ HAS+AF+SY+ +    GG+
Sbjct  387  NPDADKVKLQAALDFACGEGGSDCGPIQRGATCYDPNTLVAHASFAFNSYYQKQSRKGGS  446

Query  222  CYFNGLAVKTINDPSYGACKYPS  154
            CYF G +     +P YG+C++P+
Sbjct  447  CYFGGTSYVVTQEPRYGSCEFPT  469



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 119/195 (61%), Gaps = 9/195 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+IGA+  N+A+YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  273  DEDEIGANESNAASYNGNLVRKVLTGNGTPLRPQDPLNVYLFALFNENQKPGPTSERNYG  332

Query  531  VLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVVAPAANLTA  379
            + YPN   +Y I L+ +  ++ E  P+   T+  P  G+V        WCV    A+   
Sbjct  333  LFYPNEQKVYNIPLTKEEAKTGESTPVNSNTSQVPVAGEVSKAKVGQTWCVANGKADEKK  392

Query  378  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  199
            +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F G A 
Sbjct  393  LQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEFGGAAY  452

Query  198  KTINDPSYGACKYPS  154
                 P+YG C++P+
Sbjct  453  VVSQRPTYGNCEFPT  467



>ref|XP_004491104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Cicer arietinum]
Length=475

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 20/205 (10%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG
Sbjct  270  DNNEVGASVENAAAYNGNLVRKILTGSGTPLRPKADLTVYLFALFNENQKPGPTSERNFG  329

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPT------TNQPY-------------KGKVWC  409
            + YP+   +Y I L+ +  ++ +   P P       TNQP               G  WC
Sbjct  330  LFYPSEEKVYDIPLTVEALKN-YHDNPSPVAPVSGNTNQPTPAVSPVGGVSKSTTGDTWC  388

Query  408  VVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLG  229
            V  P A+   +  AL +ACG+G   C  IQPG  CYNPN+L+ HAS+AF+SY+ +    G
Sbjct  389  VANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVAHASFAFNSYYQKQARAG  448

Query  228  GTCYFNGLAVKTINDPSYGACKYPS  154
            G+C+F G +     +P YG+C++P+
Sbjct  449  GSCFFGGTSYVVTQEPKYGSCEFPT  473



>ref|XP_006575581.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=472

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 119/204 (58%), Gaps = 18/204 (9%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG
Sbjct  267  DSNEVGASVDNAAAYNGNLVRKILTAGGTPLRPKADLIVFLFALFNENQKPGPTSERNFG  326

Query  531  VLYPNGTNIYPIDLSGKTP--------------ESEFPPLPKPTTN----QPYKGKVWCV  406
            + YP+   +Y + L+ +                + +  P P P  +    +   G  WCV
Sbjct  327  LFYPDERRVYNVPLTTEELKDYHDRPAPVSGGGQQKGTPAPAPVVSGGVSKSTTGNTWCV  386

Query  405  VAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGG  226
              P A+   +  AL +ACG+G   C PIQ G  CY+PN+L+ HAS+AF+SY+ +    GG
Sbjct  387  ANPDADKVKLQAALDFACGEGGADCRPIQRGSTCYDPNTLVAHASFAFNSYYQKQSRKGG  446

Query  225  TCYFNGLAVKTINDPSYGACKYPS  154
            +CYF G +     +P YG+C++P+
Sbjct  447  SCYFGGTSYVVTQEPKYGSCEFPT  470



>ref|XP_001781801.1| predicted protein [Physcomitrella patens]
 gb|EDQ53355.1| predicted protein, partial [Physcomitrella patens]
Length=450

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKF--TSKVGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D  ++ A+I N+A YNR +V+K   T+++GTPARPGV IPT IFAL+NEN KPG  +ER+
Sbjct  247  DSTEVAATIDNAANYNRRLVRKILSTTQIGTPARPGVFIPTYIFALFNENLKPGVSSERN  306

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            +G+L+PN + +Y IDL+G+  +S++ P    +  Q   G  WC+    ++   + + L++
Sbjct  307  WGLLHPNLSPVYAIDLTGQIYDSQYSPNSNSSPLQTGSG-TWCISNENSDPVTLENGLNF  365

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG     C  IQP  +CY P++++ HA++AF++YW +++  GG+C F+G  V T  DPS
Sbjct  366  ACGADVEFCKAIQPSASCYLPSTIVSHAAWAFNNYWQKYKGAGGSCSFSGAGVLTSTDPS  425



>ref|XP_003616906.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99864.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=470

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 119/199 (60%), Gaps = 14/199 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG
Sbjct  271  DGNEVGASVENAAAYNANLVRKILTSKGTPLRPKADLTVFLFALFNENQKPGPTSERNFG  330

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTT-------------NQPYKGKVWCVVAPAA  391
            + YP+   +Y + L+ +  ++ +   P P +             ++   G  WCV  P A
Sbjct  331  LFYPDEKKVYNVPLTVEALKN-YHDDPSPASPVSGGGGSGGGGVSKSTTGNTWCVANPYA  389

Query  390  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  211
            +   + DAL +ACG+G   C PIQ    C++PN+L+ HAS+AF+SY+ +    GG+CYF 
Sbjct  390  DKNKLQDALDFACGEGGADCRPIQNNATCFDPNTLVAHASFAFNSYYQKQARAGGSCYFG  449

Query  210  GLAVKTINDPSYGACKYPS  154
            G +     +P YG C++P+
Sbjct  450  GTSYVVTQEPKYGKCEFPT  468



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 118/196 (60%), Gaps = 13/196 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERH  538
            D +Q G ++ N+  YN+ +V+K  +    GTP RPG  IPT IF+L+NE+QKPGP TER+
Sbjct  297  DENQQGTNVPNATRYNQQLVQKVLADPPRGTPRRPGAFIPTFIFSLFNEDQKPGPNTERN  356

Query  537  FGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKV------WCVVAPAA----N  388
            +G+ YP+GT +YPI LS   P      +P                  WCVV+P A    +
Sbjct  357  WGLFYPDGTPVYPIVLSNDAPALSHISVPSQNNGPLPASPPSPVSPQWCVVSPVAVAQVD  416

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
             T++  AL YACG G   C+ I+PG  CY PN+L+ HASYAF+SYW + ++   TC F+G
Sbjct  417  ETSLQAALDYACGAG-ADCSLIEPGEPCYLPNTLVSHASYAFNSYWQKTKAADATCDFHG  475

Query  207  LAVKTINDPSYGACKY  160
             AV T +DPS G C +
Sbjct  476  AAVLTSSDPSVGDCVF  491



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 113/190 (59%), Gaps = 6/190 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V++  +  GTP RP   +   +FAL+NEN+KPGP +ER+FG
Sbjct  273  DSNEVGASVENAAAYNGNLVRRVLAGGGTPLRPHANLTVYLFALFNENKKPGPTSERNFG  332

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-----GKVWCVVAPAANLTAVADA  367
            + YPN   +Y I L+ +  +S +  +  P T    +     G+ WCV    A     +  
Sbjct  333  LFYPNQKKVYDIPLTAEGLKS-YRDIQSPVTGGEQRVSTANGQTWCVAKEEAGKEKQSSG  391

Query  366  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  187
            L YACG+G   C+PIQPG  C++PN+L  HAS+AF+SY+ +     GTCYF G A     
Sbjct  392  LDYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYYQKKGRAIGTCYFGGAAYIVTQ  451

Query  186  DPSYGACKYP  157
             P YG C +P
Sbjct  452  QPKYGKCDFP  461



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%), Gaps = 8/190 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A+YN N+VK+  S  GTP +P   +   +FAL+NENQK GP +ER++G
Sbjct  271  DSNEIGASPDNAASYNGNLVKRVLSGSGTPLKPNESLDVFLFALFNENQKTGPTSERNYG  330

Query  531  VLYPNGTNIYPIDLSGKTP----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  364
            + YP    +Y  D +   P    +S+ P     TT+   KG+ WCV    ++   + +AL
Sbjct  331  LFYPTEKKVY--DTAEAPPSGVGKSQVPVSGDVTTSS--KGQTWCVANGGSSEKKLQNAL  386

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            +YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTCYF G A      
Sbjct  387  NYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGTCYFGGTAYVVTQP  446

Query  183  PSYGACKYPS  154
            P YG C++P+
Sbjct  447  PKYGNCEFPT  456



>ref|XP_008449141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=454

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 108/184 (59%), Gaps = 2/184 (1%)
 Frame = -3

Query  705  DQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVL  526
            ++IGAS  N+A YN N+VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G+ 
Sbjct  272  NEIGASTENAAAYNGNLVKRVLTGSGTPLRPKDPLNVYLFALFNENQKPGPTSERNYGLF  331

Query  525  YPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQ  346
            YPN   +Y I L+G    +  PP    +  +   G+ WCV         +   L YACG+
Sbjct  332  YPNEEKVYEISLTGDVVGAT-PPDSNGSKVE-VTGQTWCVANENVGAEKLQAGLDYACGE  389

Query  345  GNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGAC  166
            G   C  IQ GGACY+PNSL  HASYAF+SY+ + +   GTC F G A      P YG C
Sbjct  390  GQADCRSIQQGGACYDPNSLQAHASYAFNSYYQKMKRAAGTCDFGGAAYIVTQPPQYGKC  449

Query  165  KYPS  154
             +PS
Sbjct  450  DFPS  453



>gb|KHN38251.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=381

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 110/186 (59%), Gaps = 0/186 (0%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A+YN N+VK+  S  GTP +    +   +FAL+NENQK GP +ER++G
Sbjct  194  DSNEIGASPDNAASYNGNLVKRVLSGSGTPLKQNESLDVFLFALFNENQKTGPTSERNYG  253

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC  352
            + YP    +Y I L          P+    +    KG+ WCV +  ++   + +AL+YAC
Sbjct  254  LFYPTEKKVYDIPLPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKLQNALNYAC  313

Query  351  GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  172
            G+G   C PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F G A      P YG
Sbjct  314  GEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYVVTQPPKYG  373

Query  171  ACKYPS  154
             C++P+
Sbjct  374  NCEFPT  379



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 8/194 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A+YN N+VK+  S  GTP +    +   +FAL+NENQK GP +ER++G
Sbjct  277  DSNEIGASPDNAASYNGNLVKRVMSGSGTPLKQNESLDVFLFALFNENQKTGPTSERNYG  336

Query  531  VLYPNGTNIYPIDLSGKTPESEFP--------PLPKPTTNQPYKGKVWCVVAPAANLTAV  376
            + YP    +Y I L+ +  +   P        P+    +    KG+ WCV +  ++   +
Sbjct  337  LFYPTEKKVYDIPLTAEEIKEAPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKL  396

Query  375  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  196
             +AL+YACG+G   C PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F G A  
Sbjct  397  QNALNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYV  456

Query  195  TINDPSYGACKYPS  154
                P YG C++P+
Sbjct  457  VTQPPKYGNCEFPT  470



>gb|KFK29190.1| hypothetical protein AALP_AA7G101400 [Arabis alpina]
Length=461

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 115/193 (60%), Gaps = 9/193 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            DV+++GAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  269  DVNEVGASQSNAAAYNGGLVKRVLTGKGTPLRPRDPLNVYLFALFNENQKPGPTSERNYG  328

Query  531  VLYPNGTNIYPID-LSGKTPESEFP------PLPKPTTNQPYKGKVWCVVAPAANLTAVA  373
            + YPN   +Y +  ++GK  +S         P+P P      +G+ WCV    A +  + 
Sbjct  329  LFYPNEAKVYDVPFVAGKKRKSPLKGNRGHAPVPVPAVAD--EGEKWCVSNGEAGMEKLQ  386

Query  372  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  193
             AL YACG+G   C+PIQPG  C+NP SL  HASYAF+SY+ +     GTC+F G A   
Sbjct  387  AALDYACGEGGADCSPIQPGATCFNPESLEAHASYAFNSYYQKNARRVGTCFFGGAAHVV  446

Query  192  INDPSYGACKYPS  154
               P YG C +P+
Sbjct  447  TQPPRYGKCDFPT  459



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 109/187 (58%), Gaps = 1/187 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGASI N+A YN N+VK+  +  GTP RP   +   +FAL+NEN+K GP +ER++G
Sbjct  270  DENEIGASIENAAAYNGNLVKRVLTGSGTPLRPKEPLNAYLFALFNENKKQGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTAVADALSYA  355
            + YPN   +Y I L+    E      P    ++  K G+ WCV         +   L YA
Sbjct  330  LFYPNEEKVYEIPLTSADVEGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEKLQAGLDYA  389

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CG+G   C+ IQPG  CYNPNSL  HASYAF+SY+ + +   GTC F G A      P Y
Sbjct  390  CGEGGADCSSIQPGATCYNPNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAYVVTQPPQY  449

Query  174  GACKYPS  154
            G C++P+
Sbjct  450  GQCEFPT  456



>ref|XP_004140121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 ref|XP_004156096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 gb|KGN47963.1| hypothetical protein Csa_6G421570 [Cucumis sativus]
Length=476

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 114/203 (56%), Gaps = 17/203 (8%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS+ N+A YN N+V++  S  GTP RP   +   +FAL+NEN+K GP +ER++G
Sbjct  272  DENEIGASVENAAAYNGNLVRRILSGGGTPLRPKADLTVYLFALFNENKKNGPTSERNYG  331

Query  531  VLYPNGTNIYPIDLSGK-TPESEFPPLPKPTT----------------NQPYKGKVWCVV  403
            + YPN   +Y I  + +   + E  P PKP +                ++   G  WCV 
Sbjct  332  LFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVSGGNAPTAPPASGDGGVSKSQTGNTWCVA  391

Query  402  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  223
            +  A    +   L YACG+G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GT
Sbjct  392  SGEAGKEKLQSGLDYACGEGGADCRPIQVGATCYNPNTLEAHASYAFNSYYQKNSRKVGT  451

Query  222  CYFNGLAVKTINDPSYGACKYPS  154
            CYF G A      P YG+C++P+
Sbjct  452  CYFGGAAYVVTQPPKYGSCEFPT  474



>ref|XP_004161885.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13-like [Cucumis sativus]
Length=458

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 109/187 (58%), Gaps = 1/187 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGASI N+A YN N+VK+  +  GTP RP   +   +FAL+NEN+K GP +ER++G
Sbjct  270  DENEIGASIENAAAYNGNLVKRVLTGSGTPLRPKEPLNAYLFALFNENKKQGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTAVADALSYA  355
            + YPN   +Y I L+    E      P    ++  K G+ WCV         +   L YA
Sbjct  330  LFYPNEEKVYEIPLTSADVEGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEKLQAGLDYA  389

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CG+G   C+ IQPG  CYNPNSL  HASYAF+SY+ + +   GTC F G A      P Y
Sbjct  390  CGEGGADCSSIQPGATCYNPNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAYVVTQPPQY  449

Query  174  GACKYPS  154
            G C++P+
Sbjct  450  GQCEFPT  456



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 110/188 (59%), Gaps = 6/188 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  280  DGNEIGASESNAAAYNGGLVKRVLNGNGTPLRPKEPLNVFLFALFNENQKPGPTSERNYG  339

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSY  358
            + YPN   +Y +  +  T      P+ +     P  ++G+ WCV    A    +  AL Y
Sbjct  340  LFYPNERKVYAVPFAATTST----PVNRNKEQAPVAHEGETWCVSNGDAAKEKLQAALDY  395

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+G   C PIQPG  CY+P SL  HAS+AF+SY+ +     GTCYF G A      P 
Sbjct  396  ACGEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPR  455

Query  177  YGACKYPS  154
            YG CK+P+
Sbjct  456  YGKCKFPT  463



>emb|CDX92794.1| BnaC07g40520D [Brassica napus]
Length=451

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 108/188 (57%), Gaps = 14/188 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            DV++IGAS  N+A YN  +VK+  +  GTP R    +   +F+L+NENQKPGP +ER++G
Sbjct  274  DVNEIGASEANAAAYNGGLVKRVLNGNGTPLRRNEPLNVFLFSLFNENQKPGPTSERNYG  333

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSY  358
            + YPN   +Y +            P P  T   P  ++G+ WCV    A    +  AL Y
Sbjct  334  LFYPNERRVYAV------------PFPATTEQAPVAHEGESWCVSNGDAAKEKLQAALDY  381

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+G   C PIQPG  CYNP SL  HAS+AF+SY+ +     GTCYF G A      P 
Sbjct  382  ACGEGGADCRPIQPGATCYNPKSLEAHASFAFNSYYQKNARRVGTCYFGGTAHVVTQHPR  441

Query  177  YGACKYPS  154
            YG CK+P+
Sbjct  442  YGKCKFPT  449



>gb|KHG21189.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=489

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 111/191 (58%), Gaps = 13/191 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  ++GAS  N+A YN N+V++  +  GTP RP   +   IFAL+NENQKPGP +ER++G
Sbjct  272  DAGEVGASQDNAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYG  331

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVWCVVAPAAN  388
            + YPN   +Y I LS K       P P    NQ               G+ WC+ +P A 
Sbjct  332  LFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNGGGVSKATSGQTWCMASPNAE  390

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
               + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   + G+C+F+G
Sbjct  391  AEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSG  450

Query  207  LAVKTINDPSY  175
             A  +   P +
Sbjct  451  TAYVSTQRPFF  461



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 115/195 (59%), Gaps = 9/195 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A+YN N+V++  S  GTP RP   +   +FAL+NENQK GP +ER++G
Sbjct  279  DENEIGASEANAASYNGNLVRRVLSGNGTPLRPQDPLNVYLFALFNENQKSGPTSERNYG  338

Query  531  VLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVVAPAANLTA  379
            + YPN   +Y I L+ +  ES +  P+   T+  P  G+V        WCV    A    
Sbjct  339  LFYPNEQKVYNIPLTKEELESGQSTPVNGNTSQVPATGEVSKTSVGQTWCVANKNAGEKT  398

Query  378  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  199
            +  AL YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTC F G A 
Sbjct  399  LQAALDYACGEGGADCKPIQPGATCYSPNTLDAHASYAFNSYYQKKTRGTGTCDFGGAAY  458

Query  198  KTINDPSYGACKYPS  154
                 P YG C++P+
Sbjct  459  VVSQPPRYGNCEFPT  473



>ref|XP_004243515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Solanum lycopersicum]
Length=468

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 112/194 (58%), Gaps = 8/194 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  +IGAS+ N+A+YN N+V++     GTP RP   +   +FAL+NEN+KPGP +ER+FG
Sbjct  273  DDTEIGASVDNAASYNGNLVRRILIGGGTPLRPKEDLTVFLFALFNENKKPGPTSERNFG  332

Query  531  VLYPNGTNIY--PIDLSGKTP--ESEFPPLPKPTTNQPYK----GKVWCVVAPAANLTAV  376
            + YPN   +Y  P+ + G     +   P   +  T +  K    G+ WCV +  A    +
Sbjct  333  LFYPNERKVYNIPLTMEGLKHYVDRRSPSAGEQRTQKGGKVNVSGQTWCVASGEAEKDHL  392

Query  375  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  196
              AL YACG+G   C  IQPG  CYNPN+L  HAS+AF+SY+ +     G+CYF G A  
Sbjct  393  QAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQKKGRAMGSCYFGGAAFI  452

Query  195  TINDPSYGACKYPS  154
                P YG C+ P+
Sbjct  453  VHQQPKYGHCELPT  466



>dbj|BAF01977.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=314

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 109/188 (58%), Gaps = 6/188 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  129  DENEIGASESNAAAYNAGLVKRVLTGKGTPLRPTEPLNVYLFALFNENQKPGPTSERNYG  188

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSY  358
            + YPN   +Y +  + K+      P+       P  ++G  WCV         + +AL Y
Sbjct  189  LFYPNEGKVYNVPFTKKSTT----PVNGNRGKVPVTHEGHTWCVSNGEVAKEKLQEALDY  244

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC+F G A      P 
Sbjct  245  ACGEGGADCRPIQPGATCYHPESLEAHASYAFNSYYQKNSRRVGTCFFGGAAHVVTQPPR  304

Query  177  YGACKYPS  154
            YG C++P+
Sbjct  305  YGKCEFPT  312



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -3

Query  705  DQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVL  526
            D+  A++ N+ T+N N++K+  +  G P++P + I T I+ LYNE+++ GP +ER++G+L
Sbjct  276  DEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGIL  335

Query  525  YPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQ  346
            +PNGT++YP+ LSG +  +                 ++CV    A+   + D L++ACGQ
Sbjct  336  FPNGTSVYPLSLSGGSNSAAL-----------NDSSMFCVAKADADDDKLIDGLNWACGQ  384

Query  345  GNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGAC  166
            G   C  IQPG  CY PN +  HAS+AF+ Y+ + +S GGTC F+G A+ T  DPSY  C
Sbjct  385  GRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTC  444

Query  165  KY  160
             Y
Sbjct  445  AY  446



>ref|XP_007141644.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
 gb|ESW13638.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
Length=473

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 116/202 (57%), Gaps = 16/202 (8%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A +N N+V+K  +  GTP RP   +   +FAL+NENQK GP +ER+FG
Sbjct  270  DNNEVGASVENAAAFNGNLVRKILTGGGTPLRPKADLTVYLFALFNENQKSGPTSERNFG  329

Query  531  VLYPNGTNIYPIDLSGKT-PESEFPPLPKPTTNQPYK---------------GKVWCVVA  400
            + YP+   +Y +  + +   +    P+   + NQ  +               G  WCV  
Sbjct  330  LFYPDEKRVYNVPFTAEELKDYHDSPVKGGSHNQTTQAPAPNVSGGVSKSTTGNTWCVAN  389

Query  399  PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTC  220
            P A+   +  AL +ACG+G   C PIQ G  CY+PN+++ HAS+AF+SY+ +    GG+C
Sbjct  390  PDADKVKLQAALDFACGEGGADCAPIQHGATCYDPNTIVAHASFAFNSYYQKQARKGGSC  449

Query  219  YFNGLAVKTINDPSYGACKYPS  154
            YF G +     +P YG C++P+
Sbjct  450  YFGGTSYVVTQEPRYGNCEFPT  471



>ref|XP_011047200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Populus euphratica]
Length=470

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 115/199 (58%), Gaps = 13/199 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+ATYN N+V++  +  GTP +P   +   +FAL+NEN+K GP +ER++G
Sbjct  270  DENEVGASVENAATYNGNLVRRILTGGGTPLKPHADLTVYLFALFNENEKDGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLS----------GKTPESEFPPLPKPT---TNQPYKGKVWCVVAPAA  391
            + YP+   +Y I  +           ++P S   P+  P     ++   G  WCV  P A
Sbjct  330  LFYPDQQKVYDIPFTVEGLKNYKAPSRSPVSGGQPVSAPVRGGVSKSTTGNTWCVANPDA  389

Query  390  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  211
                +  AL +ACG+G   C PIQP   CYNPN+L+ H+S+AF+SY+ +     G CYF 
Sbjct  390  GKEKLQAALDFACGEGGADCRPIQPEATCYNPNTLVAHSSFAFNSYYQKKGRGMGDCYFG  449

Query  210  GLAVKTINDPSYGACKYPS  154
            G A     +P +G C++P+
Sbjct  450  GAAFVVTQEPKFGECEFPT  468



>ref|XP_006357966.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Solanum tuberosum]
Length=468

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 110/194 (57%), Gaps = 8/194 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  +IGA++ N+A+YN N+V++     GTP RP   +   +FAL+NEN+KPGP +ER+FG
Sbjct  273  DDTEIGATVDNAASYNGNLVRRILIGGGTPLRPKEDLTVFLFALFNENKKPGPTSERNFG  332

Query  531  VLYPNGTNIY--PIDLSG-KTPESEFPPLPKPTTNQP-----YKGKVWCVVAPAANLTAV  376
            + YPN   +Y  P+ + G K       P+      Q        G+ WCV +  A    +
Sbjct  333  LFYPNERKVYNIPLTMEGLKHYVDRRSPVAGDQRTQKGGKVNVSGQTWCVASGEAEKDHL  392

Query  375  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  196
              AL YACG+G   C  IQPG  CYNPN+L  HAS+AF+SY+ +     G+CYF G A  
Sbjct  393  QAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQKKSRAMGSCYFGGAAFI  452

Query  195  TINDPSYGACKYPS  154
                P YG C+ P+
Sbjct  453  VHQQPKYGHCELPT  466



>ref|XP_006447645.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
 gb|ESR60885.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
Length=480

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 113/200 (57%), Gaps = 14/200 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++ GAS+ N+A YN N+V++  +  GTP RP   +   +FAL+NE+QKPGP +ER++G
Sbjct  279  DENENGASVENAAAYNGNLVRRILTGGGTPLRPKADLTVYLFALFNEDQKPGPTSERNYG  338

Query  531  VLYPNGTNIY--PIDLSG-------KTPESEFPPLPKPT-----TNQPYKGKVWCVVAPA  394
            + YPN   +Y  P  + G       ++P +  P +  P       ++   G  WCV    
Sbjct  339  LFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRSPTVRAPVNGGGGVSKSTSGNTWCVANAE  398

Query  393  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  214
                 +   L YACG+G   C PIQPG  CY+PN+L  HAS+AF+SY+ +    GG+CYF
Sbjct  399  VGKEKLQRGLDYACGEGGADCRPIQPGATCYSPNTLEAHASFAFNSYYQKQSRAGGSCYF  458

Query  213  NGLAVKTINDPSYGACKYPS  154
             G A      P YG C++P+
Sbjct  459  GGAAYVVTQPPRYGVCEFPT  478



>ref|XP_010675772.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 112/190 (59%), Gaps = 4/190 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS  N+A YN N+ K+  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  272  DENEVGASGPNAAAYNGNLAKRVLTGGGTPLRPNDPLDVYLFALFNENQKPGPTSERNYG  331

Query  531  VLYPNGTNIYPIDLSG-KTPESEFPPLPKPTTNQ---PYKGKVWCVVAPAANLTAVADAL  364
            + YPN   +Y + L+  +  ++   P      ++   P  G+ WCV    A    + D L
Sbjct  332  LFYPNEQKVYNVPLTAAQIGDAAVAPASANNGSKVVVPPTGQTWCVANEQAGEEKLQDGL  391

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
            ++ACG+G   C PIQPG  CYNP +L+ HASYAF+SY+       GTC F G A      
Sbjct  392  NWACGEGKADCRPIQPGATCYNPGTLVAHASYAFNSYYQMKARSTGTCDFGGAAHVVTQS  451

Query  183  PSYGACKYPS  154
            P +G+CK+P+
Sbjct  452  PQFGSCKFPT  461



>ref|XP_010063042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Eucalyptus 
grandis]
 gb|KCW70222.1| hypothetical protein EUGRSUZ_F03495 [Eucalyptus grandis]
Length=456

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 106/186 (57%), Gaps = 0/186 (0%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GA   N+A YN N+V++  +  GTP RP   +   +FAL+NENQK GP +ER++G
Sbjct  269  DANEVGAGTQNAAAYNGNLVRRALTGTGTPLRPNNTVDVYLFALFNENQKTGPTSERNYG  328

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC  352
            + YP+   +Y I L+ +   S+     K        G+ WCV    A    +  AL YAC
Sbjct  329  LFYPDEQKVYSIPLTLEQLASDPNNASKAQVPTAPVGQTWCVANGKAGAKKLQAALDYAC  388

Query  351  GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  172
            G+G   C PIQ G ACYNPN+L  HASYAF+SY+ +     GTC F G A      P YG
Sbjct  389  GKGGADCQPIQQGSACYNPNTLEAHASYAFNSYYQKNARGAGTCNFGGAAFVVTQVPEYG  448

Query  171  ACKYPS  154
             C +P+
Sbjct  449  ECDFPT  454



>ref|XP_008449478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Cucumis melo]
Length=474

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 112/201 (56%), Gaps = 15/201 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS+ N+A YN N+V +  S  GTP RP   +   +FAL+NEN+K GP +ER++G
Sbjct  272  DENEIGASVENAAAYNGNLVHRILSGGGTPLRPKADLTVYLFALFNENKKNGPTSERNYG  331

Query  531  VLYPNGTNIYPIDLSGK-TPESEFPPLPKPTT--------------NQPYKGKVWCVVAP  397
            + YPN   +Y I  + +   E +  P  KP +              ++   G  WCV + 
Sbjct  332  LFYPNEEKVYDIPFTAEGLKEYKDKPSRKPISAPTGAPVSGGDGGVSKSQTGNTWCVASG  391

Query  396  AANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCY  217
             A    +   L YACG+G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GTCY
Sbjct  392  EAGREKLQAGLDYACGEGGADCRPIQVGATCYNPNTLEAHASYAFNSYYQKNNRKVGTCY  451

Query  216  FNGLAVKTINDPSYGACKYPS  154
            F G A      P YG+C++P+
Sbjct  452  FGGAAYVVTQPPKYGSCEFPT  472



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 110/195 (56%), Gaps = 9/195 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+IGA   N+A+YN N+VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  267  DEDEIGAGEENAASYNGNLVKRVLTGNGTPLRPQDPLNVYLFALFNENQKPGPTSERNYG  326

Query  531  VLYPNGTNIYPIDLSGKT-PESEFPPLPKPTTNQPYKGKV--------WCVVAPAANLTA  379
            + YPN   +Y I L+ K    S+  P+    +  P  G+V        WCV    +    
Sbjct  327  LFYPNEQKVYDIPLTQKELVNSQSTPVSGNKSQVPVTGEVSKTSVGQTWCVANGNSGKER  386

Query  378  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  199
            +   L YACG G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GTC F G A 
Sbjct  387  LQAGLDYACGDGAADCRPIQEGATCYNPNTLEAHASYAFNSYYQKKARAAGTCSFGGAAY  446

Query  198  KTINDPSYGACKYPS  154
                 P YG C++P+
Sbjct  447  VVTQPPRYGNCEFPT  461



>ref|XP_006469612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=540

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 113/200 (57%), Gaps = 14/200 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++ GAS+ N+A YN N+V++  +  GTP RP   +   +FAL+NE+QKPGP +ER++G
Sbjct  339  DENENGASVENAAAYNGNLVRRILTGGGTPLRPKADLTVYLFALFNEDQKPGPTSERNYG  398

Query  531  VLYPNGTNIY--PIDLSG-------KTPESEFPPLPKPT-----TNQPYKGKVWCVVAPA  394
            + YPN   +Y  P  + G       ++P +  P +  P       ++   G  WCV    
Sbjct  399  LFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRSPTVRAPVNGGGGVSKSTSGNTWCVANAE  458

Query  393  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  214
                 +   L YACG+G   C PIQPG  CY+PN+L  HAS+AF+SY+ +    GG+CYF
Sbjct  459  VGKEKLQRGLDYACGEGGADCRPIQPGATCYSPNTLEAHASFAFNSYYQKQSRAGGSCYF  518

Query  213  NGLAVKTINDPSYGACKYPS  154
             G A      P YG C++P+
Sbjct  519  GGAAYVVTQPPRYGVCEFPT  538



>ref|XP_010482941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=460

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 113/192 (59%), Gaps = 9/192 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGA   N+A YN  +VK+  +  GTP +P   +   +FAL+NENQK GP +ER++G
Sbjct  270  DENEIGAGSANAAAYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLS-GKTP-----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  370
            + YPN   +Y + LS GK+      + + PP+ KP++   + G+ WCV         + +
Sbjct  330  LFYPNENKVYDVSLSSGKSTPVEDNKEKVPPVVKPSS---HVGQTWCVANGKTTKEKLQE  386

Query  369  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  190
             L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G A    
Sbjct  387  GLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGVGTCDFKGAAYVVS  446

Query  189  NDPSYGACKYPS  154
              P YG C++P+
Sbjct  447  QPPKYGKCEFPT  458



>ref|XP_004491103.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Cicer arietinum]
Length=477

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 114/197 (58%), Gaps = 20/197 (10%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPGP +ER+FG
Sbjct  270  DNNEVGASVENAAAYNGNLVRKILTGSGTPLRPKADLTVYLFALFNENQKPGPTSERNFG  329

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPT------TNQPY-------------KGKVWC  409
            + YP+   +Y I L+ +  ++ +   P P       TNQP               G  WC
Sbjct  330  LFYPSEEKVYDIPLTVEALKN-YHDNPSPVAPVSGNTNQPTPAVSPVGGVSKSTTGDTWC  388

Query  408  VVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLG  229
            V  P A+   +  AL +ACG+G   C  IQPG  CYNPN+L+ HAS+AF+SY+ +    G
Sbjct  389  VANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVAHASFAFNSYYQKQARAG  448

Query  228  GTCYFNGLAVKTINDPS  178
            G+C+F G +     +PS
Sbjct  449  GSCFFGGTSYVVTQEPS  465



>ref|XP_010270042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nelumbo nucifera]
Length=466

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 110/199 (55%), Gaps = 16/199 (8%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+ GAS  N+A YN N+V++  +  GTP RP   +   +FAL+NEN KPGP +ER++G
Sbjct  269  DEDESGASEVNAAAYNGNLVRRVLAGGGTPQRPQEDLDVYLFALFNENMKPGPTSERNYG  328

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLP--------KPTTNQPYKG-----KVWCVVAPAA  391
            + YPN   +Y I L   TPE     +P         P  N          + WCV    A
Sbjct  329  LFYPNEEKVYDIPL---TPEEVRQKVPVNGGKSQMTPVNNGGSVSTSSSGQTWCVANGKA  385

Query  390  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  211
                +  AL YACG+G   C PIQPG +CY+PN+L  HAS+AF+SY+ + R   GTC F 
Sbjct  386  GEQKLQAALDYACGEGGSDCRPIQPGASCYDPNTLEAHASFAFNSYYQKMRRGMGTCDFE  445

Query  210  GLAVKTINDPSYGACKYPS  154
            G A      P +G C++P+
Sbjct  446  GAAYVVTQPPKFGKCEFPT  464



>ref|XP_007142328.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
 gb|ESW14322.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
Length=466

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 113/195 (58%), Gaps = 10/195 (5%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGA   N+A YN N+V++   + GTP RP   +   +FAL+NENQK GP +ER++G
Sbjct  271  DSNEIGAGPENAAEYNGNLVRRVLGQSGTPLRPNDSLDVFLFALFNENQKTGPTSERNYG  330

Query  531  VLYPNGTNIYPIDL---------SGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTA  379
            + YP+   +Y I L         S    +S+ P   + +T     G+ WCV    A+   
Sbjct  331  LFYPSEKKVYDIPLKAEGVTEAPSSGVEKSQVPASGEVSTTS-RDGQTWCVANGGASEEK  389

Query  378  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  199
            + + L+YACG+G   C+ IQP   CYNPN+L  HASYAF+SY+ +     GTC F G A 
Sbjct  390  LQNGLNYACGEGGADCSAIQPDATCYNPNTLEAHASYAFNSYYQKKARAAGTCDFGGTAY  449

Query  198  KTINDPSYGACKYPS  154
               + P YG+C++PS
Sbjct  450  VVTHPPKYGSCEFPS  464



>emb|CDP14397.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 112/201 (56%), Gaps = 15/201 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS  N+A YN N+V++  +  GTP RP   +   +FAL+NENQK GP +ER++G
Sbjct  288  DENEVGASQQNAAAYNGNLVRRVLTSGGTPLRPDEPLNVYLFALFNENQKTGPTSERNYG  347

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK---------------GKVWCVVAP  397
            + YP+   +Y + L+ +   S     P  T+    K               G+ WCV + 
Sbjct  348  LFYPSEQKVYDVPLTLEALASAPTASPSNTSRVVTKPPSTSSSGDFFPSTAGQTWCVASG  407

Query  396  AANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCY  217
                  +  AL YACG+G   C PIQPG  CYNPN+L+ HASYAF+SY+ +     G+CY
Sbjct  408  DVGEEKLKAALDYACGEGAADCRPIQPGATCYNPNTLVAHASYAFNSYYQKNARRSGSCY  467

Query  216  FNGLAVKTINDPSYGACKYPS  154
            F G A      P YG+C YP+
Sbjct  468  FGGAAYVVSQLPKYGSCDYPT  488



>gb|ACN39797.1| unknown [Picea sitchensis]
Length=474

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 110/200 (55%), Gaps = 14/200 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+ G  + N+A YN N+VK   S  GTP RP   + T +FAL+NEN+KPGP +ER++G
Sbjct  273  DEDETGVGLDNAAAYNGNLVKHVMSNSGTPLRPKASLDTFLFALFNENKKPGPTSERNYG  332

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPY--------------KGKVWCVVAPA  394
            + YP+   +Y I L+     +  P     +++ P                 + WCV    
Sbjct  333  LFYPSEQRVYDIALTPSAVNNPAPASGNSSSSTPAVSAHHHSSGTTPAGGSETWCVANSK  392

Query  393  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  214
            ++ + +  AL YACG+G+  C  IQPG  CYNPN+L  HASYAF+SY+ +     GTC F
Sbjct  393  SDTSKLQAALDYACGEGDADCQQIQPGAPCYNPNTLEAHASYAFNSYYQKNSRKIGTCDF  452

Query  213  NGLAVKTINDPSYGACKYPS  154
             G A      P YG CK+P+
Sbjct  453  AGAAYVVTQSPKYGDCKFPT  472



>emb|CDY46679.1| BnaA03g48290D [Brassica napus]
Length=446

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 107/186 (58%), Gaps = 15/186 (8%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A YN  +V++  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  274  DGNEIGASESNAAAYNGGLVQRVLNGNGTPLRPKEPLNVFLFALFNENQKPGPTSERNYG  333

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYAC  352
            + YPN   +Y +  +              TT+ P  G+ WCV    A    +  AL YAC
Sbjct  334  LFYPNERKVYAVPFAA-------------TTSTP--GETWCVSNGDAAKEKLQAALDYAC  378

Query  351  GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYG  172
            G+G   C PIQPG  CY+P SL  HAS+AF+SY+ +     GTCYF G A      P YG
Sbjct  379  GEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYG  438

Query  171  ACKYPS  154
             CK+P+
Sbjct  439  KCKFPT  444



>gb|EYU43154.1| hypothetical protein MIMGU_mgv1a005917mg [Erythranthe guttata]
Length=465

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 108/189 (57%), Gaps = 4/189 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GA++ N+A YN N+V++     GTP RP   +   +FAL+NEN+K GP +ER+FG
Sbjct  274  DKNEVGATVENAAAYNGNLVRRVLGGGGTPLRPKADLTVYLFALFNENKKVGPTSERNFG  333

Query  531  VLYPNGTNIYPIDLSGK----TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  364
            + YP+   +Y I L+ +      E   P            G+ WCV    A    + + L
Sbjct  334  LFYPDQKKVYDIPLTAEGLRGLGEKTTPVSGGEQRMATASGETWCVAKEEAGKDKLQEGL  393

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
             YACG+G   C+PIQPG  C++PN+L  HAS+AF+SY+ +     GTC+F G A      
Sbjct  394  DYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYFQKKGRAIGTCFFGGAAYIVTQK  453

Query  183  PSYGACKYP  157
            P YG C++P
Sbjct  454  PKYGKCEFP  462



>gb|EYU33669.1| hypothetical protein MIMGU_mgv1a005896mg [Erythranthe guttata]
Length=466

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 110/188 (59%), Gaps = 4/188 (2%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  ++GAS+ N+A YN N+V++  +  GTP RP V I   +FAL+NENQKPGP +ER++G
Sbjct  275  DEGEVGASVENAAAYNGNLVRRVLTGGGTPLRPDVPIDVYLFALFNENQKPGPTSERNYG  334

Query  531  VLYPNGTNIYPIDLSGK---TPESEFPPLPKPT-TNQPYKGKVWCVVAPAANLTAVADAL  364
            + YPN   +Y I L+        S+      P   ++ + G+ WCV    A    +  AL
Sbjct  335  LFYPNEEKVYDIPLTAAALGVASSKRKVAAAPAHRHRHHSGETWCVANEKAGAEKLQAAL  394

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
             YACG+G   C PIQPG  C++P+++  HAS+AF+SY+ +     G+CYF G A      
Sbjct  395  DYACGEGGADCRPIQPGATCHDPDTIGAHASFAFNSYYQKNARRRGSCYFGGAAYVVTQP  454

Query  183  PSYGACKY  160
            P +G C +
Sbjct  455  PKFGTCDF  462



>ref|XP_006280442.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
 gb|EOA13340.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
Length=457

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 109/190 (57%), Gaps = 8/190 (4%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGA   N+A YN  +VK+  +  GTP +P   +   +FAL+NENQK GP +ER++G
Sbjct  270  DENEIGAGSANAAAYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLSGKT----PESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  364
            + YPN   +Y + LSGK+     E E     KP+    + G+ WCV         + + L
Sbjct  330  LFYPNENKVYDVSLSGKSTPVNDEKEKVTPVKPS----HVGQTWCVANGKTTKEKLQEGL  385

Query  363  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  184
             YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G A      
Sbjct  386  DYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGTGTCDFKGAAYVVSQP  445

Query  183  PSYGACKYPS  154
            P YG C++P+
Sbjct  446  PKYGKCEFPT  455



>gb|EPS68573.1| hypothetical protein M569_06194, partial [Genlisea aurea]
Length=436

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%), Gaps = 2/186 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D D+ GAS+ N+A YN N+V++  +  GTP RP V +   +FAL+NE+QKPGP +ER++G
Sbjct  251  DPDEAGASVENAAAYNGNLVRRVLAGNGTPLRPSVPLQVYLFALFNEDQKPGPTSERNYG  310

Query  531  VLYPNGTNIY--PIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            + YP+   +Y  P+  +G    +E   +  P  +     + WCV    A    +  AL Y
Sbjct  311  LFYPDEQKVYDVPLTAAGLDEATEVSKIQSPPGSFAGGSQTWCVANEDAGTDKLQQALDY  370

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG     C PIQPG  CY+PN+L+ HAS+AF+SY+       G+C F G A      P+
Sbjct  371  ACGNSLVNCRPIQPGATCYDPNTLLAHASFAFNSYYQMMDRASGSCDFGGGAHVVSQPPN  430

Query  177  YGACKY  160
            +G C++
Sbjct  431  FGNCRF  436



>gb|EPS59841.1| hypothetical protein M569_14964, partial [Genlisea aurea]
Length=461

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 110/187 (59%), Gaps = 2/187 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N+V++  +  GTP RP V +   +FAL+NENQK GP +ER++G
Sbjct  275  DANEVGASVGNAAAYNGNLVRRVLAGNGTPLRPTVPLNVYLFALFNENQKTGPTSERNYG  334

Query  531  VLYPNGTNIY--PIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSY  358
            + YP+   +Y  P+  +G +  +    +  P       G+ WCV    +    +  AL Y
Sbjct  335  LFYPDEQKVYNIPLTAAGLSAGTGVSRIQTPPPEGAAAGETWCVANQDSGSEKLQRALDY  394

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+G   C PIQPG  CY+P+SL+ HAS+AF+SY+       G C F G A      P+
Sbjct  395  ACGEGGANCRPIQPGATCYHPDSLLAHASFAFNSYYQASDRRSGACDFAGAAHVVTQPPN  454

Query  177  YGACKYP  157
            YG C++P
Sbjct  455  YGNCQFP  461



>ref|XP_002864380.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40639.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 108/187 (58%), Gaps = 2/187 (1%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGA   N+A YN  +VK+  +  GTP +P   +   +FAL+NENQK GP +ER++G
Sbjct  274  DENEIGAGSANAAAYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYG  333

Query  531  VLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYA  355
            + YPN   +Y + LSGK TP ++      P     + G+ WCV         + + L YA
Sbjct  334  LFYPNENKVYDVSLSGKSTPVNDNKEKVVPV-KPSHVGQTWCVANGKTTKEKLQEGLDYA  392

Query  354  CGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSY  175
            CG+G   C PIQPG  CYNP SL  HASYAF+SY+ +     GTC F G A      P Y
Sbjct  393  CGEGGADCRPIQPGATCYNPESLEAHASYAFNSYYQKNARGVGTCDFGGAAYVVSQPPKY  452

Query  174  GACKYPS  154
            G C++P+
Sbjct  453  GKCEFPT  459



>ref|XP_009628415.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nicotiana tomentosiformis]
Length=471

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 112/198 (57%), Gaps = 12/198 (6%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  ++GAS+ N+A YN N+V++  +  GTP RP   I   +FAL+NEN+KPGP +ER+FG
Sbjct  272  DDIEVGASVDNAAAYNGNLVRRILTGGGTPLRPKEDITVFLFALFNENKKPGPTSERNFG  331

Query  531  VLYPNGTNIY--PIDLSGKTP--ESEFPPLPKPTTNQPYKGKV--------WCVVAPAAN  388
            + YPN   +Y  P+++ G     + + P        +  KG V        WCV +  A 
Sbjct  332  LFYPNERKVYDIPLNMEGLKHYIDRQSPVAGGERMQKGGKGNVSPSVPGQTWCVASGEAG  391

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
               +  AL +ACG+G   C  IQPG  CYNPN+L  HASYAF+SY+ +     G+CYF G
Sbjct  392  KDNLQAALDFACGEGGADCRSIQPGSTCYNPNTLEAHASYAFNSYYQKKGRAMGSCYFGG  451

Query  207  LAVKTINDPSYGACKYPS  154
             A      P YG C+ P+
Sbjct  452  AAYIVHQQPKYGNCELPT  469



>ref|XP_009771279.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like, partial 
[Nicotiana sylvestris]
Length=455

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 112/198 (57%), Gaps = 12/198 (6%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D  ++GAS+ N+A YN N+V++  +  GTP RP   I   +FAL+NEN+KPGP +ER+FG
Sbjct  256  DDIEVGASLDNAAAYNGNLVRRILTGGGTPLRPKEDITVFLFALFNENKKPGPTSERNFG  315

Query  531  VLYPNGTNIY--PIDLSGKTP--ESEFPPLPKPTTNQPYKGKV--------WCVVAPAAN  388
            + YPN   +Y  P+++ G     + + P        +  KG V        WCV +  A 
Sbjct  316  LFYPNERKVYDIPLNMEGLKHYIDRQSPVAGGERMQKGGKGNVSAGVPGQTWCVASGEAG  375

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
               +  AL +ACG+G   C  IQPG  CYNPN+L  HASYAF+SY+ +     G+CYF G
Sbjct  376  KDNLQAALDFACGEGGADCRSIQPGSTCYNPNTLEAHASYAFNSYYQKKGRAMGSCYFGG  435

Query  207  LAVKTINDPSYGACKYPS  154
             A      P YG C+ P+
Sbjct  436  AAYIVHQQPKYGNCELPT  453



>gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 112/198 (57%), Gaps = 12/198 (6%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D +++GAS+ N+A YN N++++  +  GTP RP   +   +FAL+NENQK GP +ER++G
Sbjct  270  DENELGASLQNAAAYNGNLIRRILTGGGTPLRPKADLTVYLFALFNENQKNGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLSGK---------TPESEFPPLPKPT---TNQPYKGKVWCVVAPAAN  388
            + YPN   +Y I  + +         +P S    +  P     ++   G  WCV      
Sbjct  330  LFYPNEQKVYDIPFTVEGLKNYKDNPSPASGGQQVTNPVNGGVSKSTTGNTWCVANSEVG  389

Query  387  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  208
               +   L +ACG+G   C PIQPG +CYNPN++  HAS+AF+SY+ +     GTCYF G
Sbjct  390  KEKLQAGLDFACGEGGADCRPIQPGASCYNPNTIEAHASFAFNSYYQKNGRKAGTCYFGG  449

Query  207  LAVKTINDPSYGACKYPS  154
             A+     P YG C++P+
Sbjct  450  SALVVTQAPKYGECEFPT  467



>ref|NP_194413.2| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEE85258.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=455

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 109/188 (58%), Gaps = 6/188 (3%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPGP +ER++G
Sbjct  270  DENEIGASESNAAAYNAGLVKRVLTGKGTPLRPTEPLNVYLFALFNENQKPGPTSERNYG  329

Query  531  VLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVADALSY  358
            + YPN   +Y +  + K+      P+       P  ++G  WCV         + +AL Y
Sbjct  330  LFYPNEGKVYNVPFTKKSTT----PVNGNRGKVPVTHEGHTWCVSNGEVAKEKLQEALDY  385

Query  357  ACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPS  178
            ACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC+F G A      P 
Sbjct  386  ACGEGGADCRPIQPGATCYHPESLEAHASYAFNSYYQKNSRRVGTCFFGGAAHVVTQPPR  445

Query  177  YGACKYPS  154
            YG C++P+
Sbjct  446  YGKCEFPT  453



>ref|XP_002278044.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
 emb|CBI26687.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 108/199 (54%), Gaps = 13/199 (7%)
 Frame = -3

Query  711  DVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFG  532
            D ++IGAS  N+A YN N++K+  +  GTP RP   +   +FAL+NENQK GP +ER++G
Sbjct  271  DENEIGASTDNAAAYNGNLIKRVLTGGGTPLRPNEPLNVYLFALFNENQKTGPTSERNYG  330

Query  531  VLYPNGTNIYPIDLS-------GKTP------ESEFPPLPKPTTNQPYKGKVWCVVAPAA  391
            + YPN   +Y I L+       G TP      +   PP           G+ WCV    A
Sbjct  331  LFYPNKEKVYNIPLTMEALKATGSTPINGSKVQVTSPPTASEEVTTAAVGQTWCVANGEA  390

Query  390  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  211
                +   L YACG+G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GTC F 
Sbjct  391  GAEKLQAGLDYACGEGGADCRPIQEGSTCYNPNTLEAHASYAFNSYYQKNTRGAGTCNFG  450

Query  210  GLAVKTINDPSYGACKYPS  154
            G A      P +G C++P+
Sbjct  451  GAAHVVTQTPKFGNCEFPT  469



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380