BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033J17

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621460.1|  PREDICTED: uncharacterized protein LOC104113074    167   3e-47   Nicotiana tomentosiformis
ref|XP_009764325.1|  PREDICTED: WD repeat-containing protein 44-like    168   1e-44   Nicotiana sylvestris
ref|XP_006343802.1|  PREDICTED: WD repeat-containing protein 44-like    166   6e-44   Solanum tuberosum [potatoes]
ref|XP_004245475.1|  PREDICTED: uncharacterized protein LOC101244103    165   2e-43   Solanum lycopersicum
ref|XP_006352232.1|  PREDICTED: uncharacterized protein LOC102579...    157   1e-40   Solanum tuberosum [potatoes]
ref|XP_009770473.1|  PREDICTED: WD repeat-containing protein 44-like    157   1e-40   Nicotiana sylvestris
ref|XP_004244644.1|  PREDICTED: uncharacterized WD repeat-contain...    154   1e-39   Solanum lycopersicum
ref|XP_004244645.1|  PREDICTED: uncharacterized WD repeat-contain...    153   3e-39   Solanum lycopersicum
emb|CDP12205.1|  unnamed protein product                                151   1e-38   Coffea canephora [robusta coffee]
ref|XP_009625118.1|  PREDICTED: WD repeat-containing protein 44-like    151   1e-38   Nicotiana tomentosiformis
ref|XP_011101012.1|  PREDICTED: protein tipD-like                       150   2e-38   Sesamum indicum [beniseed]
ref|XP_010106343.1|  WD repeat-containing protein 44                    147   4e-37   Morus notabilis
gb|EYU45249.1|  hypothetical protein MIMGU_mgv1a002075mg                144   4e-36   Erythranthe guttata [common monkey flower]
emb|CBI34556.3|  unnamed protein product                                140   1e-34   Vitis vinifera
ref|XP_010659824.1|  PREDICTED: uncharacterized protein LOC100249640    135   1e-32   Vitis vinifera
ref|XP_009359575.1|  PREDICTED: uncharacterized WD repeat-contain...    134   1e-32   
ref|XP_002518879.1|  WD-repeat protein, putative                        134   2e-32   Ricinus communis
ref|XP_008390309.1|  PREDICTED: uncharacterized protein LOC103452581    133   5e-32   
ref|XP_009344051.1|  PREDICTED: uncharacterized WD repeat-contain...    133   6e-32   
ref|XP_002297958.2|  hypothetical protein POPTR_0001s11110g             131   2e-31   
ref|XP_006584780.1|  PREDICTED: WD repeat-containing protein 44-like    130   6e-31   Glycine max [soybeans]
ref|XP_008239197.1|  PREDICTED: uncharacterized protein LOC103337808    129   1e-30   
ref|XP_007160204.1|  hypothetical protein PHAVU_002G301700g             129   1e-30   Phaseolus vulgaris [French bean]
ref|XP_010053091.1|  PREDICTED: WD repeat-containing protein 44-like    128   3e-30   Eucalyptus grandis [rose gum]
ref|XP_003525326.1|  PREDICTED: WD repeat-containing protein 44-like    128   3e-30   Glycine max [soybeans]
ref|XP_007039450.1|  Transducin/WD40 repeat-like superfamily prot...    127   4e-30   
ref|XP_007210339.1|  hypothetical protein PRUPE_ppa001944mg             127   4e-30   Prunus persica
gb|EPS61764.1|  hypothetical protein M569_13028                         126   5e-30   Genlisea aurea
gb|KDP25243.1|  hypothetical protein JCGZ_20399                         127   6e-30   Jatropha curcas
ref|XP_007039448.1|  Transducin/WD40 repeat-like superfamily prot...    127   8e-30   
ref|XP_007039449.1|  Transducin/WD40 repeat-like superfamily prot...    127   8e-30   
ref|XP_006368793.1|  hypothetical protein POPTR_0001s11110g             127   1e-29   
gb|KJB39576.1|  hypothetical protein B456_007G020200                    126   2e-29   Gossypium raimondii
ref|XP_011026824.1|  PREDICTED: uncharacterized protein LOC105127282    126   2e-29   Populus euphratica
ref|XP_002304571.2|  hypothetical protein POPTR_0003s14440g             125   2e-29   
ref|XP_011075952.1|  PREDICTED: WD repeat-containing protein 44         125   3e-29   Sesamum indicum [beniseed]
dbj|BAH20268.1|  AT1G64610                                              123   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176642.1|  WD40 domain-containing protein                        123   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19687.1|AC009519_21  F1N19.18                                     123   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234700.1|  PREDICTED: uncharacterized protein LOC103333609    122   4e-28   Prunus mume [ume]
gb|KEH21290.1|  transducin/WD40 repeat protein                          122   4e-28   Medicago truncatula
ref|XP_009358661.1|  PREDICTED: vegetative incompatibility protei...    121   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_009358663.1|  PREDICTED: uncharacterized protein LOC103949...    121   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_008388376.1|  PREDICTED: uncharacterized protein LOC103450778    121   7e-28   
ref|XP_002886335.1|  WD-40 repeat family protein                        121   7e-28   
ref|XP_006491984.1|  PREDICTED: WD repeat-containing protein 44-like    121   7e-28   Citrus sinensis [apfelsine]
gb|KDO59631.1|  hypothetical protein CISIN_1g005352mg                   121   7e-28   Citrus sinensis [apfelsine]
ref|XP_006441153.1|  hypothetical protein CICLE_v10019098mg             121   8e-28   Citrus clementina [clementine]
gb|KHG04867.1|  WD repeat-containing protein 44                         121   9e-28   Gossypium arboreum [tree cotton]
ref|XP_004300485.1|  PREDICTED: WD repeat-containing protein 3          121   1e-27   Fragaria vesca subsp. vesca
gb|EYU25256.1|  hypothetical protein MIMGU_mgv1a027154mg                120   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_007220614.1|  hypothetical protein PRUPE_ppa002072mg             119   3e-27   
gb|KHF97548.1|  WD repeat-containing 44                                 119   3e-27   Gossypium arboreum [tree cotton]
ref|XP_010252806.1|  PREDICTED: WD repeat-containing protein 44         119   7e-27   Nelumbo nucifera [Indian lotus]
ref|NP_200162.1|  transducin/WD40 domain-containing protein             118   9e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CBI23039.3|  unnamed protein product                                118   9e-27   Vitis vinifera
ref|XP_004503569.1|  PREDICTED: uncharacterized protein LOC101510067    118   1e-26   Cicer arietinum [garbanzo]
ref|XP_010473727.1|  PREDICTED: WD repeat-containing protein 44-like    117   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010442916.1|  PREDICTED: WD repeat-containing protein 44-like    117   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002271917.2|  PREDICTED: WD repeat-containing protein YMR102C    117   1e-26   Vitis vinifera
ref|XP_002870596.1|  WD-40 repeat family protein                        117   1e-26   
ref|XP_006283216.1|  hypothetical protein CARUB_v10004247mg             117   2e-26   Capsella rubella
ref|XP_006300843.1|  hypothetical protein CARUB_v10019937mg             116   2e-26   Capsella rubella
gb|KHG23616.1|  WD repeat-containing 44                                 116   6e-26   Gossypium arboreum [tree cotton]
gb|KJB09622.1|  hypothetical protein B456_001G153400                    116   6e-26   Gossypium raimondii
ref|XP_006280149.1|  hypothetical protein CARUB_v10026048mg             115   6e-26   Capsella rubella
ref|XP_011022443.1|  PREDICTED: WD repeat-containing protein 44-like    115   7e-26   Populus euphratica
ref|XP_002865975.1|  WD-40 repeat family protein                        115   7e-26   
gb|KJB18927.1|  hypothetical protein B456_003G075300                    115   9e-26   Gossypium raimondii
gb|KDP23830.1|  hypothetical protein JCGZ_00073                         115   9e-26   Jatropha curcas
ref|XP_010430602.1|  PREDICTED: WD repeat-containing protein 44         115   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004309119.1|  PREDICTED: WD repeat-containing protein 44-like    115   1e-25   Fragaria vesca subsp. vesca
ref|XP_002318441.1|  WD-40 repeat family protein                        114   2e-25   
ref|NP_199016.1|  WD40 domain-containing protein                        114   2e-25   
ref|XP_008437633.1|  PREDICTED: WD repeat-containing protein 44-l...    114   3e-25   Cucumis melo [Oriental melon]
gb|KCW89127.1|  hypothetical protein EUGRSUZ_A01444                     114   3e-25   Eucalyptus grandis [rose gum]
ref|XP_004143851.1|  PREDICTED: uncharacterized protein LOC101204856    114   3e-25   Cucumis sativus [cucumbers]
ref|XP_010048920.1|  PREDICTED: WD repeat-containing protein 44         114   3e-25   Eucalyptus grandis [rose gum]
ref|XP_004498503.1|  PREDICTED: WD repeat-containing protein 44-like    114   3e-25   Cicer arietinum [garbanzo]
ref|XP_010441382.1|  PREDICTED: WD repeat-containing protein 44-l...    114   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_011084533.1|  PREDICTED: WD repeat-containing protein 44         113   4e-25   Sesamum indicum [beniseed]
ref|XP_008437430.1|  PREDICTED: uncharacterized protein LOC103482847    113   4e-25   Cucumis melo [Oriental melon]
ref|XP_010482750.1|  PREDICTED: WD repeat-containing protein 44-like    112   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009351967.1|  PREDICTED: uncharacterized protein LOC103943394    112   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_010436150.1|  PREDICTED: WD repeat-containing protein 44-l...    112   8e-25   
ref|XP_008376769.1|  PREDICTED: vegetative incompatibility protei...    112   8e-25   Malus domestica [apple tree]
ref|XP_010446951.1|  PREDICTED: WD repeat-containing protein 44-like    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011024872.1|  PREDICTED: WD repeat-containing protein 44-l...    112   1e-24   Populus euphratica
ref|XP_008437636.1|  PREDICTED: WD repeat-containing protein 44-l...    112   1e-24   Cucumis melo [Oriental melon]
ref|XP_011023150.1|  PREDICTED: F-box-like/WD repeat-containing p...    112   1e-24   Populus euphratica
ref|XP_011024870.1|  PREDICTED: WD repeat-containing protein 44-l...    112   1e-24   Populus euphratica
gb|EYU19664.1|  hypothetical protein MIMGU_mgv1a007057mg                109   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_011024871.1|  PREDICTED: WD repeat-containing protein 44-l...    112   2e-24   Populus euphratica
ref|XP_010940865.1|  PREDICTED: WD repeat-containing protein YMR1...    112   2e-24   Elaeis guineensis
emb|CDY68513.1|  BnaCnng59300D                                          111   2e-24   Brassica napus [oilseed rape]
ref|XP_006857843.1|  hypothetical protein AMTR_s00069p00055450          111   3e-24   Amborella trichopoda
ref|XP_008775396.1|  PREDICTED: WD repeat-containing protein 44         110   3e-24   Phoenix dactylifera
ref|XP_009588536.1|  PREDICTED: WD repeat-containing protein 44-l...    110   4e-24   Nicotiana tomentosiformis
gb|KJB19862.1|  hypothetical protein B456_003G122000                    110   4e-24   Gossypium raimondii
ref|XP_009588525.1|  PREDICTED: WD repeat-containing protein 44-l...    110   5e-24   Nicotiana tomentosiformis
emb|CDP05030.1|  unnamed protein product                                110   5e-24   Coffea canephora [robusta coffee]
ref|XP_010109232.1|  WD repeat-containing protein 44                    110   5e-24   Morus notabilis
ref|XP_009361332.1|  PREDICTED: uncharacterized protein LOC103951627    110   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_009127162.1|  PREDICTED: WD repeat-containing protein 44-like    109   7e-24   Brassica rapa
ref|XP_010694812.1|  PREDICTED: WD repeat-containing protein 44-like    110   7e-24   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX67522.1|  BnaA07g15620D                                          108   2e-23   
gb|KDO59630.1|  hypothetical protein CISIN_1g005352mg                   108   2e-23   Citrus sinensis [apfelsine]
ref|XP_002302646.2|  hypothetical protein POPTR_0002s17470g             108   2e-23   
gb|KEH35471.1|  transducin/WD40 repeat protein                          108   2e-23   Medicago truncatula
ref|XP_006439270.1|  hypothetical protein CICLE_v10019710mg             107   2e-23   
ref|XP_010454738.1|  PREDICTED: uncharacterized WD repeat-contain...    108   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006287156.1|  hypothetical protein CARUB_v10000330mg             108   3e-23   Capsella rubella
ref|XP_008381066.1|  PREDICTED: striatin homolog                        108   3e-23   Malus domestica [apple tree]
ref|XP_006401696.1|  hypothetical protein EUTSA_v10012916mg             107   3e-23   Eutrema salsugineum [saltwater cress]
ref|XP_008803044.1|  PREDICTED: WD repeat-containing protein 44-like    107   4e-23   Phoenix dactylifera
gb|KDO76652.1|  hypothetical protein CISIN_1g004410mg                   107   5e-23   Citrus sinensis [apfelsine]
ref|XP_004145945.1|  PREDICTED: WD repeat-containing protein 44-like    107   5e-23   
emb|CDX88095.1|  BnaA06g26860D                                          107   5e-23   
ref|XP_010445864.1|  PREDICTED: WD repeat-containing protein 44-like    107   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010421260.1|  PREDICTED: uncharacterized WD repeat-contain...    107   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010493579.1|  PREDICTED: uncharacterized WD repeat-contain...    107   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008790515.1|  PREDICTED: uncharacterized protein LOC103707703    107   7e-23   Phoenix dactylifera
ref|XP_006476326.1|  PREDICTED: WD repeat-containing protein YMR1...    107   7e-23   Citrus sinensis [apfelsine]
ref|XP_007051501.1|  Transducin/WD40 repeat superfamily protein i...    107   8e-23   
ref|XP_007051502.1|  Transducin/WD40 repeat superfamily protein i...    107   8e-23   
emb|CDX80433.1|  BnaC07g30110D                                          106   1e-22   
ref|XP_010245259.1|  PREDICTED: transcription initiation factor T...    106   1e-22   Nelumbo nucifera [Indian lotus]
emb|CDY14377.1|  BnaA10g06780D                                          105   1e-22   Brassica napus [oilseed rape]
ref|XP_009119898.1|  PREDICTED: WD repeat-containing protein 44         105   1e-22   Brassica rapa
ref|XP_003522540.1|  PREDICTED: WD repeat-containing protein 44-like    106   2e-22   Glycine max [soybeans]
ref|NP_851068.1|  transducin/WD40 domain-containing protein             105   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KHN19514.1|  WD repeat-containing protein 44                         105   2e-22   Glycine soja [wild soybean]
ref|NP_197820.2|  transducin/WD40 domain-containing protein             105   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394689.1|  hypothetical protein EUTSA_v10003733mg             105   2e-22   Eutrema salsugineum [saltwater cress]
gb|KDP28461.1|  hypothetical protein JCGZ_14232                         105   3e-22   Jatropha curcas
ref|XP_009788735.1|  PREDICTED: WD repeat-containing protein 44-like    105   3e-22   Nicotiana sylvestris
ref|XP_007039112.1|  Transducin/WD40 repeat-like superfamily prot...    105   3e-22   Theobroma cacao [chocolate]
ref|XP_002321388.1|  WD-40 repeat family protein                        105   4e-22   
ref|XP_009150956.1|  PREDICTED: vegetative incompatibility protei...    104   4e-22   Brassica rapa
ref|XP_007039113.1|  Transducin/WD40 repeat-like superfamily prot...    104   4e-22   
ref|XP_009125213.1|  PREDICTED: uncharacterized protein LOC103850247    105   4e-22   Brassica rapa
ref|XP_002874189.1|  predicted protein                                  104   4e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_004240961.1|  PREDICTED: WD repeat-containing protein 44         104   5e-22   Solanum lycopersicum
ref|XP_007136464.1|  hypothetical protein PHAVU_009G047400g             104   5e-22   Phaseolus vulgaris [French bean]
ref|XP_002534336.1|  WD-repeat protein, putative                        104   6e-22   Ricinus communis
emb|CDY13372.1|  BnaC06g13850D                                          104   6e-22   Brassica napus [oilseed rape]
ref|XP_006360158.1|  PREDICTED: WD repeat-containing protein 44-like    104   7e-22   
ref|XP_003527990.1|  PREDICTED: WD repeat-containing protein 44-like    103   1e-21   Glycine max [soybeans]
emb|CDY35661.1|  BnaC09g29830D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_006350514.1|  PREDICTED: WD repeat-containing protein YMR1...    103   2e-21   Solanum tuberosum [potatoes]
ref|XP_006382834.1|  WD-40 repeat family protein                        102   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011044680.1|  PREDICTED: WD repeat-containing protein 44         102   2e-21   Populus euphratica
ref|XP_008669015.1|  PREDICTED: WD repeat-containing protein 44-like    102   2e-21   Zea mays [maize]
ref|XP_010541487.1|  PREDICTED: WD repeat-containing protein 44         102   3e-21   Tarenaya hassleriana [spider flower]
ref|XP_002446949.1|  hypothetical protein SORBIDRAFT_06g025690          102   3e-21   Sorghum bicolor [broomcorn]
gb|EPS62097.1|  hypothetical protein M569_12696                         100   4e-21   Genlisea aurea
ref|XP_004502686.1|  PREDICTED: WD repeat-containing protein 44-like    101   5e-21   Cicer arietinum [garbanzo]
gb|KHG23923.1|  putative WD repeat-containing C3H5.08c                  100   9e-21   Gossypium arboreum [tree cotton]
ref|XP_010933844.1|  PREDICTED: WD repeat-containing protein 44 i...    100   2e-20   Elaeis guineensis
ref|XP_010933843.1|  PREDICTED: WD repeat-containing protein 44 i...    100   2e-20   Elaeis guineensis
ref|XP_011023006.1|  PREDICTED: WD repeat-containing protein 44-like  99.8    3e-20   Populus euphratica
gb|KJB18688.1|  hypothetical protein B456_003G065400                  99.4    3e-20   Gossypium raimondii
ref|XP_009631166.1|  PREDICTED: uncharacterized protein LOC104120...  99.4    3e-20   Nicotiana tomentosiformis
ref|XP_009631159.1|  PREDICTED: uncharacterized protein LOC104120...  99.4    3e-20   Nicotiana tomentosiformis
ref|XP_004976524.1|  PREDICTED: uncharacterized WD repeat-contain...  99.0    4e-20   Setaria italica
ref|XP_011032355.1|  PREDICTED: WD repeat-containing protein 44-like  99.0    5e-20   Populus euphratica
ref|XP_010100708.1|  WD repeat-containing protein 44                  99.0    5e-20   Morus notabilis
ref|XP_002468648.1|  hypothetical protein SORBIDRAFT_01g049570        99.0    5e-20   Sorghum bicolor [broomcorn]
gb|KJB52541.1|  hypothetical protein B456_008G267100                  98.6    6e-20   Gossypium raimondii
emb|CDY47074.1|  BnaA03g12240D                                        98.2    6e-20   Brassica napus [oilseed rape]
emb|CDY53898.1|  BnaA09g53050D                                        98.2    7e-20   Brassica napus [oilseed rape]
ref|XP_009132471.1|  PREDICTED: WD repeat-containing protein 44-like  97.8    7e-20   Brassica rapa
ref|XP_004985995.1|  PREDICTED: WD repeat-containing protein 44-like  98.2    8e-20   Setaria italica
emb|CDY38748.1|  BnaC03g15010D                                        97.8    8e-20   Brassica napus [oilseed rape]
ref|XP_010553565.1|  PREDICTED: WD repeat-containing protein YMR1...  98.2    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_004234989.1|  PREDICTED: uncharacterized protein LOC101265109  98.2    8e-20   Solanum lycopersicum
gb|AGT17419.1|  signal transducer                                     98.2    8e-20   Saccharum hybrid cultivar R570
ref|XP_009597709.1|  PREDICTED: uncharacterized WD repeat-contain...  98.2    8e-20   Nicotiana tomentosiformis
ref|XP_009112863.1|  PREDICTED: WD repeat-containing protein 44       97.8    1e-19   
ref|XP_003588487.1|  WD repeat-containing protein                     98.2    1e-19   
emb|CDY53435.1|  BnaCnng25150D                                        97.4    1e-19   Brassica napus [oilseed rape]
dbj|BAJ99227.1|  predicted protein                                    97.4    1e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010520951.1|  PREDICTED: WD repeat-containing protein 44-like  97.4    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_008775006.1|  PREDICTED: WD repeat-containing protein 44-like  97.1    2e-19   Phoenix dactylifera
ref|XP_006652653.1|  PREDICTED: WD repeat-containing protein 44-like  96.7    2e-19   Oryza brachyantha
ref|XP_009390051.1|  PREDICTED: uncharacterized protein LOC103976536  96.7    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009781900.1|  PREDICTED: uncharacterized WD repeat-contain...  96.7    3e-19   Nicotiana sylvestris
ref|XP_002517227.1|  WD-repeat protein, putative                      96.3    3e-19   Ricinus communis
ref|XP_010931045.1|  PREDICTED: lissencephaly-1 homolog 1-like        96.3    3e-19   Elaeis guineensis
gb|KDP26132.1|  hypothetical protein JCGZ_22233                       96.3    3e-19   Jatropha curcas
ref|XP_009379832.1|  PREDICTED: 2-deoxy-glucose resistant protein...  96.3    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537067.1|  PREDICTED: uncharacterized WD repeat-contain...  95.9    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_002523311.1|  WD-repeat protein, putative                      95.5    5e-19   
ref|XP_002264456.1|  PREDICTED: WD repeat-containing protein YMR1...  94.7    1e-18   
ref|XP_004148673.1|  PREDICTED: uncharacterized protein LOC101207772  94.0    2e-18   Cucumis sativus [cucumbers]
ref|XP_007206323.1|  hypothetical protein PRUPE_ppa002479mg           94.0    2e-18   Prunus persica
gb|EMT30395.1|  hypothetical protein F775_32248                       93.6    3e-18   
ref|XP_006650977.1|  PREDICTED: WD repeat-containing protein 44-like  93.6    3e-18   Oryza brachyantha
ref|XP_010312469.1|  PREDICTED: uncharacterized WD repeat-contain...  92.0    8e-18   Solanum lycopersicum
ref|XP_009787742.1|  PREDICTED: uncharacterized protein LOC104235...  92.0    9e-18   Nicotiana sylvestris
ref|XP_009787741.1|  PREDICTED: uncharacterized protein LOC104235...  92.0    9e-18   Nicotiana sylvestris
tpg|DAA42921.1|  TPA: signal transducer                               92.0    1e-17   
ref|XP_009383058.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  89.4    1e-17   
ref|XP_010919285.1|  PREDICTED: uncharacterized protein LOC105043...  92.0    1e-17   Elaeis guineensis
ref|XP_009401778.1|  PREDICTED: uncharacterized protein LOC103985...  92.0    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676850.1|  PREDICTED: uncharacterized WD repeat-contain...  91.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009401780.1|  PREDICTED: uncharacterized protein LOC103985...  92.0    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397845.1|  PREDICTED: uncharacterized protein LOC103982598  91.7    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010247260.1|  PREDICTED: WD repeat-containing protein 44-l...  91.7    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010676851.1|  PREDICTED: uncharacterized WD repeat-contain...  91.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010247261.1|  PREDICTED: WD repeat-containing protein 44-l...  91.7    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010676852.1|  PREDICTED: uncharacterized WD repeat-contain...  91.3    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007048297.1|  Transducin/WD40 repeat-like superfamily prot...  90.9    2e-17   
ref|XP_011099777.1|  PREDICTED: uncharacterized protein LOC105178110  90.9    2e-17   Sesamum indicum [beniseed]
gb|KJB09623.1|  hypothetical protein B456_001G153400                  90.9    2e-17   Gossypium raimondii
gb|KHG04425.1|  WD repeat-containing 44                               90.5    3e-17   Gossypium arboreum [tree cotton]
ref|XP_010671399.1|  PREDICTED: uncharacterized protein LOC104888203  90.5    3e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS66574.1|  WD repeat-containing protein 44                       90.5    4e-17   Triticum urartu
ref|NP_001147943.1|  signal transducer                                90.1    4e-17   Zea mays [maize]
gb|EMT18175.1|  hypothetical protein F775_17680                       89.0    7e-17   
gb|EEE61519.1|  hypothetical protein OsJ_15820                        87.4    9e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008776128.1|  PREDICTED: POC1 centriolar protein homolog B...  89.0    1e-16   
ref|XP_008776130.1|  PREDICTED: uncharacterized protein LOC103696...  89.0    1e-16   Phoenix dactylifera
emb|CBI37573.3|  unnamed protein product                              88.6    1e-16   Vitis vinifera
ref|XP_002275497.1|  PREDICTED: WD repeat-containing protein YMR102C  88.2    2e-16   
ref|XP_004289406.1|  PREDICTED: WD repeat-containing protein 44       88.2    2e-16   Fragaria vesca subsp. vesca
gb|KHN34060.1|  WD repeat-containing protein 44                       87.8    2e-16   Glycine soja [wild soybean]
ref|XP_011026823.1|  PREDICTED: uncharacterized protein LOC105127281  83.2    2e-16   Populus euphratica
ref|XP_008441025.1|  PREDICTED: WD repeat-containing protein 44       87.8    2e-16   Cucumis melo [Oriental melon]
gb|AES72820.2|  transducin/WD-like repeat-protein                     87.8    3e-16   Medicago truncatula
emb|CAH66853.1|  OSIGBa0103M18.5                                      87.8    3e-16   Oryza sativa [red rice]
emb|CAE02246.2|  OSJNBb0032E06.1                                      87.8    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010680260.1|  PREDICTED: uncharacterized WD repeat-contain...  87.0    3e-16   
ref|NP_001053589.1|  Os04g0568400                                     87.4    3e-16   
ref|XP_006350983.1|  PREDICTED: nuclear distribution protein PAC1...  87.4    4e-16   
ref|XP_008361062.1|  PREDICTED: uncharacterized WD repeat-contain...  87.0    4e-16   
ref|XP_003558975.1|  PREDICTED: WD repeat-containing protein 44       87.4    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_010533561.1|  PREDICTED: WD repeat-containing protein 44-like  86.7    6e-16   Tarenaya hassleriana [spider flower]
gb|KJB71300.1|  hypothetical protein B456_011G115900                  86.7    7e-16   Gossypium raimondii
emb|CDP04751.1|  unnamed protein product                              86.3    8e-16   Coffea canephora [robusta coffee]
emb|CDY43049.1|  BnaA03g11960D                                        86.3    8e-16   Brassica napus [oilseed rape]
ref|XP_004952681.1|  PREDICTED: uncharacterized protein LOC101761920  86.3    9e-16   Setaria italica
ref|XP_008231696.1|  PREDICTED: WD repeat-containing protein 44-like  85.9    1e-15   Prunus mume [ume]
ref|XP_003602569.1|  WD repeat-containing protein, putative           85.1    2e-15   
ref|XP_006585325.1|  PREDICTED: WD repeat-containing protein 44-like  84.3    2e-15   Glycine max [soybeans]
gb|KHN29160.1|  WD repeat-containing protein 44                       84.3    2e-15   Glycine soja [wild soybean]
ref|XP_010555742.1|  PREDICTED: WD repeat-containing protein 44-like  84.7    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_004502913.1|  PREDICTED: WD repeat-containing protein 44-l...  84.3    3e-15   Cicer arietinum [garbanzo]
ref|XP_009411470.1|  PREDICTED: uncharacterized protein LOC103993...  84.3    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411471.1|  PREDICTED: uncharacterized protein LOC103993...  84.3    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007159822.1|  hypothetical protein PHAVU_002G270400g           84.0    4e-15   Phaseolus vulgaris [French bean]
ref|XP_010267520.1|  PREDICTED: 2-deoxy-glucose resistant protein 2   83.2    8e-15   Nelumbo nucifera [Indian lotus]
gb|KHN23344.1|  WD repeat-containing protein 44                       83.2    9e-15   Glycine soja [wild soybean]
ref|XP_003524298.1|  PREDICTED: WD repeat-containing protein 44-like  83.2    1e-14   Glycine max [soybeans]
ref|XP_006854606.1|  hypothetical protein AMTR_s00030p00138110        83.2    1e-14   
ref|XP_010544856.1|  PREDICTED: uncharacterized protein LOC104817380  82.4    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_008663185.1|  PREDICTED: uncharacterized protein LOC103641627  82.4    2e-14   Zea mays [maize]
ref|XP_006427813.1|  hypothetical protein CICLE_v10025084mg           81.6    2e-14   
gb|KDO58372.1|  hypothetical protein CISIN_1g005956mg                 82.0    2e-14   Citrus sinensis [apfelsine]
gb|KDO58371.1|  hypothetical protein CISIN_1g005956mg                 81.6    2e-14   Citrus sinensis [apfelsine]
ref|XP_006427812.1|  hypothetical protein CICLE_v10025084mg           81.6    3e-14   Citrus clementina [clementine]
gb|KDO58370.1|  hypothetical protein CISIN_1g005956mg                 81.6    3e-14   Citrus sinensis [apfelsine]
ref|XP_002309892.1|  WD-40 repeat family protein                      80.9    4e-14   
emb|CAH67601.1|  OSIGBa0092M08.13                                     81.3    4e-14   Oryza sativa [red rice]
ref|NP_001052770.1|  Os04g0417800                                     80.9    4e-14   
ref|XP_002447816.1|  hypothetical protein SORBIDRAFT_06g016295        80.9    5e-14   Sorghum bicolor [broomcorn]
ref|XP_007137699.1|  hypothetical protein PHAVU_009G148300g           80.1    8e-14   Phaseolus vulgaris [French bean]
ref|XP_004975600.1|  PREDICTED: WD repeat-containing protein 44-like  79.7    1e-13   Setaria italica
gb|EPS73803.1|  hypothetical protein M569_00953                       77.4    2e-13   Genlisea aurea
ref|XP_003522494.1|  PREDICTED: uncharacterized protein LOC100780...  79.3    2e-13   Glycine max [soybeans]
ref|XP_006406965.1|  hypothetical protein EUTSA_v10020024mg           79.3    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_004503954.1|  PREDICTED: WD repeat-containing protein 44-l...  79.0    2e-13   
ref|XP_004503956.1|  PREDICTED: WD repeat-containing protein 44-l...  78.6    2e-13   Cicer arietinum [garbanzo]
ref|XP_006279997.1|  hypothetical protein CARUB_v10025868mg           79.0    2e-13   Capsella rubella
ref|XP_004503955.1|  PREDICTED: WD repeat-containing protein 44-l...  78.6    2e-13   Cicer arietinum [garbanzo]
ref|XP_003630201.1|  WD repeat-containing protein                     78.6    3e-13   
gb|AET04677.2|  transducin/WD-like repeat-protein                     78.6    3e-13   Medicago truncatula
ref|XP_001781805.1|  predicted protein                                76.3    3e-13   
emb|CAN69136.1|  hypothetical protein VITISV_019124                   78.2    4e-13   Vitis vinifera
gb|KHN09592.1|  WD repeat-containing protein 44                       77.8    4e-13   
ref|XP_006652275.1|  PREDICTED: general transcriptional corepress...  77.8    5e-13   
ref|XP_009132448.1|  PREDICTED: WD repeat-containing protein 44-like  77.8    5e-13   
ref|XP_003528038.1|  PREDICTED: WD repeat-containing protein YMR1...  77.8    5e-13   
ref|XP_009119955.1|  PREDICTED: WD repeat-containing protein 44       77.8    6e-13   
ref|XP_010235507.1|  PREDICTED: WD repeat-containing protein 44-l...  77.4    7e-13   
gb|KJB41583.1|  hypothetical protein B456_007G110600                  77.4    7e-13   
gb|EYU26402.1|  hypothetical protein MIMGU_mgv1a001267mg              77.4    7e-13   
ref|XP_010090876.1|  WD repeat-containing protein 44                  77.0    8e-13   
ref|XP_009146242.1|  PREDICTED: WD repeat-containing protein 44       77.4    8e-13   
ref|XP_010446663.1|  PREDICTED: WD repeat-containing protein 44-like  77.4    9e-13   
ref|XP_003579722.1|  PREDICTED: WD repeat-containing protein 44-like  77.0    1e-12   
ref|XP_011013674.1|  PREDICTED: WD repeat-containing protein 44-l...  77.0    1e-12   
ref|XP_011042491.1|  PREDICTED: WD repeat-containing protein 44-l...  77.0    1e-12   
ref|XP_011013673.1|  PREDICTED: WD repeat-containing protein 44-l...  77.0    1e-12   
ref|XP_010235508.1|  PREDICTED: WD repeat-containing protein 44-l...  76.6    1e-12   
ref|XP_011042489.1|  PREDICTED: WD repeat-containing protein 44-l...  76.6    1e-12   
ref|XP_009393921.1|  PREDICTED: WD repeat-containing protein 44-like  76.6    1e-12   
ref|XP_003572593.1|  PREDICTED: WD repeat-containing protein 44-l...  76.3    2e-12   
emb|CBI20340.3|  unnamed protein product                              76.3    2e-12   
gb|KDP27024.1|  hypothetical protein JCGZ_20959                       76.3    2e-12   
ref|XP_008645768.1|  PREDICTED: uncharacterized protein LOC103627...  75.9    2e-12   
ref|XP_002885089.1|  WD-40 repeat family protein                      75.9    3e-12   
gb|EMS47688.1|  WD repeat-containing protein 44                       75.9    3e-12   
ref|XP_002453952.1|  hypothetical protein SORBIDRAFT_04g022100        75.5    3e-12   
emb|CDY55888.1|  BnaA04g29100D                                        75.5    4e-12   
ref|XP_004244210.1|  PREDICTED: WD repeat-containing protein 44 i...  75.1    4e-12   
ref|XP_002534244.1|  WD-repeat protein, putative                      75.1    4e-12   
ref|XP_004244209.1|  PREDICTED: uncharacterized protein LOC101249...  75.1    5e-12   
ref|XP_010503009.1|  PREDICTED: WD repeat-containing protein 44-like  75.1    5e-12   
ref|XP_008645770.1|  PREDICTED: uncharacterized protein LOC103627...  74.3    6e-12   
ref|XP_002866029.1|  WD-40 repeat family protein                      74.7    6e-12   
emb|CDY14324.1|  BnaA10g07310D                                        74.3    7e-12   
ref|NP_001048752.1|  Os03g0115400                                     74.3    7e-12   
ref|XP_008645769.1|  PREDICTED: uncharacterized protein LOC103627...  74.3    7e-12   
ref|XP_010465516.1|  PREDICTED: WD repeat-containing protein 44-like  74.3    7e-12   
gb|EAY88273.1|  hypothetical protein OsI_09728                        74.3    8e-12   
emb|CBI30564.3|  unnamed protein product                              72.8    8e-12   
ref|XP_009400872.1|  PREDICTED: WD repeat-containing protein YMR1...  74.3    8e-12   
emb|CDY18310.1|  BnaC09g30600D                                        74.3    9e-12   
ref|XP_008667919.1|  PREDICTED: protein phosphatase type 2A regul...  73.9    9e-12   
ref|XP_010442997.1|  PREDICTED: WD repeat-containing protein 44-like  73.9    1e-11   
ref|XP_010482829.1|  PREDICTED: WD repeat-containing protein 44-like  73.9    1e-11   
gb|KFK27037.1|  hypothetical protein AALP_AA8G325800                  73.9    1e-11   
ref|XP_010027691.1|  PREDICTED: WD repeat-containing protein 44       73.6    1e-11   
ref|XP_010644216.1|  PREDICTED: WD repeat-containing protein 44-l...  73.6    1e-11   
ref|NP_001147817.1|  protein phosphatase type 2A regulator/ signa...  73.2    1e-11   
ref|XP_008366762.1|  PREDICTED: WD repeat-containing protein 44-like  73.2    2e-11   
ref|XP_006296948.1|  hypothetical protein CARUB_v10012940mg           72.8    3e-11   
ref|XP_009386077.1|  PREDICTED: WD repeat-containing protein 44-like  72.8    3e-11   
ref|NP_200231.1|  transducin/WD40 domain-containing protein           72.0    5e-11   
ref|XP_009343571.1|  PREDICTED: WD repeat-containing protein 44-like  71.6    5e-11   
ref|XP_010675627.1|  PREDICTED: WD repeat-containing protein 44-l...  71.6    6e-11   
ref|XP_010675626.1|  PREDICTED: WD repeat-containing protein 44-l...  71.6    6e-11   
dbj|BAK00277.1|  predicted protein                                    71.2    7e-11   
ref|XP_006648708.1|  PREDICTED: uncharacterized WD repeat-contain...  71.2    7e-11   
ref|XP_006464715.1|  PREDICTED: WD repeat-containing protein 44-like  71.2    8e-11   
ref|XP_006451928.1|  hypothetical protein CICLE_v10007384mg           71.2    8e-11   
ref|XP_004976314.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    9e-11   
ref|XP_010238654.1|  PREDICTED: uncharacterized protein LOC100842788  71.2    9e-11   
ref|XP_004976313.1|  PREDICTED: WD repeat-containing protein 44-l...  70.9    1e-10   
dbj|BAK02261.1|  predicted protein                                    70.5    1e-10   
ref|XP_001761107.1|  predicted protein                                69.3    1e-10   
gb|EMT29791.1|  hypothetical protein F775_11999                       70.5    1e-10   
ref|XP_008662533.1|  PREDICTED: uncharacterized protein LOC103640...  70.5    1e-10   
ref|XP_008662535.1|  PREDICTED: uncharacterized protein LOC103640...  70.5    1e-10   
gb|EMS49362.1|  WD repeat-containing protein 44                       70.5    1e-10   
ref|XP_002441919.1|  hypothetical protein SORBIDRAFT_08g004850        70.1    2e-10   
emb|CDY56822.1|  BnaC05g37770D                                        70.1    2e-10   
ref|XP_010487372.1|  PREDICTED: WD repeat-containing protein 44-like  69.7    3e-10   
ref|XP_008452480.1|  PREDICTED: WD repeat-containing protein 44 i...  69.3    4e-10   
gb|KJB41582.1|  hypothetical protein B456_007G110600                  68.6    5e-10   
ref|XP_010935623.1|  PREDICTED: WD repeat-containing protein 44-like  68.6    6e-10   
emb|CDX93358.1|  BnaC04g45380D                                        68.2    7e-10   
ref|XP_008349982.1|  PREDICTED: WD repeat-containing protein 44-like  68.2    9e-10   
emb|CDY43837.1|  BnaC03g14700D                                        67.0    2e-09   
gb|EEC77683.1|  hypothetical protein OsI_16737                        67.0    2e-09   
gb|EEE61382.1|  hypothetical protein OsJ_15550                        66.6    2e-09   
emb|CAE02139.2|  OSJNBa0074L08.11                                     66.6    2e-09   
ref|XP_010918446.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  66.6    3e-09   
ref|XP_008452481.1|  PREDICTED: WD repeat-containing protein 44 i...  66.2    3e-09   
ref|XP_004141232.1|  PREDICTED: WD repeat-containing protein 44-like  66.2    3e-09   
dbj|BAK00713.1|  predicted protein                                    65.9    4e-09   
ref|XP_010543310.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  65.5    5e-09   
gb|EMS48390.1|  WD repeat-containing protein 44                       65.5    6e-09   
ref|XP_009393397.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    6e-09   
ref|XP_009394710.1|  PREDICTED: WD repeat-containing protein 44-like  65.5    6e-09   
gb|EEE52865.1|  hypothetical protein OsJ_35420                        65.1    8e-09   
ref|XP_001780848.1|  predicted protein                                64.7    9e-09   
ref|XP_006362948.1|  PREDICTED: WD repeat-containing protein 44-like  64.7    9e-09   
gb|AAG50659.1|AC084242_3  hypothetical protein                        64.3    1e-08   
ref|NP_175318.1|  WD40 domain-containing protein                      64.3    1e-08   
gb|KFK38890.1|  hypothetical protein AALP_AA3G174300                  64.3    1e-08   
ref|XP_009385247.1|  PREDICTED: WD repeat-containing protein 44-like  64.3    1e-08   
dbj|BAD25345.1|  WD-40 repeat protein-like                            63.2    2e-08   
gb|EEC73670.1|  hypothetical protein OsI_08217                        63.5    2e-08   
gb|EEE57449.1|  hypothetical protein OsJ_07666                        63.2    3e-08   
ref|XP_003580346.1|  PREDICTED: WD repeat-containing protein 44-like  63.2    3e-08   
ref|XP_003569955.1|  PREDICTED: WD repeat-containing protein 44       63.2    3e-08   
ref|XP_008679649.1|  PREDICTED: uncharacterized protein LOC103654...  63.2    3e-08   
gb|AFW65473.1|  hypothetical protein ZEAMMB73_473274                  63.2    3e-08   
ref|XP_008679648.1|  PREDICTED: uncharacterized protein LOC103654...  63.2    3e-08   
ref|XP_002894142.1|  hypothetical protein ARALYDRAFT_337011           62.8    4e-08   
emb|CBI40579.3|  unnamed protein product                              62.8    4e-08   
gb|AFW65472.1|  hypothetical protein ZEAMMB73_473274                  62.8    4e-08   
ref|XP_006393338.1|  hypothetical protein EUTSA_v10011347mg           61.2    1e-07   
ref|XP_009147936.1|  PREDICTED: uncharacterized WD repeat-contain...  61.2    1e-07   
ref|NP_001176818.1|  Os12g0178633                                     60.8    2e-07   
ref|NP_001047059.1|  Os02g0539900                                     60.8    2e-07   
gb|EEC68951.1|  hypothetical protein OsI_37676                        60.8    2e-07   
ref|XP_004978305.1|  PREDICTED: WD repeat-containing protein 44-like  60.1    3e-07   
gb|EAY86190.1|  hypothetical protein OsI_07567                        59.7    4e-07   
gb|KHG15203.1|  wdr44                                                 59.7    4e-07   
gb|KHG15202.1|  wdr44                                                 59.7    4e-07   
ref|XP_009401808.1|  PREDICTED: WD repeat-containing protein 44-like  59.7    4e-07   
ref|XP_008226666.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  59.3    5e-07   
ref|XP_004293101.1|  PREDICTED: WD repeat-containing protein 44       58.9    7e-07   
emb|CDY40612.1|  BnaC06g02280D                                        58.5    8e-07   
ref|XP_006348232.1|  PREDICTED: WD repeat-containing protein 44-like  58.9    8e-07   
ref|XP_002446829.1|  hypothetical protein SORBIDRAFT_06g023320        58.2    1e-06   
ref|XP_009774676.1|  PREDICTED: WD repeat-containing protein 44-like  58.2    1e-06   
ref|XP_009378485.1|  PREDICTED: WD repeat-containing protein 44       58.2    1e-06   
ref|XP_003539589.1|  PREDICTED: WD repeat-containing protein 44-like  58.2    1e-06   
emb|CDX93700.1|  BnaA06g03480D                                        57.8    2e-06   
ref|XP_008802494.1|  PREDICTED: WD repeat-containing protein 44-l...  57.8    2e-06   
ref|XP_007214620.1|  hypothetical protein PRUPE_ppa001338mg           57.8    2e-06   
ref|XP_007027038.1|  Transducin/WD40 repeat-like superfamily prot...  57.8    2e-06   
emb|CAE03168.1|  OSJNBa0033G16.13                                     57.4    2e-06   
ref|XP_006306015.1|  hypothetical protein CARUB_v10011309mg           57.4    2e-06   
ref|XP_011098333.1|  PREDICTED: WD repeat-containing protein 44 i...  57.4    2e-06   
ref|XP_009767447.1|  PREDICTED: uncharacterized protein LOC104218607  57.4    2e-06   
ref|XP_007021341.1|  Transducin/WD40 repeat-like superfamily protein  57.4    3e-06   
gb|KHN36799.1|  WD repeat-containing protein 44                       57.0    3e-06   
ref|XP_010461743.1|  PREDICTED: uncharacterized WD repeat-contain...  57.0    3e-06   
ref|XP_007149607.1|  hypothetical protein PHAVU_005G083800g           57.0    3e-06   
gb|KEH38772.1|  transducin/WD-like repeat-protein                     57.0    3e-06   
ref|XP_010907750.1|  PREDICTED: WD repeat-containing protein 44-l...  57.0    3e-06   
ref|XP_006341215.1|  PREDICTED: WD repeat-containing protein 44-like  57.0    3e-06   
ref|XP_004487750.1|  PREDICTED: uncharacterized protein LOC101506788  57.0    4e-06   
ref|XP_009382122.1|  PREDICTED: WD repeat-containing protein 44-like  56.6    4e-06   
ref|XP_010099011.1|  WD repeat-containing protein 44                  56.6    5e-06   
ref|XP_009611531.1|  PREDICTED: WD repeat-containing protein 44-l...  56.6    5e-06   
ref|XP_006653617.1|  PREDICTED: WD repeat-containing protein 44-like  56.2    5e-06   
emb|CDP11271.1|  unnamed protein product                              56.2    6e-06   
emb|CDP05886.1|  unnamed protein product                              56.2    6e-06   
ref|XP_009601332.1|  PREDICTED: WD repeat-containing protein 44-l...  55.8    7e-06   
ref|XP_002270206.1|  PREDICTED: WD repeat-containing protein 44-like  55.8    8e-06   
ref|XP_009611532.1|  PREDICTED: WD repeat-containing protein 44-l...  55.8    8e-06   
ref|XP_010256510.1|  PREDICTED: WD repeat-containing protein 44-like  55.8    8e-06   
ref|XP_010537008.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  55.5    1e-05   
ref|NP_566515.1|  WD40 domain-containing protein                      55.5    1e-05   
ref|XP_004980246.1|  PREDICTED: WD repeat-containing protein 44-like  55.1    1e-05   
ref|XP_008669100.1|  PREDICTED: WD repeat-containing protein 44-like  55.1    1e-05   
ref|XP_009803767.1|  PREDICTED: WD repeat-containing protein 44-l...  55.1    2e-05   
ref|XP_010535112.1|  PREDICTED: WD repeat-containing protein 44       54.7    2e-05   
ref|XP_010479314.1|  PREDICTED: uncharacterized WD repeat-contain...  54.7    2e-05   
ref|XP_009803768.1|  PREDICTED: WD repeat-containing protein 44-l...  54.7    2e-05   
ref|XP_009617547.1|  PREDICTED: uncharacterized protein LOC104109879  54.7    2e-05   
gb|KJB13412.1|  hypothetical protein B456_002G073100                  54.7    2e-05   
ref|XP_006370296.1|  hypothetical protein POPTR_0001s41390g           54.7    2e-05   
gb|KJB36726.1|  hypothetical protein B456_006G173300                  54.7    2e-05   
gb|EYU26583.1|  hypothetical protein MIMGU_mgv1a000854mg              54.7    2e-05   
gb|KJB13413.1|  hypothetical protein B456_002G073100                  54.3    2e-05   
ref|XP_010500424.1|  PREDICTED: uncharacterized WD repeat-contain...  54.3    2e-05   
ref|XP_010325863.1|  PREDICTED: WD repeat-containing protein 44-like  54.3    3e-05   
ref|XP_001777339.1|  predicted protein                                53.9    3e-05   
ref|XP_006349512.1|  PREDICTED: WD repeat-containing protein 44-like  53.5    4e-05   
ref|XP_006827823.1|  hypothetical protein AMTR_s00009p00268480        53.5    4e-05   
ref|XP_010111476.1|  WD repeat-containing protein 44                  53.5    4e-05   
ref|XP_002282052.1|  PREDICTED: WD repeat-containing protein 44-l...  53.1    6e-05   
ref|XP_009627607.1|  PREDICTED: WD repeat-containing protein 44-like  53.1    7e-05   
gb|KHG15000.1|  WD repeat-containing 44                               53.1    7e-05   
gb|EPS57208.1|  hypothetical protein M569_17612                       52.0    1e-04   
ref|XP_002317512.1|  WD-40 repeat family protein                      52.4    1e-04   
gb|KJB84321.1|  hypothetical protein B456_N018300                     52.0    1e-04   
ref|XP_004249562.1|  PREDICTED: WD repeat-containing protein 44-like  52.4    1e-04   
gb|KJB16975.1|  hypothetical protein B456_002G258100                  52.4    1e-04   
ref|XP_004248274.1|  PREDICTED: WD repeat-containing protein 44-like  52.0    1e-04   
ref|XP_010677871.1|  PREDICTED: WD repeat-containing protein 44       52.0    1e-04   
ref|XP_002309053.1|  WD-40 repeat family protein                      52.0    2e-04   
gb|KCW88929.1|  hypothetical protein EUGRSUZ_A01259                   52.0    2e-04   
ref|XP_010242005.1|  PREDICTED: uncharacterized protein LOC104586456  52.0    2e-04   
ref|XP_010047620.1|  PREDICTED: uncharacterized protein LOC104436517  52.0    2e-04   
ref|XP_009385886.1|  PREDICTED: WD repeat-containing protein 44-l...  52.0    2e-04   
gb|EYU44889.1|  hypothetical protein MIMGU_mgv1a005216mg              51.6    2e-04   
ref|XP_009385885.1|  PREDICTED: WD repeat-containing protein 44-l...  51.6    2e-04   
gb|EYU23801.1|  hypothetical protein MIMGU_mgv1a004333mg              51.6    2e-04   
ref|XP_011077463.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.6    2e-04   
ref|XP_004142205.1|  PREDICTED: uncharacterized protein LOC101206616  51.2    2e-04   
emb|CBG76443.1|  OO_Ba0013J05-OO_Ba0033A15.30                         51.2    3e-04   
gb|KGN54248.1|  hypothetical protein Csa_4G295520                     51.2    3e-04   
ref|XP_009408732.1|  PREDICTED: WD repeat-containing protein 44-like  51.2    3e-04   
ref|XP_011095202.1|  PREDICTED: WD repeat-containing protein 44-like  50.8    4e-04   
ref|XP_006429072.1|  hypothetical protein CICLE_v10013628mg           50.4    5e-04   
ref|XP_006480802.1|  PREDICTED: WD repeat-containing protein 44-like  50.4    5e-04   
gb|KDO47180.1|  hypothetical protein CISIN_1g002086mg                 50.4    5e-04   
ref|XP_010245315.1|  PREDICTED: WD repeat-containing protein 44-like  50.4    6e-04   
ref|XP_009786100.1|  PREDICTED: WD repeat-containing protein 44       50.1    7e-04   
ref|XP_011029441.1|  PREDICTED: WD repeat-containing protein 44-like  49.7    9e-04   
ref|XP_006854481.1|  hypothetical protein AMTR_s00175p00024710        49.7    0.001   



>ref|XP_009621460.1| PREDICTED: uncharacterized protein LOC104113074 [Nicotiana tomentosiformis]
Length=232

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 123/180 (68%), Gaps = 26/180 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS----KTVRSYESFYSHNAS  441
            G+RNS    PA+FTSD KH+++VTEDSNV IWNY N+ +T+    K VRS ESF+S+N S
Sbjct  54   GIRNSGSQFPASFTSDGKHILAVTEDSNVHIWNYTNQGRTTTNKPKHVRSSESFFSNNTS  113

Query  440  VVVPWCGAGS---SVPGSMLssgkaists---ssSCCQF----------KGCATWPEEKL  309
            V +PWCG  +   ++P S+L +G A   S   +S C             KG ATWPEEKL
Sbjct  114  VAIPWCGFKTNLGTLPTSVLENGNANENSLPKTSDCFSLGRALFLDSLSKGTATWPEEKL  173

Query  308  PNLSPSPVL----KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            PN SP  V     KS+YKFLKSAWQ AL SSP+LWGLVVVTAG DG IRTFLNYGLPIRF
Sbjct  174  PNSSPVTVTPSVSKSEYKFLKSAWQGAL-SSPHLWGLVVVTAGWDGCIRTFLNYGLPIRF  232



>ref|XP_009764325.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=719

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 122/180 (68%), Gaps = 26/180 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS----KTVRSYESFYSHNAS  441
            G+RNS    PA+FTSD KH+++VTEDSNV IWNY N+ +T+    K VRS ESF+S+NAS
Sbjct  541  GIRNSGSQFPASFTSDGKHILAVTEDSNVHIWNYTNQGRTTTNKPKHVRSSESFFSNNAS  600

Query  440  VVVPWCGAGS---SVPGSMLssgkaist---sssSCCQF----------KGCATWPEEKL  309
            V +PWCG  +   ++P S L +G         +  C             KG ATWPEEKL
Sbjct  601  VAIPWCGFKTNPGTLPTSFLENGNVNENSLPKTLDCFSLGRAFFLDSLSKGTATWPEEKL  660

Query  308  PNLSP---SP-VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            PN SP   +P V KS+YKFLKSAWQ AL SSP+LWGLVVVTAG DG IRTFLNYGLPIRF
Sbjct  661  PNPSPVTVTPSVCKSEYKFLKSAWQGAL-SSPHLWGLVVVTAGWDGCIRTFLNYGLPIRF  719



>ref|XP_006343802.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=728

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 119/181 (66%), Gaps = 28/181 (15%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+RNS    PA+FTSD KH+++VTEDSNV IWNY +        K VRS ESF+S+NASV
Sbjct  550  GIRNSGNQFPASFTSDGKHILAVTEDSNVHIWNYTDQGRRTNKLKKVRSSESFFSNNASV  609

Query  437  VVPWCGAGS---SVPGSMLssgkaist---sssSCCQF----------KGCATWPEEKLP  306
             +PW G  +   ++P S+L +G         +S C             KG ATWPEEKLP
Sbjct  610  AIPWSGFNTNPGTLPRSILENGNVNRNSLPRTSDCFSLGRTFLVDSLSKGSATWPEEKLP  669

Query  305  NLSPSPVL------KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            N S SPV       KS+YKFLKSAWQ AL SSP+LWGLVVVTAGLDG IRTFLNYGLPIR
Sbjct  670  N-SSSPVTVFPSVCKSEYKFLKSAWQGAL-SSPHLWGLVVVTAGLDGCIRTFLNYGLPIR  727

Query  143  F  141
            F
Sbjct  728  F  728



>ref|XP_004245475.1| PREDICTED: uncharacterized protein LOC101244103 [Solanum lycopersicum]
Length=729

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 118/183 (64%), Gaps = 31/183 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE----LQTSKTVRSYESFYSHNASV  438
            G+RNS    PA+FTSD KH+++VTEDSNV IWNY E        K VRS ESF+S+NASV
Sbjct  550  GIRNSGNQFPASFTSDGKHILAVTEDSNVHIWNYTEQGRRTNKPKKVRSSESFFSNNASV  609

Query  437  VVPWCGAGSSVPGSM--------LssgkaistsssSCCQF----------KGCATWPEEK  312
             +PW G  ++ PG++         +  +     +S C             KG ATWPEEK
Sbjct  610  ALPWSGFNTN-PGTLPRSSILENRNVNRNSLPRASDCFSLGRTFLVDSLTKGSATWPEEK  668

Query  311  LPNLSPSPVL------KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            LPN S SPV       KS+YKFLKSAWQ AL SSP+LWGLVVVTAGLDG IRTFLNYGLP
Sbjct  669  LPN-SSSPVTVFPSVCKSEYKFLKSAWQGAL-SSPHLWGLVVVTAGLDGCIRTFLNYGLP  726

Query  149  IRF  141
            IRF
Sbjct  727  IRF  729



>ref|XP_006352232.1| PREDICTED: uncharacterized protein LOC102579447 isoform X1 [Solanum 
tuberosum]
 ref|XP_006352233.1| PREDICTED: uncharacterized protein LOC102579447 isoform X2 [Solanum 
tuberosum]
Length=711

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 118/184 (64%), Gaps = 30/184 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE----LQTSKTVRSYESFYSHNASV  438
            G +N     PA+FTSD KH+++VTEDSNV IWNY+         K VRS ESF+S NASV
Sbjct  529  GTKNLDSQCPASFTSDGKHILAVTEDSNVYIWNYSHEDGVTSQPKKVRSSESFFSQNASV  588

Query  437  VVPWCGAGS----SVPGSMLssgkaistsssSCCQFKGC----------------ATWPE  318
             +PW G  +    ++PG++L++G     S S     + C                ATWPE
Sbjct  589  AIPWSGFKTNPVTTLPGNVLANGDVNENSCSKTSSLQDCFSLGRASFLDSLLKSSATWPE  648

Query  317  EKLPNLSP----SP-VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            EKLP+ SP    SP + KS+YK LKSAWQSAL+SS +LWGLVVVTAGLDG IRTFLN+GL
Sbjct  649  EKLPDSSPPATVSPSICKSEYKILKSAWQSALSSS-HLWGLVVVTAGLDGCIRTFLNHGL  707

Query  152  PIRF  141
            PIRF
Sbjct  708  PIRF  711



>ref|XP_009770473.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
 ref|XP_009770474.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
 ref|XP_009770475.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=719

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 115/183 (63%), Gaps = 29/183 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS---KTVRSYESFYSHNASV  438
            G +N     PA+FTSD KH+++VTEDSNV IWNY NE  T+   K VRS ESF S NASV
Sbjct  538  GTQNLGSQCPASFTSDGKHILAVTEDSNVYIWNYSNEDGTTGQAKKVRSSESFLSQNASV  597

Query  437  VVPWCG----AGSSVPGSMLssgkaistsssSCCQ----------------FKGCATWPE  318
             +PWCG     G+  PGS+L++G     S                       KG  TWPE
Sbjct  598  TIPWCGFKTNPGTLPPGSVLANGDVNENSQPKTSSLQDCFSLGRASFLDSILKGSPTWPE  657

Query  317  EKLPNLSPS----PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            EKLP+ SP+     + KS+YK LKSAWQSAL+SS +LWGLVVVTAG DG IRTFLNYGLP
Sbjct  658  EKLPDSSPANASPSISKSEYKILKSAWQSALSSS-HLWGLVVVTAGWDGCIRTFLNYGLP  716

Query  149  IRF  141
            IR 
Sbjct  717  IRL  719



>ref|XP_004244644.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Solanum lycopersicum]
 ref|XP_010324650.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Solanum lycopersicum]
 ref|XP_010324651.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Solanum lycopersicum]
Length=733

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 123/201 (61%), Gaps = 32/201 (16%)
 Frame = -3

Query  656  YYSNVSETAHLLFPISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE----LQT  489
            ++S  SET  ++     G +      PA+FTSD KH+++VTEDSNV IWNY+        
Sbjct  536  FFSRFSET--VVSAACPGTKKFDSQCPASFTSDGKHILAVTEDSNVYIWNYSHEDGLTSQ  593

Query  488  SKTVRSYESFYSHNASVVVPWCGAGS----SVPGSMLssgkaistsssSCCQFKGC----  333
             K VRS ESF+S NASV +PW G  +    ++PG++L++      S       + C    
Sbjct  594  PKKVRSSESFFSQNASVAIPWSGFKTNPVTTLPGNVLANADVNENSLPKTSSLQECFSLG  653

Query  332  ------------ATWPEEKLPNLSP----SP-VLKSDYKFLKSAWQSALASSPNLWGLVV  204
                        ATWPEEKLP+ +P    SP + KS+YK LKSAWQSAL+SS +LWGLVV
Sbjct  654  RASFLDSLLKSSATWPEEKLPDSNPPSTVSPSICKSEYKILKSAWQSALSSS-HLWGLVV  712

Query  203  VTAGLDGYIRTFLNYGLPIRF  141
            VTAGLDG IRTFLN+GLPIRF
Sbjct  713  VTAGLDGCIRTFLNHGLPIRF  733



>ref|XP_004244645.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X2 [Solanum lycopersicum]
 ref|XP_010324652.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X2 [Solanum lycopersicum]
Length=710

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 115/184 (63%), Gaps = 30/184 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE----LQTSKTVRSYESFYSHNASV  438
            G +      PA+FTSD KH+++VTEDSNV IWNY+         K VRS ESF+S NASV
Sbjct  528  GTKKFDSQCPASFTSDGKHILAVTEDSNVYIWNYSHEDGLTSQPKKVRSSESFFSQNASV  587

Query  437  VVPWCGAGS----SVPGSMLssgkaistsssSCCQFKGC----------------ATWPE  318
             +PW G  +    ++PG++L++      S       + C                ATWPE
Sbjct  588  AIPWSGFKTNPVTTLPGNVLANADVNENSLPKTSSLQECFSLGRASFLDSLLKSSATWPE  647

Query  317  EKLPNLSP----SP-VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            EKLP+ +P    SP + KS+YK LKSAWQSAL+SS +LWGLVVVTAGLDG IRTFLN+GL
Sbjct  648  EKLPDSNPPSTVSPSICKSEYKILKSAWQSALSSS-HLWGLVVVTAGLDGCIRTFLNHGL  706

Query  152  PIRF  141
            PIRF
Sbjct  707  PIRF  710



>emb|CDP12205.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 110/163 (67%), Gaps = 15/163 (9%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS---KTVRSYESFYSHNASV  438
            G++NS     A+FTSD  H+VS+TEDSN+ +WNY N+ QTS   K + ++ESF SHNA++
Sbjct  508  GMKNSGSQASASFTSDGNHIVSITEDSNIYLWNYTNQDQTSAEVKNISAHESFLSHNAAI  567

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPV----LKSDY  270
             +PW G  +  PG++         S      +KG ATWPEEKL   SP+ V     KS++
Sbjct  568  AIPWGGLKTK-PGALHGGRGFFLDSL-----YKGSATWPEEKLAKSSPAAVSPSVYKSEF  621

Query  269  KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            K LK A QSAL SSP+LWGLV+VTAG DG I+TFLNYGLPIRF
Sbjct  622  KSLKGALQSAL-SSPHLWGLVIVTAGWDGCIKTFLNYGLPIRF  663



>ref|XP_009625118.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
 ref|XP_009625119.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
 ref|XP_009625120.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
Length=725

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 114/183 (62%), Gaps = 29/183 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS---KTVRSYESFYSHNASV  438
            G +N     PA+FTSD KH+++VTEDSNV IWNY NE  T+   K VRS ESF S NASV
Sbjct  544  GTQNLGSQCPASFTSDGKHILAVTEDSNVYIWNYSNEDGTTSQAKKVRSSESFLSQNASV  603

Query  437  VVPWCG----AGSSVPGSMLssgkaistsssSCCQF----------------KGCATWPE  318
             +PWCG     G+  PGS+L++G     S                       KG  TWPE
Sbjct  604  TIPWCGFKTNPGTLPPGSVLANGDVNENSQPKTSSLQDCFSLGRASFLDSLLKGSPTWPE  663

Query  317  EKLPNLSPS----PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            EKLP+ +P+     + KS+ K LKSAWQSAL+SS +LWGLVVVTAG DG IRTFLNYGLP
Sbjct  664  EKLPDSNPANASPSISKSECKILKSAWQSALSSS-HLWGLVVVTAGWDGCIRTFLNYGLP  722

Query  149  IRF  141
            IR 
Sbjct  723  IRL  725



>ref|XP_011101012.1| PREDICTED: protein tipD-like [Sesamum indicum]
Length=730

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 118/183 (64%), Gaps = 29/183 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTS--KTVRSYESFYSHNASV  438
            G R+S   VPA+FTSD +H+VSV+EDSNV +WNY  ++ ++S  K V S ESF S NAS+
Sbjct  549  GNRSSGSQVPASFTSDGEHIVSVSEDSNVRVWNYTSHDQKSSRPKNVWSCESFLSRNASI  608

Query  437  VVPWCGAGS---SVPGSMLssgkaistsssS-------CCQF----------KGCATWPE  318
             +PWCG  +   ++PGS+L +G                C             KG ATWPE
Sbjct  609  AIPWCGLKNKLGALPGSILGNGHFDEKLLQKLPASFPDCFTMSFGFFLDALSKGSATWPE  668

Query  317  EKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            EKLP  +P    + V KS++KFLK+AW SAL +SP+LWGLV+VTAG DG IRTFLNYGLP
Sbjct  669  EKLPKSNPMAAKTSVGKSEFKFLKNAWLSAL-NSPHLWGLVIVTAGWDGCIRTFLNYGLP  727

Query  149  IRF  141
            IRF
Sbjct  728  IRF  730



>ref|XP_010106343.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXC52360.1| WD repeat-containing protein 44 [Morus notabilis]
Length=734

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 115/192 (60%), Gaps = 38/192 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS---KTVRSYESFYSHNASV  438
            GVRN+   +PA+FTSD KH+VS TEDSNV IWNY N+ +TS   K + S ESF SHNAS+
Sbjct  544  GVRNAGSQMPASFTSDGKHIVSATEDSNVYIWNYTNQEKTSSRTKNIWSSESFLSHNASI  603

Query  437  VVPWCGAGSS---VP---------GSMLssgkaistsssSCCQF----------------  342
             +PWCG+ ++   +P         GS L  G+          Q                 
Sbjct  604  AIPWCGSKTTPDAIPSPALIGDTRGSGLEHGQKHPYLEEHPQQKVPISSPDCFRGFLESL  663

Query  341  -KGCATWPEEKLPNLSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYI  177
             KG ATWPEEKL N SP  +    L S ++FLKSA QS ++ SP++WGLV+VTAG DG I
Sbjct  664  PKGTATWPEEKLVNSSPMAISPTTLTSKFRFLKSALQS-MSGSPHMWGLVIVTAGWDGRI  722

Query  176  RTFLNYGLPIRF  141
            RTFLNYGLPIR 
Sbjct  723  RTFLNYGLPIRI  734



>gb|EYU45249.1| hypothetical protein MIMGU_mgv1a002075mg [Erythranthe guttata]
Length=718

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 110/177 (62%), Gaps = 24/177 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY------NELQTSKTVRSYESFYSHNA  444
            G R +   VPA FTSD +H++S T++SNV +WNY       +    K V S E+F+S N+
Sbjct  544  GNRGTVSQVPAAFTSDGEHIISATDESNVRVWNYASTPPDQKPSRLKNVFSRETFFSQNS  603

Query  443  SVVVPWCGAGS---SVPGSMLssgkaistsssS---CCQ----------FKGCATWPEEK  312
            S+ +PWCG  +   S+P S+L +             C            ++G ATWPEE+
Sbjct  604  SIAIPWCGLKNKLGSLPASILGNSHFDEKLLQKFPDCLTTSLGFFLDALYRGSATWPEER  663

Query  311  LPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            LP + PS V KS++KFLK++W SA  +SP+LWGLVVVTAG DG IRTFLNYGLPIRF
Sbjct  664  LPPVKPS-VTKSEFKFLKNSWLSAF-NSPHLWGLVVVTAGWDGCIRTFLNYGLPIRF  718



>emb|CBI34556.3| unnamed protein product [Vitis vinifera]
Length=665

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 105/164 (64%), Gaps = 20/164 (12%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            GVRN       +FT+D KH+VS +EDSNV +W+YN    +    K + S ESF SHNA++
Sbjct  513  GVRNVGSHTSTSFTADGKHIVSASEDSNVHLWDYNNQDRASSRAKDIWSCESFLSHNATI  572

Query  437  VVPWCGAGSSV---PGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP-SPVLK-SD  273
             +PWCG  ++    P   L++              +G ATWPEEKLP+ SP SP ++ S+
Sbjct  573  AIPWCGMKTTTETCPSPTLTTKSLP----------RGSATWPEEKLPDSSPFSPSMRRSE  622

Query  272  YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            YKFLKSA Q+  ASSP+ WGLV+VTAG DG+IRT+ NYGLP R 
Sbjct  623  YKFLKSACQNT-ASSPHTWGLVIVTAGWDGWIRTYHNYGLPHRL  665



>ref|XP_010659824.1| PREDICTED: uncharacterized protein LOC100249640 [Vitis vinifera]
Length=727

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 108/180 (60%), Gaps = 26/180 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            GVRN       +FT+D KH+VS +EDSNV +W+YN    +    K + S ESF SHNA++
Sbjct  549  GVRNVGSHTSTSFTADGKHIVSASEDSNVHLWDYNNQDRASSRAKDIWSCESFLSHNATI  608

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF-------KGCATWPEE  315
             +PWCG  +            S+PG       A S    S  +        +G ATWPEE
Sbjct  609  AIPWCGMKTTTETCPSPTLTTSLPGFENGQEMASSPDCFSAAREFLLESLPRGSATWPEE  668

Query  314  KLPNLSP-SPVLK-SDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            KLP+ SP SP ++ S+YKFLKSA Q+  ASSP+ WGLV+VTAG DG+IRT+ NYGLP R 
Sbjct  669  KLPDSSPFSPSMRRSEYKFLKSACQNT-ASSPHTWGLVIVTAGWDGWIRTYHNYGLPHRL  727



>ref|XP_009359575.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Pyrus x bretschneideri]
Length=722

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 102/177 (58%), Gaps = 24/177 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASV  438
            G+RN    + A+FTSD KH+VS ++DSNV IWN+N   T    S+ + S ESF SHN+ +
Sbjct  546  GLRNGGNHMSASFTSDGKHIVSASDDSNVRIWNFNSQDTTSSRSRNIWSCESFVSHNSMI  605

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF---KGCATWPEEKLPN  303
             +PW G  S             +P S L              Q    +G ATWPEEKL N
Sbjct  606  AIPWNGVNSLPGTLPSPRFIGDLPRSSLDYRLKHYNLDEKVEQKSLPRGTATWPEEKLVN  665

Query  302  LSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             SP PV     +S+YKFLKSA    ++ S ++WGLV+VTA LDG IRT+ NYGLPIR
Sbjct  666  SSPVPVSPTICRSEYKFLKSACH-GMSGSSHMWGLVIVTASLDGRIRTYHNYGLPIR  721



>ref|XP_002518879.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF43412.1| WD-repeat protein, putative [Ricinus communis]
Length=743

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 110/192 (57%), Gaps = 43/192 (22%)
 Frame = -3

Query  593  SAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASVVVPW  426
            +A  + A+FTSD KHV+S +EDSN+ +WNYN  + S    K ++SY+SF S NAS+ +PW
Sbjct  554  AANQMSASFTSDGKHVLSTSEDSNIYVWNYNSEEKSSSRVKKIQSYQSFASQNASIAIPW  613

Query  425  CGAGSSVPGSML------------------------ssgkaistsssSCCQF--------  342
            CG   +VPG ++                         +   +  SS  C           
Sbjct  614  CGI-ENVPGPLVPPKADGDLSGNSGLHGHSHHKFFGETDHKVLPSSPDCFSLTRGLLLDS  672

Query  341  --KGCATWPEEKLPNLSP---SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYI  177
              +G ATWPEEKLP+ SP   SP    +Y+FLKSA  S + SSP+LWGLV+VTAG DG I
Sbjct  673  LTRGSATWPEEKLPDSSPVALSPTKCKEYRFLKSACNS-IFSSPHLWGLVIVTAGWDGRI  731

Query  176  RTFLNYGLPIRF  141
            RT+LNYGLP+R 
Sbjct  732  RTYLNYGLPLRI  743



>ref|XP_008390309.1| PREDICTED: uncharacterized protein LOC103452581 [Malus domestica]
 ref|XP_008390310.1| PREDICTED: uncharacterized protein LOC103452581 [Malus domestica]
Length=724

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 103/177 (58%), Gaps = 24/177 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASV  438
            G+RN    + A+FTSD KH+VS ++DSNV IWN N   T    S+ + S ESF SHN+ +
Sbjct  548  GLRNGGNHMSASFTSDGKHIVSASDDSNVRIWNCNSQDTTSSRSRNIWSCESFVSHNSMI  607

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF---KGCATWPEEKLPN  303
             +PW G  S             +P S L              Q    +G ATWPEEKL N
Sbjct  608  AIPWNGVNSLPGTLASPRFIGDLPRSSLDYPLKHLNLDEKVEQKSLPRGTATWPEEKLVN  667

Query  302  LSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             SP PV     +S+YKFLKSA QS ++ S ++WGLV+VTA LDG I+T+ NYGLPIR
Sbjct  668  SSPVPVSPMMCRSEYKFLKSACQS-MSGSSHMWGLVIVTASLDGRIKTYHNYGLPIR  723



>ref|XP_009344051.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Pyrus x bretschneideri]
 ref|XP_009344052.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Pyrus x bretschneideri]
Length=730

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 103/177 (58%), Gaps = 24/177 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+RN    + A+FTSD KH+VS ++DSNV IWN+N   T+    + + S ESF SHN+ +
Sbjct  554  GLRNGGNHMSASFTSDGKHIVSASDDSNVRIWNFNSQDTTSSRLRNIWSCESFVSHNSMI  613

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF---KGCATWPEEKLPN  303
             +PW G  S             +P S L              Q    +G ATWPEEKL N
Sbjct  614  AIPWNGVNSLPGTLPSPRFIGDLPRSSLDYPLKHYNLDEKVEQKSLPRGTATWPEEKLVN  673

Query  302  LSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             SP PV     +S+YKFLKSA  S ++ S ++WGLV+VTA LDG IRT+ NYGLPIR
Sbjct  674  SSPVPVSPTMCRSEYKFLKSACHS-MSGSCHMWGLVIVTASLDGRIRTYHNYGLPIR  729



>ref|XP_002297958.2| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
 gb|EEE82763.2| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
Length=716

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 109/168 (65%), Gaps = 20/168 (12%)
 Frame = -3

Query  602  VRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTSKT--VRSYESFYSHNASVVV  432
            +R +A  + A+FTSD KH++S +EDSNV IWNY ++ +TS+T  ++S ESF S NASV +
Sbjct  555  LRFAANQISASFTSDGKHIISTSEDSNVYIWNYTSQERTSRTKNIQSCESFMSQNASVAI  614

Query  431  PWCGAG-------SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPS----PV  285
            PW G         SS P    S  +     S +    +G ATWPEEKLPN SP     P 
Sbjct  615  PWRGIETIEQKRLSSSPSVCFSLARGFLLESLT----RGSATWPEEKLPNSSPKAASPPK  670

Query  284  LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
             + ++K+LK+A Q+ L+S  ++WGLV+VTAG DG IRT+LNYGLP+R 
Sbjct  671  SRPEFKYLKNACQNMLSS--HMWGLVIVTAGWDGRIRTYLNYGLPLRL  716



>ref|XP_006584780.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
 gb|KHN16710.1| Putative WD repeat-containing protein C3H5.08c [Glycine soja]
Length=720

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 31/181 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVR--SYESFYSHNASV  438
            G+R SAG + A+FT+D KH++SV+EDSNVCIWNY   +  TSK  +  S ESF SHNA++
Sbjct  543  GLR-SAGQMHASFTTDGKHIISVSEDSNVCIWNYTGQDRNTSKAKKIWSSESFLSHNAAI  601

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSC-----CQF-----------KGCATWPEEKLP  306
             VPWCG   S+PG++LS       +         C F           K  ATWPEE L 
Sbjct  602  AVPWCGI-ESMPGTLLSPSLGEDVNQRCSLPSPDCFFLSRGFLSELIPKVSATWPEETLV  660

Query  305  NLS------PSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            + S       SP + KS+YKFL+SA +    S+ +LWG V+VTAG DGYIR + NYGLP+
Sbjct  661  DSSCQTQTVVSPTMCKSEYKFLRSACKG--MSNSHLWGQVIVTAGWDGYIRVYQNYGLPV  718

Query  146  R  144
            R
Sbjct  719  R  719



>ref|XP_008239197.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
 ref|XP_008239198.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
 ref|XP_008239199.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
 ref|XP_008239200.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
Length=738

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 107/196 (55%), Gaps = 45/196 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+RN    + A+FTSD  H+VS +EDSNV IWNYN    +    + + S ESF SHN+ +
Sbjct  545  GLRNGGNHMLASFTSDGTHIVSASEDSNVHIWNYNSQDMTSSRPRNIWSCESFVSHNSMI  604

Query  437  VVPWCGAGSSVPGSM------------------------LssgkaistsssSCCQF----  342
             +PW G  +S+PG++                            + +  SS  C       
Sbjct  605  AIPWNGE-NSIPGTLPSPRFTGDMQGSSLDNQPKHLSFDEKVEQKMHLSSPDCFSLGRGF  663

Query  341  ------KGCATWPEEKLPNLSP---SPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAG  192
                  KG ATWPEEKL N SP   SP + +SDYKFLKSA QS   S PNLWGLV+VTAG
Sbjct  664  FLEALQKGTATWPEEKLVNSSPVAVSPTMCRSDYKFLKSACQSM--SGPNLWGLVIVTAG  721

Query  191  LDGYIRTFLNYGLPIR  144
             DG IRT+ NYG PIR
Sbjct  722  WDGRIRTYHNYGTPIR  737



>ref|XP_007160204.1| hypothetical protein PHAVU_002G301700g [Phaseolus vulgaris]
 gb|ESW32198.1| hypothetical protein PHAVU_002G301700g [Phaseolus vulgaris]
Length=719

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 111/181 (61%), Gaps = 32/181 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVR--SYESFYSHNASV  438
            G+R SAG + A+FT+D KH++SV+EDSNVCIWNY  ++  TSK  +  S ESF SHN+ +
Sbjct  543  GLR-SAGQMHASFTTDGKHIISVSEDSNVCIWNYTGHDRSTSKAKKIWSSESFLSHNSVI  601

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSC-----CQF-----------KGCATWPEEKLP  306
             VPWCG   S+PG++LS       +         C F           K  ATWPEE L 
Sbjct  602  AVPWCGI-ESIPGTLLSPSLGEDANQRCSLPSPDCFFLSRGFLSELIPKVSATWPEETLV  660

Query  305  N-------LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            +       +SP+ + KS+YKFLKSA +    S+ +LWG V+VTAG DGYIR + NYGLP+
Sbjct  661  DSNQTQTVVSPT-MCKSEYKFLKSACKG--MSNSHLWGQVIVTAGWDGYIRVYQNYGLPV  717

Query  146  R  144
            R
Sbjct  718  R  718



>ref|XP_010053091.1| PREDICTED: WD repeat-containing protein 44-like [Eucalyptus grandis]
 gb|KCW77336.1| hypothetical protein EUGRSUZ_D01697 [Eucalyptus grandis]
Length=747

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 109/197 (55%), Gaps = 46/197 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTSKTVR---SYESFYSHNASV  438
            G RNS G + ATFTSD KHV+S +EDSNV IWNY  + +TS  V+   S ESF+S NASV
Sbjct  553  GPRNSGGPMIATFTSDGKHVISASEDSNVYIWNYAGQDKTSSRVKKIWSCESFWSSNASV  612

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSCCQF----------------------------  342
             +PWCG   +VP   L+         +SC +                             
Sbjct  613  ALPWCGI-RTVP-EALAPPSRSEERRASCAENGENHHMLEEYFQKMPPYSLDCFSLSRGF  670

Query  341  ------KGCATWPEEKLPNLSPSPVL-----KSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                  KG ATWPEEKL + SP+ V      K +YKFLKSA  S L SS ++WGLV+VTA
Sbjct  671  FLELLPKGSATWPEEKLSDSSPTTVSSQAISKLEYKFLKSACHSVL-SSAHMWGLVIVTA  729

Query  194  GLDGYIRTFLNYGLPIR  144
            G DG IRT+ NYGLP+R
Sbjct  730  GWDGRIRTYHNYGLPVR  746



>ref|XP_003525326.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
 gb|KHM99868.1| WD repeat-containing protein 44 [Glycine soja]
Length=720

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 110/181 (61%), Gaps = 31/181 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVR--SYESFYSHNASV  438
            G+R SAG + A+FT+D KH++SV+EDS+VCIWNY   +  TSK  +  S ESF SHNA++
Sbjct  543  GLR-SAGQMHASFTTDGKHIISVSEDSHVCIWNYTGQDRSTSKAKKIWSSESFLSHNAAI  601

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSC-----CQF-----------KGCATWPEEKLP  306
             VPWCG   S+PG++LS       +         C F           K  ATWPEE L 
Sbjct  602  AVPWCGI-ESMPGTLLSPSLGEDVNQKCSLPSPDCFFLSRGFLSELIPKVSATWPEETLV  660

Query  305  NLS------PSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            + S       SP + KS+YKFL+SA +    S+ +LWG V+VTAG DGYIR + NYGLP+
Sbjct  661  DSSCQTQTVVSPTMCKSEYKFLRSACKG--MSNSHLWGQVIVTAGWDGYIRVYQNYGLPV  718

Query  146  R  144
            R
Sbjct  719  R  719



>ref|XP_007039450.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY23951.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
3 [Theobroma cacao]
Length=678

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 107/198 (54%), Gaps = 44/198 (22%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNA  444
            ++G R +   + ATF+ D K ++S +EDSNV IWNY   +     +KT+ S ESF SHNA
Sbjct  484  ASGFRIATSQISATFSQDGKQIISASEDSNVYIWNYTNQEKNSSKAKTILSRESFLSHNA  543

Query  443  SVVVPWCGAGSSVPGSM-------------LssgkaistsssSCCQF-------------  342
            SV +PWCG   ++PG++             L++ +          Q              
Sbjct  544  SVAIPWCGI-ETIPGTLRSPELGGDVQRNGLANVQKHHNPKVELEQIMPHSSPDCFSLTR  602

Query  341  -------KGCATWPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                   +G ATWPEE LPN SP    S + K + K LKSA+QS L+S  + WGLV+VTA
Sbjct  603  VLLESLTRGSATWPEETLPNASPATIASDMCKFELKVLKSAYQSMLSS--HKWGLVIVTA  660

Query  194  GLDGYIRTFLNYGLPIRF  141
              DG IRT+LNYGLPIR 
Sbjct  661  SWDGRIRTYLNYGLPIRL  678



>ref|XP_007210339.1| hypothetical protein PRUPE_ppa001944mg [Prunus persica]
 gb|EMJ11538.1| hypothetical protein PRUPE_ppa001944mg [Prunus persica]
Length=738

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 102/195 (52%), Gaps = 43/195 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+RN    + A+FTSD  H+VS +EDSNV IWNYN    +    + + S ESF SH + +
Sbjct  545  GLRNGGNHMLASFTSDGTHIVSASEDSNVRIWNYNSQDMTSSRPRNIWSCESFVSHKSMI  604

Query  437  VVPWCGAG------------SSVPGSMLssgkaistsssSCCQF----------------  342
             +PW G                +PGS L +     +      Q                 
Sbjct  605  AIPWNGVNIIPGTLPSPRFTGDMPGSCLDNQLKHLSFDEKVEQKMHLSSPDCFSLGRGFL  664

Query  341  -----KGCATWPEEKLPNLSP---SPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
                 KG ATWPEEKL N SP   SP + +SDYKFL+SA QS   S PNLWGLV+VTAG 
Sbjct  665  LEALPKGTATWPEEKLVNSSPVAVSPTMCRSDYKFLRSACQSM--SGPNLWGLVIVTAGW  722

Query  188  DGYIRTFLNYGLPIR  144
            DG IRT+ NYG PIR
Sbjct  723  DGRIRTYHNYGTPIR  737



>gb|EPS61764.1| hypothetical protein M569_13028, partial [Genlisea aurea]
Length=553

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 104/165 (63%), Gaps = 21/165 (13%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVR-----SYESFYSHNAS  441
            G ++S   VPA+FTSD +H+VSV +DSNV +WNY+     K  R     S+ESF S NAS
Sbjct  400  GNKSSGSQVPASFTSDGEHIVSVGDDSNVRVWNYSSSHDQKPPRPKALWSHESFPSRNAS  459

Query  440  VVV--PWCGAGSS---VPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLKS  276
             +   PW  AGS    +P  +     A+         ++G ATWPE++L +   + V +S
Sbjct  460  SIAIPPWM-AGSKNRRIPECLGYLVDAL---------YRGSATWPEDRLKSNPIASVCRS  509

Query  275  DYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            + + LK+AW +AL +SP+LWGLV+VT GLDG IRTFLNYGLPIR 
Sbjct  510  ELRMLKNAWMNAL-NSPHLWGLVIVTGGLDGCIRTFLNYGLPIRI  553



>gb|KDP25243.1| hypothetical protein JCGZ_20399 [Jatropha curcas]
Length=742

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 38/181 (21%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTS---KTVRSYESFYSHNASVVVPWCGAGSSV  405
            A+FT+D KHV+S +EDSN+ IWNYN  + S   K ++S ESF S N S+ +PWCG   + 
Sbjct  564  ASFTTDGKHVISTSEDSNIYIWNYNSQEKSPREKNIQSCESFMSQNVSIAIPWCGI-ENE  622

Query  404  PGSML-------------------ssgkaistsssSCCQF----------KGCATWPEEK  312
            PG+++                        +  SS  C             +G ATWPEE 
Sbjct  623  PGTIVPPTCGNSGKNGPSPQKIFGDLEHQMLESSPDCFSLTRGFLLDSLTRGSATWPEEM  682

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            L + SP    S   K++YKFL+SA+ + + SSP+LWGLV+VTAG DG IRT+LNYGLP+R
Sbjct  683  LNDSSPVARSSKKFKTEYKFLRSAYNN-IFSSPHLWGLVIVTAGWDGRIRTYLNYGLPLR  741

Query  143  F  141
             
Sbjct  742  L  742



>ref|XP_007039448.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY23949.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=750

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 108/198 (55%), Gaps = 44/198 (22%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNA  444
            ++G R +   + ATF+ D K ++S +EDSNV IWNY   +     +KT+ S ESF SHNA
Sbjct  556  ASGFRIATSQISATFSQDGKQIISASEDSNVYIWNYTNQEKNSSKAKTILSRESFLSHNA  615

Query  443  SVVVPWCGAGSSVPGSM------------------------LssgkaistsssSCCQF--  342
            SV +PWCG   ++PG++                        +   + +  SS  C     
Sbjct  616  SVAIPWCGI-ETIPGTLRSPELGGDVQRNGLANVQKHHNPKVELEQIMPHSSPDCFSLTR  674

Query  341  -------KGCATWPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                   +G ATWPEE LPN SP    S + K + K LKSA+QS L+S  + WGLV+VTA
Sbjct  675  VLLESLTRGSATWPEETLPNASPATIASDMCKFELKVLKSAYQSMLSS--HKWGLVIVTA  732

Query  194  GLDGYIRTFLNYGLPIRF  141
              DG IRT+LNYGLPIR 
Sbjct  733  SWDGRIRTYLNYGLPIRL  750



>ref|XP_007039449.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY23950.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=751

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 108/198 (55%), Gaps = 44/198 (22%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNA  444
            ++G R +   + ATF+ D K ++S +EDSNV IWNY   +     +KT+ S ESF SHNA
Sbjct  557  ASGFRIATSQISATFSQDGKQIISASEDSNVYIWNYTNQEKNSSKAKTILSRESFLSHNA  616

Query  443  SVVVPWCGAGSSVPGSM------------------------LssgkaistsssSCCQF--  342
            SV +PWCG   ++PG++                        +   + +  SS  C     
Sbjct  617  SVAIPWCGI-ETIPGTLRSPELGGDVQRNGLANVQKHHNPKVELEQIMPHSSPDCFSLTR  675

Query  341  -------KGCATWPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                   +G ATWPEE LPN SP    S + K + K LKSA+QS L+S  + WGLV+VTA
Sbjct  676  VLLESLTRGSATWPEETLPNASPATIASDMCKFELKVLKSAYQSMLSS--HKWGLVIVTA  733

Query  194  GLDGYIRTFLNYGLPIRF  141
              DG IRT+LNYGLPIR 
Sbjct  734  SWDGRIRTYLNYGLPIRL  751



>ref|XP_006368793.1| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
 gb|ERP65362.1| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
Length=746

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 115/197 (58%), Gaps = 43/197 (22%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTSKT--VRSYESFYSHNAS  441
            ++ +R +A  + A+FTSD KH++S +EDSNV IWNY ++ +TS+T  ++S ESF S NAS
Sbjct  553  ASSLRFAANQISASFTSDGKHIISTSEDSNVYIWNYTSQERTSRTKNIQSCESFMSQNAS  612

Query  440  VVVPWCGAGSSVPGSM----LssgkaistsssSCCQF-----------------------  342
            V +PW G   +VP ++     S       S  SC +F                       
Sbjct  613  VAIPWRGI-ETVPETLSSPETSGDVNSFRSDRSCPKFCGEIEQKRLSSSPSVCFSLARGF  671

Query  341  ------KGCATWPEEKLPNLSPS----PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAG  192
                  +G ATWPEEKLPN SP     P  + ++K+LK+A Q+ L+S  ++WGLV+VTAG
Sbjct  672  LLESLTRGSATWPEEKLPNSSPKAASPPKSRPEFKYLKNACQNMLSS--HMWGLVIVTAG  729

Query  191  LDGYIRTFLNYGLPIRF  141
             DG IRT+LNYGLP+R 
Sbjct  730  WDGRIRTYLNYGLPLRL  746



>gb|KJB39576.1| hypothetical protein B456_007G020200 [Gossypium raimondii]
 gb|KJB39577.1| hypothetical protein B456_007G020200 [Gossypium raimondii]
Length=721

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 104/195 (53%), Gaps = 44/195 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASV  438
            G R +   + ATF+ D K ++S +EDSNV IWNY   +     +K + S ESF SHNAS+
Sbjct  529  GFRIATSQISATFSQDGKQIISASEDSNVYIWNYTNPEKNCSKAKNISSRESFLSHNASI  588

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSCCQFK---------------------------  339
             +PWCG  +  PG+++SS    +   +S    K                           
Sbjct  589  AIPWCGIKTD-PGTLMSSESNDNMRENSLTNGKKQLNPKVELEQLAPLASPNGFSLKRVL  647

Query  338  ------GCATWPEEKLPNLSPSPVLKSDYKF----LKSAWQSALASSPNLWGLVVVTAGL  189
                  G ATWPEE LPN SP+ +    +KF    LKSA+QS L+S  + WGLV+VTA  
Sbjct  648  MESLTRGSATWPEETLPNTSPAAIASDLWKFELKVLKSAYQSMLSS--HKWGLVIVTASF  705

Query  188  DGYIRTFLNYGLPIR  144
            DG IRT+LNYGLPIR
Sbjct  706  DGRIRTYLNYGLPIR  720



>ref|XP_011026824.1| PREDICTED: uncharacterized protein LOC105127282 [Populus euphratica]
Length=740

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 113/193 (59%), Gaps = 41/193 (21%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTSKT--VRSYESFYSHNAS  441
            ++ +R +A  + A+FTSD KH++S +EDSNV IWNY ++ +TS+T  ++S ESF S NAS
Sbjct  553  ASSLRFAANQISASFTSDGKHIISTSEDSNVYIWNYTSQERTSRTKNIQSCESFMSQNAS  612

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF---------------------------  342
            V +PW G   +VP +  S       S  SC +F                           
Sbjct  613  VAIPWRGI-ETVPET--SGDVNSFHSDHSCPKFCGEIEQKRLSSSPSVCFSLARGFLLES  669

Query  341  --KGCATWPEEKLPNLSPSPVLKS----DYKFLKSAWQSALASSPNLWGLVVVTAGLDGY  180
              +G ATWPEEKLPN SP     S    ++K+LKSA Q+ L+S  ++WGLV+VTAG DG 
Sbjct  670  LTRGSATWPEEKLPNSSPKAASPSKSRPEFKYLKSACQNMLSS--HMWGLVIVTAGWDGR  727

Query  179  IRTFLNYGLPIRF  141
            IRT+LNYGLP+R 
Sbjct  728  IRTYLNYGLPLRL  740



>ref|XP_002304571.2| hypothetical protein POPTR_0003s14440g [Populus trichocarpa]
 gb|EEE79550.2| hypothetical protein POPTR_0003s14440g [Populus trichocarpa]
Length=713

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 101/164 (62%), Gaps = 11/164 (7%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY---NELQTSKTVRSYESFYSHNAS  441
            ++G+R+ A    A+FTSD KH++S +ED NV +WNY        +K ++S ESF S NAS
Sbjct  554  ASGLRSVANQTSASFTSDGKHIISTSEDFNVHVWNYASQERTSRAKNIQSCESFLSQNAS  613

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP---SPVL-KSD  273
            V +PW      +  S      A      S    +G ATWPEEKLPN SP   SP   + +
Sbjct  614  VAIPWQLDQKKLSSSSDCFSLARGFLLESLT--RGSATWPEEKLPNSSPKTASPTKSRPE  671

Query  272  YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            +K+LK+A  + L+S  +LWGLV+VTAG DG IRT+LNYGLP+R 
Sbjct  672  FKYLKNACHNMLSS--HLWGLVIVTAGWDGRIRTYLNYGLPLRL  713



>ref|XP_011075952.1| PREDICTED: WD repeat-containing protein 44 [Sesamum indicum]
Length=706

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 106/170 (62%), Gaps = 20/170 (12%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+RN+   + ATFTSD KH++S +EDSN+ IWNY ++  S     K  +S+E F+S +AS
Sbjct  538  GLRNTGNQISATFTSDGKHIISASEDSNIYIWNYTDVGNSSFPQPKVNKSFE-FFSADAS  596

Query  440  VVVPWCG--AGSSVPGSMLssgkaistsssSCCQF------KGCATWPEEKLPNLSP---  294
            V +PW G  +G+    S+     + ST  S   +F      KG ATWPEEKLP  SP   
Sbjct  597  VAIPWSGLKSGTISKSSINPLSFSSSTCFSFSQEFLLDSTSKGSATWPEEKLPVSSPPAG  656

Query  293  -SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             SP+ KS YK  K++ QS  +S  + WGLV+VTAG DG IR+F NYGLP+
Sbjct  657  TSPLGKSQYKLFKTSCQS--SSDTHAWGLVIVTAGWDGRIRSFHNYGLPV  704



>dbj|BAH20268.1| AT1G64610 [Arabidopsis thaliana]
Length=623

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNEL-------QTSKTVRSYESFYSHNASVVVPWCGA  417
            A+F SD KH++S +EDS + +W+Y++L       +T K++RSYE F SHNASV +PW   
Sbjct  479  ASFISDGKHIISTSEDSYINVWSYSQLPSKKPYSETPKSIRSYEGFLSHNASVAIPWLRQ  538

Query  416  GSSVPGSMLssgkaistsssSCCQ-FKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSA  240
            G     S   +   +      C    KG  TWPEEKL +++ S   +   K L+SAWQ  
Sbjct  539  GRRDGLSECITDLDMKIPKVDCFSPMKGSTTWPEEKLEDVAMSN--RGKLKLLRSAWQ--  594

Query  239  LASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  595  ----PHLWGLVIVTATWDGRIRVFHNYGLPIR  622



>ref|NP_176642.1| WD40 domain-containing protein [Arabidopsis thaliana]
 ref|NP_974089.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AAL36415.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20010.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34260.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE34261.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=647

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNEL-------QTSKTVRSYESFYSHNASVVVPWCGA  417
            A+F SD KH++S +EDS + +W+Y++L       +T K++RSYE F SHNASV +PW   
Sbjct  503  ASFISDGKHIISTSEDSYINVWSYSQLPSKKPYSETPKSIRSYEGFLSHNASVAIPWLRQ  562

Query  416  GSSVPGSMLssgkaistsssSCCQ-FKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSA  240
            G     S   +   +      C    KG  TWPEEKL +++ S   +   K L+SAWQ  
Sbjct  563  GRRDGLSECITDLDMKIPKVDCFSPMKGSTTWPEEKLEDVAMSN--RGKLKLLRSAWQ--  618

Query  239  LASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  619  ----PHLWGLVIVTATWDGRIRVFHNYGLPIR  646



>gb|AAF19687.1|AC009519_21 F1N19.18 [Arabidopsis thaliana]
Length=667

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNEL-------QTSKTVRSYESFYSHNASVVVPWCGA  417
            A+F SD KH++S +EDS + +W+Y++L       +T K++RSYE F SHNASV +PW   
Sbjct  523  ASFISDGKHIISTSEDSYINVWSYSQLPSKKPYSETPKSIRSYEGFLSHNASVAIPWLRQ  582

Query  416  GSSVPGSMLssgkaistsssSC-CQFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSA  240
            G     S   +   +      C    KG  TWPEEKL +++ S   +   K L+SAWQ  
Sbjct  583  GRRDGLSECITDLDMKIPKVDCFSPMKGSTTWPEEKLEDVAMSN--RGKLKLLRSAWQ--  638

Query  239  LASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  639  ----PHLWGLVIVTATWDGRIRVFHNYGLPIR  666



>ref|XP_008234700.1| PREDICTED: uncharacterized protein LOC103333609 [Prunus mume]
Length=738

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 103/181 (57%), Gaps = 33/181 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G RN+     ATFTSD KH+VSV+EDSNV IWN        L  +K +RS+E F S N S
Sbjct  561  GQRNAGNQTSATFTSDGKHIVSVSEDSNVYIWNCGNQEEHVLSQAKKIRSFERF-STNVS  619

Query  440  VVVPWCG--------------AGSSVPGSMLssgkaistsssSCCQF-----KGCATWPE  318
            + +PWCG                  +PG++  S  A  + S     F     KG ATWPE
Sbjct  620  IAIPWCGFKCDSLENESQFQAMDGKLPGTLPFSSPACFSLSQD--SFLESIPKGSATWPE  677

Query  317  EKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            EKLP  SP    S + +S+YKF K++ QS   SS + WG+V+VTAG DG IR+F NYGLP
Sbjct  678  EKLPTSSPLAKPSTMHRSEYKFFKTSCQST--SSSHAWGMVIVTAGWDGRIRSFHNYGLP  735

Query  149  I  147
            +
Sbjct  736  V  736



>gb|KEH21290.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=714

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 110/175 (63%), Gaps = 25/175 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKT--VRSYESFYSHNASV  438
            G+R SAG + A+FTSD KH+VS++E SNVCIWN+   +  TSK   + S ESF SHNA++
Sbjct  543  GLR-SAGQMHASFTSDGKHIVSLSEGSNVCIWNHTGQDRNTSKAKKIMSSESFLSHNATI  601

Query  437  VVPWCGAGSS-VPGSMLssgkaistsssSCCQF-----------KGCATWPEEKLPN---  303
             +PWCG  S+ +  S+       S+ SS  C F           K  ATWPEE L +   
Sbjct  602  AIPWCGIESTPLSPSLGEELIQRSSLSSPDCFFMSRGFLSELVPKVSATWPEETLLDSGQ  661

Query  302  --LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
              +SP+ + KS+Y+FL+SA +    S+ +LWG V+VTAG DG+IR + NYGLP+R
Sbjct  662  TVVSPT-ICKSEYRFLRSACKG--MSNSHLWGQVIVTAGSDGFIRVYQNYGLPVR  713



>ref|XP_009358661.1| PREDICTED: vegetative incompatibility protein HET-E-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009358662.1| PREDICTED: vegetative incompatibility protein HET-E-1-like isoform 
X1 [Pyrus x bretschneideri]
Length=744

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 99/195 (51%), Gaps = 42/195 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ----TSKTVRSYESFYSHNASV  438
            G+RN      A+FT+D KH+VS ++DSNV IWN+N        S+ + S ESF SHN+ +
Sbjct  550  GLRNGGNHTSASFTTDGKHIVSASDDSNVHIWNFNSQDMTSSQSRKIWSCESFVSHNSII  609

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF----------------  342
             +PW G  S             VP S L              Q                 
Sbjct  610  AIPWNGVNSLPGTLPSPRFIGDVPQSSLDYPPKHLNFDEKLDQKMHLSSPDCFSLGRGFL  669

Query  341  -----KGCATWPEEKLPNLSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
                 +G  TWPEEKL N SP PV      S+YKFLK A QS ++ S ++WGLV+VTAG 
Sbjct  670  LESLPRGTPTWPEEKLVNSSPVPVSPAMCSSEYKFLKKACQS-MSGSSHMWGLVIVTAGW  728

Query  188  DGYIRTFLNYGLPIR  144
            DG IRT+ NYGLPIR
Sbjct  729  DGRIRTYHNYGLPIR  743



>ref|XP_009358663.1| PREDICTED: uncharacterized protein LOC103949280 isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 99/195 (51%), Gaps = 42/195 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ----TSKTVRSYESFYSHNASV  438
            G+RN      A+FT+D KH+VS ++DSNV IWN+N        S+ + S ESF SHN+ +
Sbjct  549  GLRNGGNHTSASFTTDGKHIVSASDDSNVHIWNFNSQDMTSSQSRKIWSCESFVSHNSII  608

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF----------------  342
             +PW G  S             VP S L              Q                 
Sbjct  609  AIPWNGVNSLPGTLPSPRFIGDVPQSSLDYPPKHLNFDEKLDQKMHLSSPDCFSLGRGFL  668

Query  341  -----KGCATWPEEKLPNLSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
                 +G  TWPEEKL N SP PV      S+YKFLK A QS ++ S ++WGLV+VTAG 
Sbjct  669  LESLPRGTPTWPEEKLVNSSPVPVSPAMCSSEYKFLKKACQS-MSGSSHMWGLVIVTAGW  727

Query  188  DGYIRTFLNYGLPIR  144
            DG IRT+ NYGLPIR
Sbjct  728  DGRIRTYHNYGLPIR  742



>ref|XP_008388376.1| PREDICTED: uncharacterized protein LOC103450778 [Malus domestica]
Length=744

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 99/195 (51%), Gaps = 42/195 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+RN      A+FT+D KH+VS ++DSNV IWN+N    +    + + S ESF SHN+ +
Sbjct  550  GLRNGGNHTSASFTTDGKHIVSASDDSNVHIWNFNSQDMTSSRLRKIXSCESFVSHNSII  609

Query  437  VVPWCGAGS------------SVPGSMLssgkaistsssSCCQF----------------  342
             +PW G  S             VP S +              Q                 
Sbjct  610  AIPWNGVNSLPGTLPSPRFIGDVPQSSIDYPLKHLNFDEKLEQKMHLSSPDCFSLGRGFL  669

Query  341  -----KGCATWPEEKLPNLSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
                 +G  TWPEEKL N SP PV      S+YKFLK A QS ++ S ++WGLV+VTAG 
Sbjct  670  LESLPRGTPTWPEEKLVNSSPVPVSPTMCSSEYKFLKKACQS-MSGSSHMWGLVIVTAGW  728

Query  188  DGYIRTFLNYGLPIR  144
            DG IRT+ NYGLPIR
Sbjct  729  DGRIRTYHNYGLPIR  743



>ref|XP_002886335.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62594.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=644

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 88/152 (58%), Gaps = 16/152 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNEL-------QTSKTVRSYESFYSHNASVVVPWCGA  417
            A+F SD KH++S +EDS + +W+Y++L       +T K++RSYE F SHNASV +PW   
Sbjct  500  ASFISDGKHIISTSEDSYINVWSYSQLPSKKLYSETPKSIRSYEGFLSHNASVAIPWLRQ  559

Query  416  GSSVPGSMLssgkaistsssSCCQ-FKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSA  240
            GS    S   +          C    KG  TWPEEKL ++  S   +   K L+S WQ  
Sbjct  560  GSRDGLSECITDLDRKIPKVDCFSPMKGSTTWPEEKLEDVVMSN--RGKLKLLRSVWQ--  615

Query  239  LASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                P+LWGLV+VTA  DG IR F NYGLP+R
Sbjct  616  ----PHLWGLVIVTATWDGRIRVFHNYGLPVR  643



>ref|XP_006491984.1| PREDICTED: WD repeat-containing protein 44-like [Citrus sinensis]
Length=701

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 101/178 (57%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNAS  441
            G+R S   + A FTSD KH+VS  EDSNV +WN   + E     +KT+RS E F + NAS
Sbjct  525  GLRRSGNQLSACFTSDGKHIVSAGEDSNVYMWNCIGHEEPAHDQAKTIRSLERFTT-NAS  583

Query  440  VVVPWCGA----GSSVPGSMLssgkaistsssSCCQF------------KGCATWPEEKL  309
            + +PWCG         P   +S   +    + +  +F            KGCATWPEEKL
Sbjct  584  IAIPWCGLKCGNAEKEPQLHVSDDDSPENLAFAPARFSLGQEYVFESLPKGCATWPEEKL  643

Query  308  PNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P LS     S + KS YKFLKS+      +S + WGLV+VTAG DG IR+FLNYGLPI
Sbjct  644  PALSQLSSASALHKSQYKFLKSS--CLCTTSSHAWGLVIVTAGWDGRIRSFLNYGLPI  699



>gb|KDO59631.1| hypothetical protein CISIN_1g005352mg [Citrus sinensis]
Length=701

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 101/178 (57%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNAS  441
            G+R S   + A FTSD KH+VS  EDSNV +WN   + E     +KT+RS E F + NAS
Sbjct  525  GLRRSGNQLSACFTSDGKHIVSAGEDSNVYMWNCIGHEEPAHDQAKTIRSLERFTT-NAS  583

Query  440  VVVPWCGA----GSSVPGSMLssgkaistsssSCCQF------------KGCATWPEEKL  309
            + +PWCG         P   +S   +    + +  +F            KGCATWPEEKL
Sbjct  584  IAIPWCGLKCGNAEKEPQLHVSDDDSPENLAFAPARFSLGQEYVFESFPKGCATWPEEKL  643

Query  308  PNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P LS     S + KS YKFLKS+      +S + WGLV+VTAG DG IR+FLNYGLPI
Sbjct  644  PALSQLSSASALHKSQYKFLKSS--CLCTTSSHAWGLVIVTAGWDGRIRSFLNYGLPI  699



>ref|XP_006441153.1| hypothetical protein CICLE_v10019098mg [Citrus clementina]
 gb|ESR54393.1| hypothetical protein CICLE_v10019098mg [Citrus clementina]
Length=701

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 101/178 (57%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNAS  441
            G+R S   + A FTSD KH+VS  EDSNV +WN   + E     +KT+RS E F + NAS
Sbjct  525  GLRRSGNQLSACFTSDGKHIVSAGEDSNVYMWNCIGHEEPAHDQAKTIRSLERFTT-NAS  583

Query  440  VVVPWCGA----GSSVPGSMLssgkaistsssSCCQF------------KGCATWPEEKL  309
            + +PWCG         P   +S   +    + +  +F            KGCATWPEEKL
Sbjct  584  IAIPWCGLKCGNAEKEPQLHVSDDDSPENLAFAPARFSLGQEYVFESFPKGCATWPEEKL  643

Query  308  PNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P LS     S + KS YKFLKS+      +S + WGLV+VTAG DG IR+FLNYGLPI
Sbjct  644  PALSQLSSASALHKSQYKFLKSS--CLCTTSSHAWGLVIVTAGWDGRIRSFLNYGLPI  699



>gb|KHG04867.1| WD repeat-containing protein 44 [Gossypium arboreum]
 gb|KHG04868.1| WD repeat-containing protein 44 [Gossypium arboreum]
Length=721

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 102/195 (52%), Gaps = 44/195 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASV  438
            G R +   + ATF+ D K ++S +EDSNV IWNY   +     +K + S ESF+SHN S+
Sbjct  529  GFRIATSQISATFSQDGKQIISASEDSNVYIWNYTNPEKNCSKAKNISSRESFFSHNVSI  588

Query  437  VVPWCGAGSSVPGSMLssgkaistsssSCCQFK---------------------------  339
             +PWCG  +  PG ++SS    +   +S    K                           
Sbjct  589  AIPWCGIKTD-PGMLMSSVSNDNMQENSLTNGKKQLNPKVELEQLAPHASPNGFSLKRVL  647

Query  338  ------GCATWPEEKLPNLSPSPVLKSDYKF----LKSAWQSALASSPNLWGLVVVTAGL  189
                  G ATWPEE L N SP+ +    +KF    LKSA+QS L+S  + WGLV+VTA  
Sbjct  648  MESLTRGSATWPEETLLNTSPAAIASDLWKFELKVLKSAYQSMLSS--HKWGLVIVTASF  705

Query  188  DGYIRTFLNYGLPIR  144
            DG IRT+LNYGLPIR
Sbjct  706  DGRIRTYLNYGLPIR  720



>ref|XP_004300485.1| PREDICTED: WD repeat-containing protein 3 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465363.1| PREDICTED: WD repeat-containing protein 3 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465364.1| PREDICTED: WD repeat-containing protein 3 [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 106/200 (53%), Gaps = 46/200 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+R+    V A+FTSD  H+VS +EDS+V IWNYN  +TS    K +RS ESF SHN+ +
Sbjct  548  GLRSGGSHVSASFTSDGNHIVSASEDSSVHIWNYNGQETSSSRSKNIRSCESFVSHNSMI  607

Query  437  VVPWCGA-------------GSSVPGSMLssgkaistsssSCCQF---------------  342
             +PW G              G S   S L S   +        Q                
Sbjct  608  AIPWNGVNDLPAMLPSPAFIGDSQGRSSLDSPLKLLNFDERVQQKMHLSSPDCFSLGRGF  667

Query  341  ------KGCATWPEEKLPNLSPS-------PVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
                  KG  TWPEEKL N SP         + +S+Y+FLK+A QS L+SS ++WGLV+V
Sbjct  668  LLESLPKGTPTWPEEKLVNSSPVPPVPVSPTMSRSEYRFLKNACQS-LSSSSHMWGLVIV  726

Query  200  TAGLDGYIRTFLNYGLPIRF  141
            TAGLDG IRT+ NYGLP R+
Sbjct  727  TAGLDGRIRTYHNYGLPTRY  746



>gb|EYU25256.1| hypothetical protein MIMGU_mgv1a027154mg [Erythranthe guttata]
Length=679

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 79/167 (47%), Positives = 104/167 (62%), Gaps = 20/167 (12%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD KH+VS +EDSNV +WNY + + S     K  RS+E F S +AS
Sbjct  517  GLRNAGNQISASFTSDGKHIVSTSEDSNVYMWNYIDQRESTFSQPKVNRSFECF-SSDAS  575

Query  440  VVVPWCGAGSSV--PGSMLssgkaistsssSCCQF------KGCATWPEEKLPNLSPSPV  285
            V VPW G  SS     S+     + ST  S   +F      KG ATWPEEK   LS SP+
Sbjct  576  VAVPWSGLKSSALHKSSINPLPFSSSTCFSLSQEFLLDSNSKGSATWPEEK---LSTSPI  632

Query  284  L-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            + KS +K  K++ QS  +S+ + WGLV+VTAG DG IR+F NYGLP+
Sbjct  633  MGKSQFKLFKTSCQS--SSNSHAWGLVIVTAGWDGRIRSFHNYGLPV  677



>ref|XP_007220614.1| hypothetical protein PRUPE_ppa002072mg [Prunus persica]
 gb|EMJ21813.1| hypothetical protein PRUPE_ppa002072mg [Prunus persica]
Length=720

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 101/179 (56%), Gaps = 29/179 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G RN+     ATFTSD KH+VSV+EDSNV IWN        L  +K +RS E F S N S
Sbjct  543  GQRNAGNQTSATFTSDGKHIVSVSEDSNVYIWNCGNQEEHVLSQAKKIRSCERF-STNVS  601

Query  440  VVVPWCGAG----------SSVPGSMLssgkaistsssSCCQF-------KGCATWPEEK  312
            + +PWCG             ++ G +  +    S +  S  Q        KG ATWPEEK
Sbjct  602  IAIPWCGFKRDSLENEGQFQAMDGKLPETLPFSSPACFSLSQDSFLESIPKGSATWPEEK  661

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP  SP    S + +S+YKF K++ QS   SS + WG+V+VTAG DG IR+F NYGLP+
Sbjct  662  LPTSSPLAKPSTMHRSEYKFFKTSCQST--SSSHAWGMVIVTAGWDGRIRSFHNYGLPV  718



>gb|KHF97548.1| WD repeat-containing 44 [Gossypium arboreum]
Length=738

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 108/199 (54%), Gaps = 45/199 (23%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS---KTVRSYESFYSHNA  444
            ++G R +   + ATF+ D K ++S +EDSN+ IWNY N+ + S   K++ S ESF SHNA
Sbjct  543  ASGFRVATSQISATFSQDGKQIISASEDSNIYIWNYANQEKNSSKVKSISSCESFLSHNA  602

Query  443  SVVVPWCGAGSSVPGSM-------------------------LssgkaistsssSCCQF-  342
            SV +PW G   ++P ++                         +   + +  SS  C    
Sbjct  603  SVAIPWRGI-ETIPATLTSLELGGGDVRRNSHPSGQKHQSPKVEPEQPMPNSSPDCFSLT  661

Query  341  --------KGCATWPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVT  198
                    KG  TWPEE LPN SP    S V K + K LKSA+QS L+S  + WGLV+VT
Sbjct  662  RVLLESLTKGSPTWPEETLPNASPVTVASDVCKFELKVLKSAYQSMLSS--HKWGLVIVT  719

Query  197  AGLDGYIRTFLNYGLPIRF  141
            AG DG IRT+LNYGLPIR 
Sbjct  720  AGWDGRIRTYLNYGLPIRL  738



>ref|XP_010252806.1| PREDICTED: WD repeat-containing protein 44 [Nelumbo nucifera]
Length=757

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 107/205 (52%), Gaps = 51/205 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSYESFYSHNAS  441
            G+RN+   + A+F SD KH++S +EDSNV IWN N          K++ S E F+S N S
Sbjct  554  GLRNAGSQISASFASDGKHIISASEDSNVYIWNCNSQDGPAPSQVKSIWSCERFFSSNVS  613

Query  440  VVVPWCG------------------------AGSSVPGS-----MLssgkaistsssSCC  348
            V +PWCG                        AGSS         +L         SSS  
Sbjct  614  VAIPWCGMKSSNFVLSTALGAQSTLKTPENIAGSSQANGGWQHCLLDENSHNVLPSSSPD  673

Query  347  QF------------KGCATWPEEKLP---NLSPSPVL-KSDYKFLKSAWQSALASSPNLW  216
            +F            KGCATWPEEKLP   +L+ S  + KS YKFLK++   AL +SP+ W
Sbjct  674  RFSLSHGFFSEALPKGCATWPEEKLPMSGSLAVSSTMCKSLYKFLKASCHGAL-NSPHAW  732

Query  215  GLVVVTAGLDGYIRTFLNYGLPIRF  141
            GLVVVTAG DG IR+F NYGLP+R 
Sbjct  733  GLVVVTAGWDGRIRSFHNYGLPVRL  757



>ref|NP_200162.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB09726.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM14068.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13109.1| unknown protein [Arabidopsis thaliana]
 gb|AED96370.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=654

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 92/173 (53%), Gaps = 39/173 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVRSYESFYSHNASVVVPW  426
            GV  +  L  A+ TSD KH+VS  EDSNV IW+ +E   +K +RS+E F S NASV   W
Sbjct  499  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNDEESETKKIRSFERF-SANASVAATW  557

Query  425  CGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEKLPN-  303
            CG                      VPGS+                 KG ATWPEE LP  
Sbjct  558  CGFSDHNTTLPFSSPSCLSHNEGFVPGSIS----------------KGSATWPEENLPAN  601

Query  302  -LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             LS S +  S YKFLKS++Q   ASS   WG+V+VT G DG IRTF NYGLP+
Sbjct  602  PLSTSAMNASHYKFLKSSYQR--ASSSLSWGMVIVTGGWDGQIRTFQNYGLPV  652



>emb|CBI23039.3| unnamed protein product [Vitis vinifera]
Length=674

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 102/178 (57%), Gaps = 30/178 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-YNE----LQTSKTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD KH+VS  +DSNV +WN  NE    L  SK++R++E F + NAS
Sbjct  498  GLRNAGNQMSASFTSDGKHIVSACDDSNVYVWNCSNEGEPALSQSKSIRAFEHFLT-NAS  556

Query  440  VVVPWCGAGSSVPGS-----MLssgkaistsssSCCQF------------KGCATWPEEK  312
            V +PWCG     P +      L      +    S   F            KG ATWPEEK
Sbjct  557  VAIPWCGMKYGNPENGWQFHALDESSPNTLPFPSPASFSLSQEFFSESFPKGSATWPEEK  616

Query  311  LPNLS----PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            LP  S    PS + KS++KFLK A QS   SS + WGLV+VTAG DG IR+F NYGLP
Sbjct  617  LPTSSLVSVPSKIHKSEHKFLK-ACQST--SSSHAWGLVIVTAGWDGRIRSFHNYGLP  671



>ref|XP_004503569.1| PREDICTED: uncharacterized protein LOC101510067 [Cicer arietinum]
Length=706

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 78/175 (45%), Positives = 106/175 (61%), Gaps = 25/175 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTS--KTVRSYESFYSHNASV  438
            G+R SAG + A+FTSD KH+VS++E SNVCIWN+   +  TS  K + S ESF S+NAS+
Sbjct  535  GLR-SAGQMHASFTSDGKHIVSLSEGSNVCIWNHTGQDKNTSKPKQIWSSESFLSNNASI  593

Query  437  VVPWCGAGS-SVPGSMLssgkaistsssSCCQFKG-----------CATWPEEKLPN---  303
             +PWCG  S  +  S+       S+ SS  C F G             TWPEE L +   
Sbjct  594  AIPWCGIESMPLSPSLGEDLIRRSSLSSPDCFFMGRGFLSELVPKVSPTWPEETLLDSGQ  653

Query  302  --LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
              +SP+ + KS+YKFL+ A +    S+ +LW  V+VTAG DGYI+ + NYGLP+R
Sbjct  654  TVVSPT-MCKSEYKFLRGACKG--MSNSHLWNQVIVTAGTDGYIKVYQNYGLPVR  705



>ref|XP_010473727.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=649

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 83/151 (55%), Gaps = 15/151 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQT------SKTVRSYESFYSHNASVVVPWCGAG  414
            A+F SD KH+VS +EDS + +WNY++L +      +K  RSYE F SHN SV +PW   G
Sbjct  506  ASFISDGKHIVSTSEDSCIHVWNYSQLPSKKPSSGTKRTRSYEGFLSHNVSVAIPWLRQG  565

Query  413  SSVPGSMLssgkaistsssSCCQ-FKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSAL  237
                 S              C    KG  TWPEEKL + + S   +   K L+SAWQ   
Sbjct  566  HRDELSECIIDLDRKLPKVDCFSPMKGSTTWPEEKLEDAAMSN--RGKLKLLRSAWQ---  620

Query  236  ASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
               P+LWGLV VTA  DG IR F NYGLPIR
Sbjct  621  ---PHLWGLVFVTATWDGRIRVFNNYGLPIR  648



>ref|XP_010442916.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010442917.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=659

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 94/176 (53%), Gaps = 42/176 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ---TSKTVRSYESFYSHNASVV  435
            GV  +  L+ A+ TSD KH+VS  EDSNV IW+ +E      SK +RS+E F S NASV 
Sbjct  501  GVCKTRSLISASLTSDGKHIVSACEDSNVYIWSNDESDCSSQSKKIRSFERF-STNASVA  559

Query  434  VPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEKL  309
              WCG                      VPGS+                 KG ATWPEE L
Sbjct  560  ATWCGFSDHNTTLPFSSPSCLSLNEGYVPGSIS----------------KGSATWPEENL  603

Query  308  PN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P   LS S +  S YKFLKS++Q A  SS  LWG+V+VT G DG IRTF NYGLP+
Sbjct  604  PVNPLSTSAMNASHYKFLKSSYQRA--SSSLLWGMVIVTGGWDGRIRTFQNYGLPV  657



>ref|XP_002271917.2| PREDICTED: WD repeat-containing protein YMR102C [Vitis vinifera]
Length=732

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 102/178 (57%), Gaps = 30/178 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-YNE----LQTSKTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD KH+VS  +DSNV +WN  NE    L  SK++R++E F + NAS
Sbjct  556  GLRNAGNQMSASFTSDGKHIVSACDDSNVYVWNCSNEGEPALSQSKSIRAFEHFLT-NAS  614

Query  440  VVVPWCGAGSSVPGS-----MLssgkaistsssSCCQF------------KGCATWPEEK  312
            V +PWCG     P +      L      +    S   F            KG ATWPEEK
Sbjct  615  VAIPWCGMKYGNPENGWQFHALDESSPNTLPFPSPASFSLSQEFFSESFPKGSATWPEEK  674

Query  311  LPNLS----PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            LP  S    PS + KS++KFLK A QS   SS + WGLV+VTAG DG IR+F NYGLP
Sbjct  675  LPTSSLVSVPSKIHKSEHKFLK-ACQST--SSSHAWGLVIVTAGWDGRIRSFHNYGLP  729



>ref|XP_002870596.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46855.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 88/160 (55%), Gaps = 16/160 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNASVVVPWCGAG  414
            A+FTSD KH+VS  EDS + +W+Y++       Q  KT+RSYE F S N SV +PW G G
Sbjct  549  ASFTSDGKHIVSTIEDSGIHVWDYSQPNKKASSQKPKTIRSYEGFLSQNVSVAIPWLGQG  608

Query  413  --SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL--------KSDYKF  264
               ++   +  S              KG  TWPEEKL  ++ S           +S  + 
Sbjct  609  KEETIIADLEKSFAHFPAPMDYFSPMKGATTWPEEKLEVVAGSAAAAVSATVSSRSKLRL  668

Query  263  LKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            LKS  Q+   S+P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  669  LKSVCQNVNGSTPHLWGLVIVTATWDGMIRVFHNYGLPIR  708



>ref|XP_006283216.1| hypothetical protein CARUB_v10004247mg [Capsella rubella]
 gb|EOA16114.1| hypothetical protein CARUB_v10004247mg [Capsella rubella]
Length=717

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 91/161 (57%), Gaps = 17/161 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNASVVVPWCGAG  414
            A+FTSD KH+VS  EDS + +W+Y++       Q  KT+RSYE F SHN SV +PW G  
Sbjct  556  ASFTSDGKHIVSTIEDSGIHVWDYSQPNKKASSQKPKTIRSYEGFLSHNVSVAIPWLGQQ  615

Query  413  SSVPGSMLssgkaistsssSCCQF---KGCATWPEEKLPNLSPSPV--------LKSDYK  267
                  +    K  +   +    F   KG  TWPEEKL  +S +          ++S  +
Sbjct  616  GKEDNFIADLEKTFAHFPAPMDYFSPIKGATTWPEEKLGAVSGAAAAAVSATVSIRSKLR  675

Query  266  FLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             L+S  Q+  +SSP+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  676  LLRSVCQNVNSSSPHLWGLVIVTATWDGRIRVFHNYGLPIR  716



>ref|XP_006300843.1| hypothetical protein CARUB_v10019937mg [Capsella rubella]
 gb|EOA33741.1| hypothetical protein CARUB_v10019937mg [Capsella rubella]
Length=646

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 83/151 (55%), Gaps = 15/151 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTSK------TVRSYESFYSHNASVVVPWCGAG  414
            A+F  D KH+VS +EDS + +WNY++L + K      + RSYE F SHNASV +PW   G
Sbjct  503  ASFIPDGKHIVSTSEDSCIHVWNYSQLPSKKPSSGIKSTRSYEGFLSHNASVAIPWLRQG  562

Query  413  SSVPGSMLssgkaistsssSCCQ-FKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSAL  237
                 S              C    KG  TWPEEKL + + S   +   K L+SAWQ   
Sbjct  563  HRDDLSECIIDLDRKIPKVDCFSPMKGSTTWPEEKLEDAAMSN--REKLKLLRSAWQ---  617

Query  236  ASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
               P+LWGLV VTA  DG IR F NYGLP+R
Sbjct  618  ---PHLWGLVFVTATWDGRIRVFNNYGLPVR  645



>gb|KHG23616.1| WD repeat-containing 44 [Gossypium arboreum]
Length=752

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 104/200 (52%), Gaps = 48/200 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASV  438
            G+ N+   + A FTSD   +VS +EDSNV +WNY      +  SK  RS E F+S+NASV
Sbjct  552  GLHNAGSQISAVFTSDGMRIVSASEDSNVYVWNYINQDGPVSHSKKNRSCERFFSNNASV  611

Query  437  VVPWCG-----------AGSS----------------VPGSMLssgkaistsssSCCQF-  342
             +PWCG           +G+S                V  S L          SS  +F 
Sbjct  612  AIPWCGITCRNSIFPNMSGTSPSPKDLSSRWCNENTGVLQSELGDSSQHKFPFSSSERFS  671

Query  341  -----------KGCATWPEEKLPN----LSPSPVLKSDYKFLKSAWQSALASSPNLWGLV  207
                       KG ATWPEEKLP+    +  S + KS+YK LK++ QSAL SS + WGLV
Sbjct  672  LGHGFFSESLLKGTATWPEEKLPHPDSFVVSSAMCKSEYKLLKTSCQSALGSS-HAWGLV  730

Query  206  VVTAGLDGYIRTFLNYGLPI  147
            +VT G DG IR+F NYGLP+
Sbjct  731  IVTGGYDGRIRSFQNYGLPV  750



>gb|KJB09622.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
 gb|KJB09625.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
Length=753

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 104/201 (52%), Gaps = 48/201 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASV  438
            G+ N+   + A FTSD   +VS +EDSNV +WNY      +  SK  RS E F+S+NASV
Sbjct  553  GLHNAGSQISAVFTSDGMRIVSASEDSNVYVWNYINQDGPVSHSKKNRSCERFFSNNASV  612

Query  437  VVPWCG-----------AGSS----------------VPGSMLssgkaistsssSCCQF-  342
             +PWCG           +G+S                V  S L          SS  +F 
Sbjct  613  AIPWCGITCRNSIFPNMSGTSPSPKDLSSRWCNENTGVLQSELGDSSQHKLPFSSSERFS  672

Query  341  -----------KGCATWPEEKLPN----LSPSPVLKSDYKFLKSAWQSALASSPNLWGLV  207
                       KG ATWPEEKLP+    +  S + KS YK LK++ QSAL SS + WGLV
Sbjct  673  LGHGFFSESLLKGTATWPEEKLPHPDSFVVSSAMCKSQYKLLKTSCQSALGSS-HAWGLV  731

Query  206  VVTAGLDGYIRTFLNYGLPIR  144
            +VT G DG IR+F NYGLP++
Sbjct  732  IVTGGYDGRIRSFQNYGLPVQ  752



>ref|XP_006280149.1| hypothetical protein CARUB_v10026048mg [Capsella rubella]
 gb|EOA13047.1| hypothetical protein CARUB_v10026048mg [Capsella rubella]
Length=657

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 92/177 (52%), Gaps = 43/177 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE----LQTSKTVRSYESFYSHNASV  438
            GVR +  L  A+ TSD KH+VS  EDS V IW+ +E       +K +RS+E F S NASV
Sbjct  490  GVRKTRSLTSASLTSDGKHIVSACEDSKVYIWSNDEESDCASQTKKIRSFERF-SANASV  548

Query  437  VVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEK  312
               WCG                      VPGS+                 KG ATWPEE 
Sbjct  549  AATWCGFSDHSTTLPFSSPSCLSLNEGFVPGSIS----------------KGSATWPEEN  592

Query  311  LPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP   LS S +  S YKFLKS++Q A  SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  593  LPENPLSTSAMNASHYKFLKSSYQRA--SSSLSWGMVIVTGGWDGQIRTFQNYGLPV  647



>ref|XP_011022443.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011022444.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011022445.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011022446.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
Length=745

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 108/194 (56%), Gaps = 39/194 (20%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS---KTVRSYESFYSHNAS  441
            ++G+R+ A    A+FTSD KH++S +ED NV +WN    Q +   K ++S ESF S NA 
Sbjct  554  ASGLRSVANQTSASFTSDGKHIISTSEDFNVHVWNSASQQRTSRAKNIQSCESFLSQNAY  613

Query  440  VVVPWCGAGS--SVPGSMLssgkaistsssSCCQF-------------------------  342
            V +PW G  +    P S+ S+      S  +  +F                         
Sbjct  614  VAIPWRGIETIPGTPSSLESTCGNSFKSDHTRPKFCGELDQKKLSSSSDCFSLARGFLLE  673

Query  341  ---KGCATWPEEKLPNLSP--SPVLKS--DYKFLKSAWQSALASSPNLWGLVVVTAGLDG  183
               +G ATWPEEKLPN SP  + + KS  ++K+LK+A  + L+S  +LWGLV+VTAG DG
Sbjct  674  SLTRGSATWPEEKLPNSSPKTASLTKSRPEFKYLKNACHNMLSS--HLWGLVIVTAGWDG  731

Query  182  YIRTFLNYGLPIRF  141
             IRT+LNYGLP+R 
Sbjct  732  RIRTYLNYGLPLRL  745



>ref|XP_002865975.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42234.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=654

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 91/173 (53%), Gaps = 39/173 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVRSYESFYSHNASVVVPW  426
            GV  +  L  A+ TSD KH+VS  EDSNV IW+ +E   +K +RS+E F S NASV   W
Sbjct  499  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNDEESETKKIRSFERF-STNASVAATW  557

Query  425  CGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEKLPN-  303
            CG                      VPGS+                 KG ATWPEE LP  
Sbjct  558  CGFSDHNTTLPFSSPSCLSLSEGFVPGSIS----------------KGSATWPEENLPAN  601

Query  302  -LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             L  S +  S YKFLKS++Q   ASS   WG+V+VT G DG IRTF NYGLP+
Sbjct  602  PLFTSAMNASHYKFLKSSYQR--ASSSLSWGMVIVTGGWDGRIRTFQNYGLPV  652



>gb|KJB18927.1| hypothetical protein B456_003G075300 [Gossypium raimondii]
Length=738

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 107/199 (54%), Gaps = 45/199 (23%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS---KTVRSYESFYSHNA  444
            ++G R     + ATF+ D K ++S +EDSN+ IWNY N+ + S   K++ S ESF SHNA
Sbjct  543  ASGFRVVTSQISATFSQDGKQIISASEDSNIYIWNYANQEKNSSKLKSISSCESFLSHNA  602

Query  443  SVVVPWCGAGSSVPGSM-------------------------LssgkaistsssSCCQF-  342
            SV +PW G   ++P ++                         +   + +  SSS C    
Sbjct  603  SVAIPWRGI-ETIPATLTSLELDGGDVRRNSHPSGQKHQSPKVEPEQPMPNSSSDCFSLT  661

Query  341  --------KGCATWPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVT  198
                    KG  TWPEE LPN SP    S + K + K LKSA+QS L+S  + WGLV+VT
Sbjct  662  RVLLESLTKGSPTWPEETLPNASPVTVASDMCKFELKVLKSAYQSMLSS--HKWGLVIVT  719

Query  197  AGLDGYIRTFLNYGLPIRF  141
            A  DG IRT+LNYGLPIR 
Sbjct  720  ADWDGRIRTYLNYGLPIRL  738



>gb|KDP23830.1| hypothetical protein JCGZ_00073 [Jatropha curcas]
Length=712

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 102/180 (57%), Gaps = 32/180 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-----NELQTSKTVRSYESFYSHNAS  441
            G++++   + A+FTSD KH+VS  EDSNV +WN+     ++   +KT+RS E F S NAS
Sbjct  536  GLKSTPSQISASFTSDGKHIVSACEDSNVYLWNFIDQGRSDPMQAKTIRSCERF-STNAS  594

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF------------------KGCATWPEE  315
            + +PWCG      G+        + ++     F                  KG ATWPEE
Sbjct  595  IAIPWCGLKHESSGN--GGFHVSNDNAPEVMPFPSPAGFSLSQEYFLESFPKGSATWPEE  652

Query  314  KLPNLSP---SPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KLP  SP   SP + KS YKFLK++ QS  AS  + W LV+VTAG DG IR+F NYGLP+
Sbjct  653  KLPPASPLSTSPAMHKSQYKFLKASCQSIAAS--HAWDLVIVTAGWDGRIRSFHNYGLPV  710



>ref|XP_010430602.1| PREDICTED: WD repeat-containing protein 44 [Camelina sativa]
Length=658

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 82/151 (54%), Gaps = 15/151 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQT------SKTVRSYESFYSHNASVVVPWCGAG  414
            A+F  D KH+VS +EDS + +WNY++L +      +K  RSYE F SHN SV +PW   G
Sbjct  515  ASFIPDGKHIVSTSEDSCIHVWNYSQLPSKKPSSGTKRTRSYEGFLSHNVSVAIPWLRQG  574

Query  413  SSVPGSMLssgkaistsssSCCQ-FKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSAL  237
                 S              C    KG  TWPEEKL + + S   +   K L+SAWQ   
Sbjct  575  HRDELSECIIDLDRKLPKVDCFSPMKGSTTWPEEKLEDAAMSN--RGKLKLLRSAWQ---  629

Query  236  ASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
               P+LWGLV VTA  DG IR F NYGLPIR
Sbjct  630  ---PHLWGLVFVTATWDGRIRVFNNYGLPIR  657



>ref|XP_004309119.1| PREDICTED: WD repeat-containing protein 44-like [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 31/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G++N+A L  ATFTSD KH++S +EDSNV IWN ++ + S     K+ RS E F + +AS
Sbjct  531  GLKNAANLRSATFTSDGKHIISASEDSNVYIWNCSDQEKSFFSQAKSTRSCERF-TMDAS  589

Query  440  VVVPWCG--------AG----------SSVPGSMLssgkaistsssSCCQFKGCATWPEE  315
            V +PW G        AG           ++P S  +       S       KG ATWPEE
Sbjct  590  VAIPWSGLKCEALEHAGKFGVVENKFPETLPFSSPACFSLSQESFLESIP-KGSATWPEE  648

Query  314  KLPNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KLP  SP P    + +S+YKF K++ QS   SS + WG+V+VTAG DG I++F NYGLP+
Sbjct  649  KLPTSSPLPKSSTMHRSEYKFFKTSCQST--SSSHAWGMVIVTAGWDGRIKSFHNYGLPV  706



>ref|XP_002318441.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE96661.1| WD-40 repeat family protein [Populus trichocarpa]
Length=654

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 96/161 (60%), Gaps = 19/161 (12%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSYESFYSHNASVVV  432
            N+A  + A+FT D KH++S  EDSNV +WNY + +      SK  RSYE F S NASV +
Sbjct  500  NTANQISASFTLDGKHIISACEDSNVHLWNYIDQEQHATPQSKNSRSYEHF-SANASVAI  558

Query  431  PWCGAGS---SVPGSMLssgkaistsssSCCQFKGCATWPEEK---LPNLSPSPVLKSDY  270
            PWCG      S P     S +  S S       KGCATWPEEK    P  + S + KS Y
Sbjct  559  PWCGLKFLPLSSPAHFSLSQEYFSESFP-----KGCATWPEEKLSSSPLSTSSAMHKSQY  613

Query  269  KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KFLK++ QS    S + WGLV+VTAG DG I++F NYGLP+
Sbjct  614  KFLKTSCQS--TDSSHAWGLVIVTAGWDGRIKSFHNYGLPV  652



>ref|NP_199016.1| WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB08434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94754.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=709

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 88/160 (55%), Gaps = 16/160 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNASVVVPWCGAG  414
            A+FTSD KH+VS  E+S + +W++++       Q  KT+RSYE F S N SV +PW G G
Sbjct  549  ASFTSDGKHIVSTIEESGIHVWDFSQPNKKASSQKPKTIRSYEGFLSRNVSVAIPWLGQG  608

Query  413  --SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL--------KSDYKF  264
               S+   +  S              KG  TWPEEKL  ++ +           +S  + 
Sbjct  609  KEDSIIADLEKSFAHFPVPLDYFSPMKGATTWPEEKLGVVAGTAAAAVSATVSSRSKLRL  668

Query  263  LKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            LKS  Q+   S+P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  669  LKSVCQNVHGSTPHLWGLVIVTATWDGSIRVFHNYGLPIR  708



>ref|XP_008437633.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cucumis 
melo]
 ref|XP_008437634.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cucumis 
melo]
 ref|XP_008437635.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cucumis 
melo]
Length=759

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 104/182 (57%), Gaps = 28/182 (15%)
 Frame = -3

Query  617  PISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYS  453
            P  +G  N+   + A+FTSD KH++S + DSNV +WN    NE  L   K ++SYE ++S
Sbjct  579  PFCSGPCNTGNQMSASFTSDGKHIISASGDSNVYVWNCSYKNEAVLSPVKKIKSYE-YFS  637

Query  452  HNASVVVPWCG------AGSS-VPGSM--------LssgkaistsssSCCQF-KGCATWP  321
             NAS+ VPWCG      AG    PG          L S    S S      F KG ATWP
Sbjct  638  SNASIAVPWCGLRCNTEAGERHFPGMQRNSSETFPLPSPAFFSLSQELLESFPKGSATWP  697

Query  320  EEKLPNLS----PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            EEKLP  S    PS + KS YKFLK + Q+   SS + WGLV+VTAG DG IR+F NYGL
Sbjct  698  EEKLPTSSLLSRPSLMHKSRYKFLKLSCQNT--SSSHAWGLVIVTAGWDGRIRSFHNYGL  755

Query  152  PI  147
            P+
Sbjct  756  PV  757



>gb|KCW89127.1| hypothetical protein EUGRSUZ_A01444 [Eucalyptus grandis]
Length=697

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 103/178 (58%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G R +     A+ TSD KH+VS +EDS+V IWN  + + S     K +RS E F S NAS
Sbjct  521  GCRGAGNQNFASLTSDGKHIVSASEDSSVYIWNCLDQKGSIPSEAKVIRSCERF-SSNAS  579

Query  440  VVVPWCG-AGSSVPGSM----LssgkaistsssSCCQF-----------KGCATWPEEKL  309
            V +PWCG    + P  +    L +    + SSS  C +           KG ATWPEEKL
Sbjct  580  VAIPWCGFKRRNSPDGLKLDDLGTKSLEALSSSPACFYQGHEFLLESFPKGSATWPEEKL  639

Query  308  PNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P  SP P    + K+ YKFL+++ QS   S+ + WGLV+VTAG DG IR+FLNYGLP+
Sbjct  640  PTSSPWPSSHAMHKTQYKFLRTSCQST--SNAHAWGLVIVTAGWDGRIRSFLNYGLPV  695



>ref|XP_004143851.1| PREDICTED: uncharacterized protein LOC101204856 [Cucumis sativus]
 ref|XP_004161452.1| PREDICTED: uncharacterized LOC101204856 [Cucumis sativus]
 gb|KGN49996.1| hypothetical protein Csa_5G148670 [Cucumis sativus]
Length=743

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 101/196 (52%), Gaps = 43/196 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN---ELQTSKTVRSYESFYSHNASVV  435
            G+RN    + A+FTSD KH+VS +E+ NV +WNYN   +    K + S ESF+S + ++ 
Sbjct  550  GLRNGGNKMSASFTSDGKHIVSASEE-NVYVWNYNCKDKASRKKKIWSSESFFSRSTTIA  608

Query  434  VPWCGAG------------SSVPGSMLssgkaistsssS-----------CCQF------  342
            +PW G                 PGS+       S                C         
Sbjct  609  IPWSGVKITPEPPLSPTRVCDTPGSIPEMEPKYSDDDGDREHKVPSSSPDCFSLSRTLFP  668

Query  341  ---KGCATWPEEKLPNLSPSPVL------KSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
               KG ATWPEEKL + S           K+++KFLK+A QS L SSP++WGLV+VTAG 
Sbjct  669  ELLKGTATWPEEKLHDSSSMTPSPSPSMCKTEFKFLKNACQSML-SSPHMWGLVIVTAGW  727

Query  188  DGYIRTFLNYGLPIRF  141
            DG IRTFLNYGLPIR 
Sbjct  728  DGRIRTFLNYGLPIRL  743



>ref|XP_010048920.1| PREDICTED: WD repeat-containing protein 44 [Eucalyptus grandis]
Length=726

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 103/178 (58%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G R +     A+ TSD KH+VS +EDS+V IWN  + + S     K +RS E F S NAS
Sbjct  550  GCRGAGNQNFASLTSDGKHIVSASEDSSVYIWNCLDQKGSIPSEAKVIRSCERF-SSNAS  608

Query  440  VVVPWCG-AGSSVPGSM----LssgkaistsssSCCQF-----------KGCATWPEEKL  309
            V +PWCG    + P  +    L +    + SSS  C +           KG ATWPEEKL
Sbjct  609  VAIPWCGFKRRNSPDGLKLDDLGTKSLEALSSSPACFYQGHEFLLESFPKGSATWPEEKL  668

Query  308  PNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P  SP P    + K+ YKFL+++ QS   S+ + WGLV+VTAG DG IR+FLNYGLP+
Sbjct  669  PTSSPWPSSHAMHKTQYKFLRTSCQST--SNAHAWGLVIVTAGWDGRIRSFLNYGLPV  724



>ref|XP_004498503.1| PREDICTED: WD repeat-containing protein 44-like [Cicer arietinum]
Length=727

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 103/175 (59%), Gaps = 29/175 (17%)
 Frame = -3

Query  593  SAG-LVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASVVVP  429
            SAG ++ AT TSD KH++S +EDSNV +WN ++ ++    +K +RS E F+S +ASV VP
Sbjct  554  SAGSVMSATLTSDGKHILSASEDSNVYLWNVSDDESRPVKAKKIRSCERFFS-DASVAVP  612

Query  428  WCGAGSSVPGSMLssgkaistsssSCC-----------QF------KGCATWPEEKLPNL  300
            WCG  S    +          S+ + C            F      KG ATWPEEKLP  
Sbjct  613  WCGLKSENIENAKKLDVLNKRSNQAMCLDPPSSFSLSQDFFLDSFPKGSATWPEEKLPTS  672

Query  299  SP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            SP    S + KS YKFLKS+ +S   S+ + WGLV+VTAG DG I++F NYGLP+
Sbjct  673  SPKSIKSALHKSAYKFLKSSCKST--SNCHAWGLVIVTAGWDGRIKSFHNYGLPV  725



>ref|XP_010441382.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Camelina 
sativa]
 ref|XP_010441383.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Camelina 
sativa]
 ref|XP_010441384.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Camelina 
sativa]
Length=721

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 85/162 (52%), Gaps = 18/162 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNASVVVPWCGAG  414
            A+FTSD KH+VS  EDS + +W+Y++       Q  KT+RSYE F SHN SV +PW G  
Sbjct  559  ASFTSDGKHIVSTIEDSGIHVWDYSQPNKKASSQKPKTIRSYEGFLSHNVSVAIPWLGQQ  618

Query  413  ---SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL---------KSDY  270
                +    +  +              KG  TWPEEKL  +               +S  
Sbjct  619  GKEDNFIADLEKTFAHFPAPMDYLSPNKGATTWPEEKLGVVVAGAAAAVVSATVSSRSKL  678

Query  269  KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            + L+S  Q+   SSP+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  679  RLLRSVCQNVNTSSPHLWGLVIVTATWDGRIRVFHNYGLPIR  720



>ref|XP_011084533.1| PREDICTED: WD repeat-containing protein 44 [Sesamum indicum]
Length=698

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 103/176 (59%), Gaps = 27/176 (15%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSYESFYSHNAS  441
            G+RN+   + A+FT+D KH+VS ++DSN+ IWNY + +      SK +RS+E F S +AS
Sbjct  525  GLRNTGNQISASFTADGKHIVSASDDSNIYIWNYADQRESSFSQSKAIRSFECF-SSDAS  583

Query  440  VVVPWCG--AGSSVPGSMLssgkaistsssSCCQF------------KGCATWPEEKLPN  303
            + +PW G   G+S   +++      +   SS   F            KG ATWPEEKLP 
Sbjct  584  IAIPWSGLKTGNSEE-ALIQETSTNTLPFSSSVHFSLSQENLLGSSSKGSATWPEEKLPA  642

Query  302  LSPS----PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             +P     P+ KS YK  K + QS+ +S  + WGLV+VTA  DG IR+F NYGLP+
Sbjct  643  STPQASTPPMSKSQYKLFKDSCQSSSSS--HAWGLVIVTASWDGRIRSFHNYGLPV  696



>ref|XP_008437430.1| PREDICTED: uncharacterized protein LOC103482847 [Cucumis melo]
Length=743

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 103/196 (53%), Gaps = 43/196 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN---ELQTSKTVRSYESFYSHNASVV  435
            G+RN    + A+FTSD KH+VS +E+ NV +WNYN   +    K + S ESF+S +A++ 
Sbjct  550  GLRNGGNKMSASFTSDGKHIVSASEE-NVYVWNYNCKDKASRKKKIWSSESFFSRSATIA  608

Query  434  VPWCGAGSS-----------------------VPGSMLssgkaistsssSCCQF------  342
            +PW G   +                        P         + +SS  C         
Sbjct  609  IPWSGVKITPEPPLSPTRVCDTTGIIPEMEPKYPDDDGDREHKVPSSSPDCFSLSRTLFP  668

Query  341  ---KGCATWPEEKLPNLSPSPVL------KSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
               KG ATWPEEKL + S           K+++KFLK+A QS L SSP++WGLV+VTAG 
Sbjct  669  ELLKGTATWPEEKLHDSSSMTPSPSPSMCKTEFKFLKNACQSML-SSPHMWGLVIVTAGW  727

Query  188  DGYIRTFLNYGLPIRF  141
            DG IRTFLNYGLPIR 
Sbjct  728  DGRIRTFLNYGLPIRL  743



>ref|XP_010482750.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010482751.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=662

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 92/177 (52%), Gaps = 43/177 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ----TSKTVRSYESFYSHNASV  438
            GV  +  L  A+ TSD KH+VS  EDSNV IW+ +E       SK +RS+E F S NASV
Sbjct  503  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNDEESDCSSQSKKIRSFERF-STNASV  561

Query  437  VVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEK  312
               WCG                      VPGS+                 KG ATWPEE 
Sbjct  562  AATWCGFSDHNTTLPFSSPSCFSLNERYVPGSIS----------------KGSATWPEEN  605

Query  311  LP--NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP   LS S +  S YKFLKS++Q A  SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  606  LPVNPLSTSAMNASHYKFLKSSYQRA--SSSLSWGMVIVTGGWDGRIRTFQNYGLPV  660



>ref|XP_009351967.1| PREDICTED: uncharacterized protein LOC103943394 [Pyrus x bretschneideri]
 ref|XP_009351968.1| PREDICTED: uncharacterized protein LOC103943394 [Pyrus x bretschneideri]
Length=723

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 100/177 (56%), Gaps = 27/177 (15%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G RN+     ATFTSD KH+VSV+EDS+V +WN +      L  +K +RS E F S N S
Sbjct  548  GQRNAGNQTSATFTSDGKHIVSVSEDSSVYVWNCSNHEERVLSQAKKIRSCERF-STNVS  606

Query  440  VVVPWCG--AGSSVPGSMLssgkaistss---sSCCQF----------KGCATWPEEKLP  306
            V +PW G   G+      L +       +   S+C             KG ATWPEEKLP
Sbjct  607  VAIPWSGFKCGTVENERQLQAADENLQETLPFSACFSLSQDSFLESIPKGSATWPEEKLP  666

Query  305  NLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
              +P    S +L S+YKF K++ Q+   SS + WG+V+VTAG DG IR+F NYGLP+
Sbjct  667  TSNPLANQSTMLISEYKFFKTSCQNT--SSSHAWGMVIVTAGWDGRIRSFHNYGLPV  721



>ref|XP_010436150.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Camelina 
sativa]
 ref|XP_010436151.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Camelina 
sativa]
 ref|XP_010436152.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Camelina 
sativa]
 ref|XP_010436154.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Camelina 
sativa]
Length=726

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 85/162 (52%), Gaps = 18/162 (11%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNASVVVPWCGAG  414
            A+FTSD KH+VS  EDS + +W+Y++       Q  KT+RSYE F SHN SV +PW G  
Sbjct  564  ASFTSDGKHIVSTIEDSGIHVWDYSQPNKKASSQKPKTIRSYEGFLSHNVSVAIPWLGQQ  623

Query  413  ---SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL---------KSDY  270
                +    +  +              KG  TWPEEKL  +               +S  
Sbjct  624  GKEDNFIADLEKTFAHFPAPMDYLSPNKGGTTWPEEKLGVVVAGAAAAAVSATVSSRSKL  683

Query  269  KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            + L+S  Q+   SSP+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  684  RLLRSVCQNVNTSSPHLWGLVIVTATWDGRIRVFHNYGLPIR  725



>ref|XP_008376769.1| PREDICTED: vegetative incompatibility protein HET-E-1-like [Malus 
domestica]
Length=723

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 101/179 (56%), Gaps = 29/179 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G RN+     AT TSD KH+VSV EDS+V +WN N      L  +K +RS E F S N S
Sbjct  546  GQRNAGNQTSATITSDGKHIVSVNEDSSVYVWNCNNHEERVLSQAKKIRSCERF-STNVS  604

Query  440  VVVPWCG--------------AGSSVPGSM-LssgkaistsssSCCQF--KGCATWPEEK  312
            V +PW G                 ++P  +  SS    S S  S  Q   KG ATWPEEK
Sbjct  605  VAIPWSGFKCGTVENERQFQAVDENLPERLPFSSPACFSLSQDSFLQSIPKGSATWPEEK  664

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP  SP    S + KS+YKFLK++ Q+   SS + WG+V+VTAG DG IR+F NYGLP+
Sbjct  665  LPTSSPLAKQSTMHKSEYKFLKTSCQNT--SSSHAWGMVIVTAGWDGRIRSFHNYGLPV  721



>ref|XP_010446951.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010446958.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=727

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 84/160 (53%), Gaps = 16/160 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNASVVVPWCGAG  414
            A+FTSD KH+VS  EDS + +W+Y++       Q  KT+RSYE F S N SV +PW G  
Sbjct  567  ASFTSDGKHIVSTIEDSGIHVWDYSQPNKKASSQKPKTIRSYEGFLSQNVSVAIPWLGQQ  626

Query  413  ---SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL-------KSDYKF  264
                +    +  +              KG  TWPEEKL     +          +S  + 
Sbjct  627  GKEDNFIADLEKTFAHFPVPMDYLSPIKGATTWPEEKLGVAGAAAAAVSATVSSRSKLRL  686

Query  263  LKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            L+S  Q+   SSP+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  687  LRSVCQNVNTSSPHLWGLVIVTATWDGRIRVFHNYGLPIR  726



>ref|XP_011024872.1| PREDICTED: WD repeat-containing protein 44-like isoform X3 [Populus 
euphratica]
Length=729

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 100/175 (57%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNASVVV  432
            N+A  + A+FTSD KH++S  EDS+V +WNY + +      SK  RSYE F S NASV +
Sbjct  556  NTANQISASFTSDGKHIISACEDSSVHLWNYIDQEQPATPQSKKSRSYEHF-SANASVAI  614

Query  431  PWCG--AGSSVPG---SMLssgkaistsssSCCQF------------KGCATWPEEKLPN  303
            PWCG   GS   G    +  +        SS   F            KGCATWPEEKL +
Sbjct  615  PWCGLKCGSLDNGWGFRVSDNNSQEVLPLSSPAHFSLSQEYFSESFPKGCATWPEEKLSS  674

Query  302  LSPS---PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               S    + KS YKFLKS+ QSA   S + WGLV+VTAG DG I++F NYGLP+
Sbjct  675  SPLSTSSAMHKSQYKFLKSSCQSA--DSSHAWGLVIVTAGWDGRIKSFHNYGLPV  727



>ref|XP_008437636.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Cucumis 
melo]
Length=719

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 101/175 (58%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNASVVV  432
            N+   + A+FTSD KH++S + DSNV +WN    NE  L   K ++SYE ++S NAS+ V
Sbjct  546  NTGNQMSASFTSDGKHIISASGDSNVYVWNCSYKNEAVLSPVKKIKSYE-YFSSNASIAV  604

Query  431  PWCG------AGSS-VPGSM--------LssgkaistsssSCCQF-KGCATWPEEKLPNL  300
            PWCG      AG    PG          L S    S S      F KG ATWPEEKLP  
Sbjct  605  PWCGLRCNTEAGERHFPGMQRNSSETFPLPSPAFFSLSQELLESFPKGSATWPEEKLPTS  664

Query  299  S----PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            S    PS + KS YKFLK + Q+   SS + WGLV+VTAG DG IR+F NYGLP+
Sbjct  665  SLLSRPSLMHKSRYKFLKLSCQNT--SSSHAWGLVIVTAGWDGRIRSFHNYGLPV  717



>ref|XP_011023150.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1X [Populus 
euphratica]
 ref|XP_011023152.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1X [Populus 
euphratica]
 ref|XP_011023153.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1X [Populus 
euphratica]
Length=744

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 100/200 (50%), Gaps = 46/200 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD  H+VS +EDS V IWNY        Q  K+  S E F+S+N S
Sbjct  546  GLRNAGSQISASFTSDGMHIVSASEDSYVYIWNYISQDGPVAQEKKSKWSCERFFSNNVS  605

Query  440  VVVPWCGAGS-SVPGSMLssgkaistsssSCCQF--------------------------  342
            V +PWCG  S +   S ++     S +S  C +                           
Sbjct  606  VAIPWCGMTSMNCSSSTVTGKSPSSINSGPCSEKGVLLQSELVESSQWKLPFSSPENLSL  665

Query  341  ----------KGCATWPEEKLPNLS---PSPVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
                      KG ATWPEE LP  S    S + KS YKFLK + QS +  SP+ WGLV+V
Sbjct  666  SHGFFSHSLPKGSATWPEENLPASSLVVSSAMCKSQYKFLKMSCQS-MHGSPHAWGLVIV  724

Query  200  TAGLDGYIRTFLNYGLPIRF  141
            TAG DG IR+F NYGLPI  
Sbjct  725  TAGWDGRIRSFQNYGLPIHL  744



>ref|XP_011024870.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
Length=732

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 100/175 (57%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNASVVV  432
            N+A  + A+FTSD KH++S  EDS+V +WNY + +      SK  RSYE F S NASV +
Sbjct  559  NTANQISASFTSDGKHIISACEDSSVHLWNYIDQEQPATPQSKKSRSYEHF-SANASVAI  617

Query  431  PWCG--AGSSVPG---SMLssgkaistsssSCCQF------------KGCATWPEEKLPN  303
            PWCG   GS   G    +  +        SS   F            KGCATWPEEKL +
Sbjct  618  PWCGLKCGSLDNGWGFRVSDNNSQEVLPLSSPAHFSLSQEYFSESFPKGCATWPEEKLSS  677

Query  302  LSPS---PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               S    + KS YKFLKS+ QSA   S + WGLV+VTAG DG I++F NYGLP+
Sbjct  678  SPLSTSSAMHKSQYKFLKSSCQSA--DSSHAWGLVIVTAGWDGRIKSFHNYGLPV  730



>gb|EYU19664.1| hypothetical protein MIMGU_mgv1a007057mg [Erythranthe guttata]
Length=421

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 101/172 (59%), Gaps = 22/172 (13%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+RN    + A+FTSD KH+VS +EDSNV IW Y + + S     K V+S+E F S +AS
Sbjct  251  GLRNGGNQISASFTSDGKHIVSASEDSNVYIWKYADQEDSSFLQPKAVKSFECF-SSDAS  309

Query  440  VVVPWCGAGSSVPGS--------MLssgkaistsssSCCQFKGC----ATWPEEKLPNLS  297
            V +PW G  +S P           LS+  ++S         KG     ATWPEEKLP  S
Sbjct  310  VAIPWPGIKASGPHESSNKPLPFSLSTSLSLSQDYFLDSITKGSSSAYATWPEEKLPISS  369

Query  296  P--SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               S + KS Y+F K++ QS+  S  + WGLV+VT+G DG IR+F NYGLP+
Sbjct  370  SLMSGISKSQYRFFKNSCQSS--SDSHAWGLVIVTSGWDGRIRSFHNYGLPV  419



>ref|XP_011024871.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Populus 
euphratica]
Length=731

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 100/175 (57%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNASVVV  432
            N+A  + A+FTSD KH++S  EDS+V +WNY + +      SK  RSYE F S NASV +
Sbjct  558  NTANQISASFTSDGKHIISACEDSSVHLWNYIDQEQPATPQSKKSRSYEHF-SANASVAI  616

Query  431  PWCG--AGSSVPG---SMLssgkaistsssSCCQF------------KGCATWPEEKLPN  303
            PWCG   GS   G    +  +        SS   F            KGCATWPEEKL +
Sbjct  617  PWCGLKCGSLDNGWGFRVSDNNSQEVLPLSSPAHFSLSQEYFSESFPKGCATWPEEKLSS  676

Query  302  LSPS---PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               S    + KS YKFLKS+ QSA   S + WGLV+VTAG DG I++F NYGLP+
Sbjct  677  SPLSTSSAMHKSQYKFLKSSCQSA--DSSHAWGLVIVTAGWDGRIKSFHNYGLPV  729



>ref|XP_010940865.1| PREDICTED: WD repeat-containing protein YMR102C-like [Elaeis 
guineensis]
 ref|XP_010940866.1| PREDICTED: WD repeat-containing protein YMR102C-like [Elaeis 
guineensis]
Length=740

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 99/184 (54%), Gaps = 35/184 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVR-----SYESFYSHNAS  441
            G+RNS   + A+FTSD +H++S +EDS V +W+YN   T ++ +     S E F+  N S
Sbjct  559  GLRNSGSQISASFTSDGRHIISASEDSYVYVWSYNSQDTPRSNQMKSTWSCERFFCSNVS  618

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF------------------------KGC  333
            V +PW G  S  P S LS    +     +  Q                         KG 
Sbjct  619  VAIPWQGMESRSPVSNLSQFLPLGQVPDNQSQPGSRGDNSLYMSPGRFSHEFSESLPKGS  678

Query  332  ATWPEEKLP-NLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNY  159
            ATWPEEKLP +L  SP L KS YKFLK++ Q+    + + WG V+VTAG DG IR+F NY
Sbjct  679  ATWPEEKLPLSLMTSPALPKSQYKFLKTSCQN----NSHAWGQVIVTAGWDGQIRSFQNY  734

Query  158  GLPI  147
            GLPI
Sbjct  735  GLPI  738



>emb|CDY68513.1| BnaCnng59300D [Brassica napus]
Length=633

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 92/169 (54%), Gaps = 26/169 (15%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            GV  +  L   + TSD KH+VS  EDSN+ IW+  E   S     K +RS+E F S NAS
Sbjct  472  GVCKTRSLTSVSLTSDGKHIVSACEDSNIYIWSNGEESDSSSSQTKKIRSFERF-STNAS  530

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF---------KGCATWPEEKLPN--LSP  294
            V   WCG         L     +  SS SC  +         KG ATWPEE LP   LS 
Sbjct  531  VAATWCG--------FLDHNATLPFSSPSCLSYEGFVPGSIPKGSATWPEENLPANPLSS  582

Query  293  SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            S +  S YKFLKS++Q A  SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  583  STMSASHYKFLKSSYQRATNSSL-AWGMVIVTGGWDGRIRTFQNYGLPV  630



>ref|XP_006857843.1| hypothetical protein AMTR_s00069p00055450 [Amborella trichopoda]
 gb|ERN19310.1| hypothetical protein AMTR_s00069p00055450 [Amborella trichopoda]
Length=768

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 104/202 (51%), Gaps = 48/202 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN--ELQTSKTVRSY---ESFYSHNAS  441
            G+RN+   + A+FTS+ KH+VS +EDS+V +W+Y   E +TSK  +S    E F+S+N+S
Sbjct  568  GLRNTGSQISASFTSNGKHIVSASEDSHVYVWSYETPEGRTSKQAKSVWSCERFFSNNSS  627

Query  440  VVVPWCGAGSSV-PGSMLssgkaistsss-------------SCCQ--------------  345
            V + W G  S   P S +S      TS                 C+              
Sbjct  628  VAITWSGLKSEARPSSEVSLKTNSRTSDELTESSENGFHSSWDSCRETPSVSSSSPDRFS  687

Query  344  ----------FKGCATWPEEKLPNL----SPSPVLKSDYKFLKSAWQSALASSPNLWGLV  207
                       +G ATWPEEKLP+     S     KS +KFLK+A +   AS P+ WGLV
Sbjct  688  LGHGFFADSLARGSATWPEEKLPSTDALSSAQSTCKSQFKFLKTASEGMFAS-PHTWGLV  746

Query  206  VVTAGLDGYIRTFLNYGLPIRF  141
            +VTAG DG IR+F NYGLP+R 
Sbjct  747  IVTAGWDGRIRSFHNYGLPVRL  768



>ref|XP_008775396.1| PREDICTED: WD repeat-containing protein 44 [Phoenix dactylifera]
Length=701

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 103/185 (56%), Gaps = 36/185 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+ N+   + A+FTSD +H++S +EDS V IW+Y+          K+ RS+E F+S+NAS
Sbjct  519  GLWNAGNQISASFTSDGRHIISASEDSYVYIWSYSSKDAPRSNQVKSTRSHERFFSNNAS  578

Query  440  VVVPWCGAGS--------------------SVPGSMLssgkaistsssSCCQF-----KG  336
            + +PW G  S                    S PGS+  +     + +     F     KG
Sbjct  579  IALPWQGMESRSRVSDLSGFLPLQQVPNNQSQPGSIGDNSLYTGSFTIRHEFFSESLPKG  638

Query  335  CATWPEEKLPNLS-PSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLN  162
             ATWPEEKLP+ S  SP L KS YKFLK++ Q+    + + WG V+VTAG DG IR+F N
Sbjct  639  SATWPEEKLPSSSMTSPALPKSQYKFLKTSCQN----NSHAWGQVIVTAGWDGQIRSFQN  694

Query  161  YGLPI  147
            YGLP+
Sbjct  695  YGLPV  699



>ref|XP_009588536.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nicotiana 
tomentosiformis]
Length=650

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 97/181 (54%), Gaps = 36/181 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKT-----VRSYESFYSHNAS  441
            G+RN+   + A FTSD KH++S +EDSNV +WN++  + S       VRS+E F++ +A+
Sbjct  474  GLRNAGSHLSAAFTSDGKHIISASEDSNVYLWNFHIPEESSVSQPGAVRSFE-FFNGDAT  532

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF--------------------KGCATWP  321
            + +PW G    +      +       S S   F                    KG ATWP
Sbjct  533  IAIPWSG----LKNVNQENRCHSQGLSQSLTNFPFPSSPWFTLGQELFLEAIPKGSATWP  588

Query  320  EEKLPNLSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            EEKLP   P PV     KS YKFLK + QS+  S  + WGLV+VTAG DG IR+F NYGL
Sbjct  589  EEKLPVSHPRPVPSAMCKSHYKFLKRSCQSS--SRSHAWGLVIVTAGYDGRIRSFHNYGL  646

Query  152  P  150
            P
Sbjct  647  P  647



>gb|KJB19862.1| hypothetical protein B456_003G122000 [Gossypium raimondii]
Length=728

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 101/179 (56%), Gaps = 29/179 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSYESFYSHNAS  441
            G  N+      + T D KH+VS  ED+NV IWN  +        +K +RS+E F++ NAS
Sbjct  551  GACNNVNQAFTSLTPDGKHIVSACEDANVYIWNCVDQDECTHSNAKDIRSFERFFA-NAS  609

Query  440  VVVPWCGA--GSSVPG---SMLssgkaistsssSCCQF------------KGCATWPEEK  312
            + +PWCG   G++  G    +L+   + +   SS   F            K  ATWPEE+
Sbjct  610  IAIPWCGMKCGNAENGRQFEVLNENLSDNLPLSSPSHFSLSHEYFLESFPKESATWPEER  669

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP  SP    S + KS YKFLK++ QS   S  + WGLV+VTAG+DG IR+FLNYGLP+
Sbjct  670  LPPSSPLTVSSSMHKSQYKFLKTSCQSTFES--HAWGLVIVTAGMDGRIRSFLNYGLPV  726



>ref|XP_009588525.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nicotiana 
tomentosiformis]
Length=721

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 97/181 (54%), Gaps = 36/181 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKT-----VRSYESFYSHNAS  441
            G+RN+   + A FTSD KH++S +EDSNV +WN++  + S       VRS+E F++ +A+
Sbjct  545  GLRNAGSHLSAAFTSDGKHIISASEDSNVYLWNFHIPEESSVSQPGAVRSFE-FFNGDAT  603

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF--------------------KGCATWP  321
            + +PW G    +      +       S S   F                    KG ATWP
Sbjct  604  IAIPWSG----LKNVNQENRCHSQGLSQSLTNFPFPSSPWFTLGQELFLEAIPKGSATWP  659

Query  320  EEKLPNLSPSPV----LKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            EEKLP   P PV     KS YKFLK + QS+  S  + WGLV+VTAG DG IR+F NYGL
Sbjct  660  EEKLPVSHPRPVPSAMCKSHYKFLKRSCQSS--SRSHAWGLVIVTAGYDGRIRSFHNYGL  717

Query  152  P  150
            P
Sbjct  718  P  718



>emb|CDP05030.1| unnamed protein product [Coffea canephora]
Length=734

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 77/178 (43%), Positives = 101/178 (57%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-YNELQTS----KTVRSYESFYSHNAS  441
            G R+S   + A+ TSD KH++S +EDSNV +WN +N   TS    K VR++E F S +AS
Sbjct  558  GSRSSGNQISASCTSDGKHIISASEDSNVYMWNSFNLDDTSPSQPKNVRAFECF-SGDAS  616

Query  440  VVVPWCG--AGSSVPGSMLs----sgkaistsssSCCQF----------KGCATWPEEKL  309
            V +PW G   G S     LS    +       S +C             +G ATWPEEKL
Sbjct  617  VAIPWFGLKRGDSDDMQQLSGIDRNSTDKLPLSPTCLSLGHEFFLESIPRGSATWPEEKL  676

Query  308  P----NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P     +  S + KS YKFLK+A+QS+  S  + WG+V+V AG DG IR+F NYGLPI
Sbjct  677  PASGSQVVASLLSKSQYKFLKTAFQSS--SGSHAWGMVIVAAGWDGRIRSFHNYGLPI  732



>ref|XP_010109232.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXC21412.1| WD repeat-containing protein 44 [Morus notabilis]
Length=708

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 101/179 (56%), Gaps = 29/179 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-YNELQT----SKTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD KH+VS  EDSNV +W+ + E +T    SK VRS E F S NAS
Sbjct  531  GLRNAGNQISASFTSDGKHIVSACEDSNVYLWSCFGEEETVLSQSKKVRSCERF-STNAS  589

Query  440  VVVPWCG--AGSSVPGSMLssgkaist-----sssSCCQF----------KGCATWPEEK  312
            V +PW G   G+S  GS         +     SS  C             K  ATWPEEK
Sbjct  590  VAIPWSGLQCGNSENGSQFHIVDKCISDTLPFSSLECFSISQEFFLESFPKASATWPEEK  649

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP  SP    S + +S  KFLKS+ ++   S  + WG+V+VTAG DG IR+F NYGLPI
Sbjct  650  LPISSPQAKQSTMHRSQLKFLKSSCKNTPTS--HAWGMVIVTAGWDGRIRSFHNYGLPI  706



>ref|XP_009361332.1| PREDICTED: uncharacterized protein LOC103951627 [Pyrus x bretschneideri]
Length=718

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 104/187 (56%), Gaps = 29/187 (16%)
 Frame = -3

Query  629  HLLFPISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYE  465
             +L  +S   + +     ATFTSD KH+VSV EDS+V +WN N      L  +K +RS E
Sbjct  533  RILHGLSVVGKYAGNQTSATFTSDGKHIVSVNEDSSVYVWNCNNHEERVLSQAKKIRSCE  592

Query  464  SFYSHNASVVVPWCG--------------AGSSVPGSM-LssgkaistsssSCCQF--KG  336
             F S N SV +PW G                 ++P  +  SS    + S  S  Q   KG
Sbjct  593  RF-STNVSVAIPWSGFKCGTVENERQFQAVDENLPERLPFSSPACFALSQDSFLQSIPKG  651

Query  335  CATWPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTF  168
             ATWPEEKLP  SP    S + KS+YKFLK++ Q+   SS + WG+V+VTAG DG IR+F
Sbjct  652  SATWPEEKLPTSSPLAKQSTMHKSEYKFLKTSCQNT--SSSHAWGMVIVTAGWDGRIRSF  709

Query  167  LNYGLPI  147
             NYGLP+
Sbjct  710  HNYGLPV  716



>ref|XP_009127162.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
 ref|XP_009127163.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
 emb|CDY49166.1| BnaA02g10250D [Brassica napus]
Length=633

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 91/179 (51%), Gaps = 44/179 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNA  444
            GV  +  L  A+ TSD KH+VS  EDSNV IW+  +         +K +RS+E F S NA
Sbjct  470  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNGDESDSSSSSQTKKIRSFERF-STNA  528

Query  443  SVVVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPE  318
            SV   WCG                      VPGS+                 KG ATWPE
Sbjct  529  SVAATWCGFSDHNATLPFSSPSCLSINEGFVPGSIP----------------KGSATWPE  572

Query  317  EKLPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            E LP   LS S +  S YKFLKS++Q A  SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  573  ENLPANPLSSSTMSASHYKFLKSSYQRATNSSL-AWGMVIVTGGWDGRIRTFQNYGLPV  630



>ref|XP_010694812.1| PREDICTED: WD repeat-containing protein 44-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010694873.1| PREDICTED: WD repeat-containing protein 44-like [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 98/194 (51%), Gaps = 40/194 (21%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN--YNELQTSKTVRSY---ESFYSHNAS  441
            G+RN+   + ATFTSD +H+VS +EDS V +W+   ++   S  +RS    E F+SHNA 
Sbjct  553  GLRNAGSQISATFTSDGEHIVSASEDSFVYVWDCTNSDRAVSSHLRSKHSSERFFSHNAC  612

Query  440  VVVPW----CG------AGSSVP--GSMLssgkaistsssSCCQF---------------  342
            V VPW    CG      +GSS    G M+                               
Sbjct  613  VAVPWHGTTCGNISSNLSGSSTKHSGVMVRYTTETGPEHRPSVDRTSLFSTDTISLGFSD  672

Query  341  ---KGCATWPEEKLPN----LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDG  183
               +G ATWPEEKL      +  S   KS+YK LK+  Q+ +A SP  WGLV+VTAG DG
Sbjct  673  PFSRGVATWPEEKLIGSNSLIVSSATCKSEYKLLKTTCQN-MAGSPQAWGLVIVTAGWDG  731

Query  182  YIRTFLNYGLPIRF  141
             IR F NYGLP+R 
Sbjct  732  RIRVFQNYGLPVRL  745



>emb|CDX67522.1| BnaA07g15620D [Brassica napus]
Length=625

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 89/172 (52%), Gaps = 26/172 (15%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL--------QTSKTVRSYESFY  456
            ++ +R +     A FTSD KH+VS  EDS + +W+Y++         Q  KT+RSYE F 
Sbjct  463  ASSLRTTLSPTSALFTSDGKHIVSTIEDSGIHVWDYSQPNKKAASPPQKPKTIRSYEGFL  522

Query  455  SHNASVVVPWCGAGS------SVPGSMLssgkaistsssSC-CQFKGCATWPEEKLPNLS  297
            S N SV +PW G G       S    +      +      C  Q KG  TWPEEKL  L 
Sbjct  523  SDNVSVAIPWLGQGKEEDSVCSFIADLDKKFAHLPLPVRDCFSQVKGATTWPEEKLGVL-  581

Query  296  PSPVLKSDYKFLKSAWQSALAS-SPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                     + L+S  Q+   + +P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  582  ---------RLLRSVCQNVNNTCTPHLWGLVIVTATWDGRIRVFHNYGLPIR  624



>gb|KDO59630.1| hypothetical protein CISIN_1g005352mg [Citrus sinensis]
Length=686

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 92/163 (56%), Gaps = 28/163 (17%)
 Frame = -3

Query  560  DEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNASVVVPWCGA----GSS  408
            D KH+VS  EDSNV +WN   + E     +KT+RS E F + NAS+ +PWCG        
Sbjct  525  DGKHIVSAGEDSNVYMWNCIGHEEPAHDQAKTIRSLERFTT-NASIAIPWCGLKCGNAEK  583

Query  407  VPGSMLssgkaistsssSCCQF------------KGCATWPEEKLPNLSP----SPVLKS  276
             P   +S   +    + +  +F            KGCATWPEEKLP LS     S + KS
Sbjct  584  EPQLHVSDDDSPENLAFAPARFSLGQEYVFESFPKGCATWPEEKLPALSQLSSASALHKS  643

Query  275  DYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             YKFLKS+      +S + WGLV+VTAG DG IR+FLNYGLPI
Sbjct  644  QYKFLKSS--CLCTTSSHAWGLVIVTAGWDGRIRSFLNYGLPI  684



>ref|XP_002302646.2| hypothetical protein POPTR_0002s17470g [Populus trichocarpa]
 gb|EEE81919.2| hypothetical protein POPTR_0002s17470g [Populus trichocarpa]
Length=744

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 99/200 (50%), Gaps = 46/200 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD  H+VS +EDS V IWN         Q  K+  S E F+S+N S
Sbjct  546  GLRNAGSQISASFTSDGMHIVSASEDSYVYIWNNISQDGPVAQEKKSKWSCERFFSNNVS  605

Query  440  VVVPWCGAGS-SVPGSMLssgkaistsssSCCQF--------------------------  342
            V +PWCG  S +   S ++     S +S  C +                           
Sbjct  606  VAIPWCGMTSMNCSSSTVTRKSPSSINSGPCSEKSVLLQSELVESSQWKLPFSSPENLSL  665

Query  341  ----------KGCATWPEEKLPNLS---PSPVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
                      KG ATWPEE LP  S    S + KS YKFLK + QS +  SP+ WGLV+V
Sbjct  666  SHGFFSHSLPKGSATWPEENLPASSLVVSSAMCKSQYKFLKMSCQS-MHGSPHAWGLVIV  724

Query  200  TAGLDGYIRTFLNYGLPIRF  141
            TAG DG IR+F NYGLP+  
Sbjct  725  TAGWDGRIRSFQNYGLPVHL  744



>gb|KEH35471.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=702

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 98/179 (55%), Gaps = 32/179 (18%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNASVVV  432
            N+   + A+FTSD KH++S  EDSNV +WN N+ ++     SK VRS E F S NASV V
Sbjct  525  NTGSPMCASFTSDGKHILSACEDSNVYLWNVNQEESNNPMKSKKVRSCERF-SSNASVAV  583

Query  431  PWCGAGSSV-------------PGSMLssgkaistsssSCCQF------KGCATWPEEKL  309
            PW G    V             P  ++        S S    F      KG ATWPEEKL
Sbjct  584  PWHGLKPQVTENEQLNVLDKKSPQVVMQLHPNPPASFSLSQDFFLESFPKGSATWPEEKL  643

Query  308  P-----NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            P         S + KS+YKFLKS+ +S   +S + WG+V+VTAG DG I+TF NYGLP+
Sbjct  644  PVSGSKTKKTSLLRKSEYKFLKSSCKST--NSAHAWGMVIVTAGWDGKIKTFQNYGLPV  700



>ref|XP_006439270.1| hypothetical protein CICLE_v10019710mg [Citrus clementina]
 ref|XP_006439271.1| hypothetical protein CICLE_v10019710mg [Citrus clementina]
 gb|ESR52510.1| hypothetical protein CICLE_v10019710mg [Citrus clementina]
 gb|ESR52511.1| hypothetical protein CICLE_v10019710mg [Citrus clementina]
Length=525

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 101/198 (51%), Gaps = 42/198 (21%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVRSY----ESFYSHNA  444
            ++  R +   + ATFTSD KHVVS +EDSN+ IWNY+    S +        ESF SHN 
Sbjct  329  ASAFRVAGSQMFATFTSDGKHVVSPSEDSNIYIWNYSNQDKSSSRSKSIWSCESFLSHNV  388

Query  443  SVVVPWCG---AGSSVPGSMLssgkaistsssSCCQ------------------------  345
            SV +PW G      ++P          ++   +  Q                        
Sbjct  389  SVAIPWVGLETTAGALPSPTFGEKMQRNSLKQNNHQNLEGDLDQNMPHSPSDCFSHARDF  448

Query  344  -----FKGCATWPEEKLPNLSP-----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                  K  ATWPEEKLPN SP     SP+ KS  K LKSA QS L S+P+LWGLVVVTA
Sbjct  449  FLEYMTKSAATWPEEKLPNASPKAVSLSPLCKSKLKLLKSACQSIL-SNPHLWGLVVVTA  507

Query  194  GLDGYIRTFLNYGLPIRF  141
              DG IRT+LNYGLPIR 
Sbjct  508  SWDGRIRTYLNYGLPIRI  525



>ref|XP_010454738.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Camelina sativa]
Length=713

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 94/168 (56%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN--YNELQTSKT----------VRSYES  462
            G RN+   + A+FT+D KH+VS  +DS+V +WN   N  Q   T          +RS+E 
Sbjct  546  GSRNTGNQISASFTADGKHIVSACDDSSVYVWNCVGNNPQQPSTGFFSYTKRLKIRSFEK  605

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  606  F-SADVSVAIPWCGFAPVISGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  664

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG IR F NYGLP+
Sbjct  665  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIRLFHNYGLPV  711



>ref|XP_006287156.1| hypothetical protein CARUB_v10000330mg [Capsella rubella]
 gb|EOA20054.1| hypothetical protein CARUB_v10000330mg [Capsella rubella]
Length=717

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 95/168 (57%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN--YNELQTSKT----------VRSYES  462
            G RN+   + A+FT+D KH++S  +DS+V +WN   N+ +   T          +RS+E 
Sbjct  550  GSRNTGNQISASFTADGKHIISACDDSSVYVWNCVGNDPEQPSTGFFSYTKRLKIRSFEK  609

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  610  F-SADVSVAIPWCGFAPVISGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  668

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG IR F NYGLP+
Sbjct  669  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIRLFHNYGLPV  715



>ref|XP_008381066.1| PREDICTED: striatin homolog [Malus domestica]
 ref|XP_008381071.1| PREDICTED: striatin homolog [Malus domestica]
Length=725

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 95/179 (53%), Gaps = 29/179 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNAS  441
            G RN+     ATFTSD KH+VSV+EDS+V +WN N      L  +K +RS E F S N S
Sbjct  548  GQRNAGNQTSATFTSDGKHIVSVSEDSSVYVWNCNNHEERVLSQAKKIRSCERF-STNVS  606

Query  440  VVVPWCG--AGSSVPGSMLssgkaistsss-----SCCQF----------KGCATWPEEK  312
            V +PW G   G+        +       +      +C             KG ATWPEE 
Sbjct  607  VAIPWSGFKCGTVENERQFQAADENLQDALPFSSPACFSLSQDSFLESIPKGSATWPEEN  666

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP  SP    S +  S+YKF K + Q+   SS + WG+V+VTAG DG IR+F NYGLP+
Sbjct  667  LPTTSPLANQSNMHISEYKFFKISCQNT--SSSHAWGMVIVTAGWDGRIRSFHNYGLPV  723



>ref|XP_006401696.1| hypothetical protein EUTSA_v10012916mg [Eutrema salsugineum]
 ref|XP_006401697.1| hypothetical protein EUTSA_v10012916mg [Eutrema salsugineum]
 gb|ESQ43149.1| hypothetical protein EUTSA_v10012916mg [Eutrema salsugineum]
 gb|ESQ43150.1| hypothetical protein EUTSA_v10012916mg [Eutrema salsugineum]
Length=654

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 90/177 (51%), Gaps = 43/177 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            GV  +  L  A+ + D KH+VS  EDSNV IW+  E   S    K +RS+E F S NASV
Sbjct  494  GVCKTRRLTSASLSFDGKHIVSACEDSNVYIWSNGEESDSSSQTKKIRSFERF-STNASV  552

Query  437  VVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEK  312
               WCG                      VPGS+                 KG ATWPEE 
Sbjct  553  ATTWCGFSDHNTTLPFSSPSFLSLSEGFVPGSIS----------------KGNATWPEEN  596

Query  311  LPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP   LS S +  S YKFLKS++Q A +S    WG+V+VT G DG IRTF NYGLP+
Sbjct  597  LPVNPLSTSAMNASHYKFLKSSYQRATSSLA--WGMVIVTGGWDGRIRTFQNYGLPV  651



>ref|XP_008803044.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera]
Length=718

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 98/184 (53%), Gaps = 37/184 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL------QTSKTVRSYESFYSHNA  444
            G+RNS   + A+FTSD +H++S +EDS V +W+Y+        Q S+T RS E F+S N 
Sbjct  537  GLRNSGSQISASFTSDGRHIISASEDSYVYVWSYSSQDAPRSNQGSRT-RSCERFFSSNV  595

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCCQF------------------------KG  336
            SV +PW G  S  P S LS    +     +  Q                         KG
Sbjct  596  SVAIPWQGMESRGPVSDLSQFLPLQQVPDNQSQPGLRGDNSLSMSSGSFSREFSESLPKG  655

Query  335  CATWPEEKLPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLN  162
             ATWPEE LP+  ++P  + KS YKFLK++ Q+    + + WG V+VTAG DG IR F N
Sbjct  656  SATWPEENLPSSLMTPPALPKSQYKFLKTSCQN----NSHAWGQVIVTAGWDGQIRLFQN  711

Query  161  YGLP  150
            YGLP
Sbjct  712  YGLP  715



>gb|KDO76652.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
 gb|KDO76653.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
 gb|KDO76654.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
Length=755

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 101/198 (51%), Gaps = 42/198 (21%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVRSY----ESFYSHNA  444
            ++  R +   + ATFTSD KHVVS +EDSN+ IWNY+    S +        ESF SHN 
Sbjct  559  ASAFRVAGSQMFATFTSDGKHVVSPSEDSNIYIWNYSNQDKSSSRSKSIWSCESFLSHNV  618

Query  443  SVVVPWCG---AGSSVPGSMLssgkaistsssSCCQ------------------------  345
            SV +PW G      ++P          ++   +  Q                        
Sbjct  619  SVAIPWVGLETTAGALPSPTFGEKMQRNSLKQNNHQNLEGDLDQNMPHSPSDCFSHARDF  678

Query  344  -----FKGCATWPEEKLPNLSP-----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                  K  ATWPEEKLPN SP     SP+ KS  K LKSA QS L S+P+LWGLVVVTA
Sbjct  679  FLEYMTKSAATWPEEKLPNASPKAVSLSPLCKSKLKLLKSACQSIL-SNPHLWGLVVVTA  737

Query  194  GLDGYIRTFLNYGLPIRF  141
              DG IRT+LNYGLPIR 
Sbjct  738  SWDGRIRTYLNYGLPIRI  755



>ref|XP_004145945.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus]
 ref|XP_004171238.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus]
 gb|KGN49840.1| hypothetical protein Csa_5G139180 [Cucumis sativus]
Length=720

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 99/175 (57%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNASVVV  432
            N+     A+FTSD KH++S + DSNV +WN    NE  L   K ++SYE ++S NAS+ V
Sbjct  547  NTGNQTSASFTSDGKHIISASGDSNVYVWNCSYKNEAVLSPVKKIKSYE-YFSSNASIAV  605

Query  431  PWCG------AGSS-VPGSM--------LssgkaistsssSCCQF-KGCATWPEEKLPNL  300
            PW G      AG    PG          L S    S S      F KG ATWPEEKLP  
Sbjct  606  PWYGLRCNTEAGERHFPGMQRNSSETFPLPSPAFFSLSQELLESFPKGSATWPEEKLPTS  665

Query  299  S----PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            S    PS + KS YKFLK + Q+   SS + WGLV+VTAG DG IR+F NYGLP+
Sbjct  666  SLLPKPSMMHKSRYKFLKLSCQNT--SSSHAWGLVIVTAGWDGRIRSFHNYGLPV  718



>emb|CDX88095.1| BnaA06g26860D [Brassica napus]
Length=639

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 94/170 (55%), Gaps = 20/170 (12%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-------------YNELQTSKTVRSYE  465
            G RN+   + A+FT D KH++S  +DS+V +WN             ++  +  K +RS+E
Sbjct  471  GSRNAGNQISASFTGDGKHIISACDDSSVYVWNCVPHDPEPPSPGFFSHTKRIK-IRSFE  529

Query  464  SFYSHNASVVVPWCGAGSSV--PGSMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP  294
             F S + SV +PWCG  S     GS LS               KG ATWPEEKL +  SP
Sbjct  530  KF-SADVSVAIPWCGFSSPAISGGSELSPSLFSLGREYVLDSPKGAATWPEEKLASSFSP  588

Query  293  -SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               + +S Y+FL+S+ +   A S +LWGLV+VT G DG IR F NYGLP+
Sbjct  589  VRAIRRSHYRFLRSSCRRT-AESSHLWGLVIVTGGWDGRIRLFHNYGLPV  637



>ref|XP_010445864.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010445867.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010445872.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010445878.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010445882.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=660

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 91/177 (51%), Gaps = 43/177 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ----TSKTVRSYESFYSHNASV  438
            GV  +  L  A+ TSD KH+VS  EDSNV IW+ ++       SK +RS+E F S NASV
Sbjct  501  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNDDESDCSSQSKKIRSFERF-STNASV  559

Query  437  VVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEEK  312
               W G                      VPGS+                 KG ATWPEE 
Sbjct  560  AATWSGFSDHNTTLPFSSPSCLSLNEGYVPGSIS----------------KGSATWPEEN  603

Query  311  LPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP   LS S +  S YKF+KS++Q A  SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  604  LPVNPLSTSAMNASHYKFIKSSYQRA--SSSLSWGMVIVTGGWDGRIRTFQNYGLPV  658



>ref|XP_010421260.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Camelina sativa]
Length=720

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 92/168 (55%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN------------YNELQTSKTVRSYES  462
            G RN+   + A+FT+D KH+VS  +DS+V +WN            +        +RS+E 
Sbjct  553  GSRNTGNQISASFTADGKHIVSACDDSSVYVWNCVGNGPEQPSTGFFSYTKRLKIRSFEK  612

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  613  F-SADVSVAIPWCGFAPVISGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  671

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG IR F NYGLP+
Sbjct  672  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIRLFHNYGLPV  718



>ref|XP_010493579.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Camelina sativa]
Length=714

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 92/168 (55%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN------------YNELQTSKTVRSYES  462
            G RN+   + A+FT+D KH+VS  +DS+V +WN            +        +RS+E 
Sbjct  547  GSRNTGNQISASFTADGKHIVSACDDSSVYVWNCVGKDPQQPSTGFFSYTKRLKIRSFEK  606

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  607  F-SADVSVAIPWCGFAPVISGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  665

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG IR F NYGLP+
Sbjct  666  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIRLFHNYGLPV  712



>ref|XP_008790515.1| PREDICTED: uncharacterized protein LOC103707703 [Phoenix dactylifera]
Length=755

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 100/200 (50%), Gaps = 49/200 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G RN+   + A+FT+D +H++S  EDSNV +W++   +       K+  S E F+S N S
Sbjct  560  GPRNAGSQISASFTADGRHIISACEDSNVYVWDHANQEVPFSNHLKSTWSCERFFSDNVS  619

Query  440  VVVPWCGAGSSVPGSM------------------------------------Lssgkais  369
            + +PW G G   P S+                                    LS   + +
Sbjct  620  IAIPWHGLGCRNPVSVTSEVLPSQEDVFLDQAGTTDDSSHHGEDSFGNNTLSLSPSGSFT  679

Query  368  tsssSCCQF--KGCATWPEEKLPNLS--PSPVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
             S     +F  KG ATWPEEKLP+ S   S + KS YKFLKS+ Q     + + WG V+V
Sbjct  680  LSHEFISEFLPKGSATWPEEKLPSSSTTASALCKSQYKFLKSSCQG----TSHAWGQVIV  735

Query  200  TAGLDGYIRTFLNYGLPIRF  141
            TAGLDG IR+F NYGLP+R 
Sbjct  736  TAGLDGRIRSFQNYGLPVRL  755



>ref|XP_006476326.1| PREDICTED: WD repeat-containing protein YMR102C-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476327.1| PREDICTED: WD repeat-containing protein YMR102C-like isoform 
X2 [Citrus sinensis]
Length=756

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 101/199 (51%), Gaps = 43/199 (22%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVRSY----ESFYSHNA  444
            ++  R +   + ATFTSD KHVVS +EDSN+ IWNY+    S +        ESF SHN 
Sbjct  559  ASAFRVAGSQMFATFTSDGKHVVSPSEDSNIYIWNYSNQDKSSSRSKSIWSCESFLSHNV  618

Query  443  SVVVPWCG---AGSSVPGSMLssgkaistsssSCCQ------------------------  345
            SV +PW G      ++P          ++   +  Q                        
Sbjct  619  SVAIPWVGLETTAGALPSPTFGEKMQRNSLKQNNHQNLEGDLDQNMPHSPSDCFSHARDF  678

Query  344  -----FKGCATWPEEKLPNLSP------SPVLKSDYKFLKSAWQSALASSPNLWGLVVVT  198
                  K  ATWPEEKLPN SP      SP+ KS  K LKSA QS L S+P+LWGLV+VT
Sbjct  679  FLEYMTKSAATWPEEKLPNASPPKAVSLSPLCKSKLKLLKSACQSIL-SNPHLWGLVIVT  737

Query  197  AGLDGYIRTFLNYGLPIRF  141
            A  DG IRT+LNYGLPIR 
Sbjct  738  ASWDGRIRTYLNYGLPIRI  756



>ref|XP_007051501.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007051503.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95658.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95660.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
Length=753

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 98/203 (48%), Gaps = 49/203 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASV  438
            G+RN+   + A+FTSD   +VS +EDSNV +WNY      +  +K   S E F+S+NASV
Sbjct  552  GLRNAGSQISASFTSDGMRIVSASEDSNVYVWNYISQDRSVPQAKNNWSCERFFSNNASV  611

Query  437  VVPW----------------------------CGAGSSVPGSMLssgkaistsssSCCQF  342
             +PW                            C   +    S L          SS  +F
Sbjct  612  AIPWCGMTSRNSIFSKTSGTSPSPRVFSSSWRCNEYTGALQSELGESSQHKLPFSSSERF  671

Query  341  ------------KGCATWPEEKLPN----LSPSPVLKSDYKFLKSAWQSALASSPNLWGL  210
                        KG ATWPEEKLP     +  S + KS YK LK++  SAL S+ N WGL
Sbjct  672  SLGHGFFLESLPKGTATWPEEKLPPPNSLVVSSAMCKSQYKLLKTSCHSALGSA-NAWGL  730

Query  209  VVVTAGLDGYIRTFLNYGLPIRF  141
            V+VTAG DG IR+F NYGLPI  
Sbjct  731  VIVTAGWDGRIRSFQNYGLPIHL  753



>ref|XP_007051502.1| Transducin/WD40 repeat superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95659.1| Transducin/WD40 repeat superfamily protein isoform 2 [Theobroma 
cacao]
Length=754

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 98/203 (48%), Gaps = 49/203 (24%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASV  438
            G+RN+   + A+FTSD   +VS +EDSNV +WNY      +  +K   S E F+S+NASV
Sbjct  553  GLRNAGSQISASFTSDGMRIVSASEDSNVYVWNYISQDRSVPQAKNNWSCERFFSNNASV  612

Query  437  VVPW----------------------------CGAGSSVPGSMLssgkaistsssSCCQF  342
             +PW                            C   +    S L          SS  +F
Sbjct  613  AIPWCGMTSRNSIFSKTSGTSPSPRVFSSSWRCNEYTGALQSELGESSQHKLPFSSSERF  672

Query  341  ------------KGCATWPEEKLPN----LSPSPVLKSDYKFLKSAWQSALASSPNLWGL  210
                        KG ATWPEEKLP     +  S + KS YK LK++  SAL S+ N WGL
Sbjct  673  SLGHGFFLESLPKGTATWPEEKLPPPNSLVVSSAMCKSQYKLLKTSCHSALGSA-NAWGL  731

Query  209  VVVTAGLDGYIRTFLNYGLPIRF  141
            V+VTAG DG IR+F NYGLPI  
Sbjct  732  VIVTAGWDGRIRSFQNYGLPIHL  754



>emb|CDX80433.1| BnaC07g30110D [Brassica napus]
Length=671

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 94/170 (55%), Gaps = 20/170 (12%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-------------YNELQTSKTVRSYE  465
            G RN+   + A+FT D KH++S  +DS+V +WN             ++  +  K +RS+E
Sbjct  503  GSRNAGNQISASFTGDGKHIISACDDSSVYVWNCVPHDPEPPSPGFFSHTKRIK-IRSFE  561

Query  464  SFYSHNASVVVPWCGAGSS--VPGSMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP  294
             F S + SV +PWCG  S     GS LS               KG ATWPEEKL +  SP
Sbjct  562  KF-SADVSVAIPWCGFSSPGISGGSELSPSLFSLGREYVLDSPKGAATWPEEKLASSFSP  620

Query  293  -SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               + +S Y+FL+S+ +   A S +LWGLV+VT G DG IR F NYGLP+
Sbjct  621  VRAIRRSHYRFLRSSCRRT-AESSHLWGLVIVTGGWDGRIRLFHNYGLPV  669



>ref|XP_010245259.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Nelumbo nucifera]
 ref|XP_010245260.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Nelumbo nucifera]
 ref|XP_010245261.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Nelumbo nucifera]
 ref|XP_010245262.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Nelumbo nucifera]
 ref|XP_010245263.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Nelumbo nucifera]
 ref|XP_010245265.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Nelumbo nucifera]
Length=689

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 97/185 (52%), Gaps = 30/185 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+R S   + A+FTS+ +H++SV EDS+V +WNY+ L     + +K++RS E F+  + S
Sbjct  505  GLRKSGSQMSASFTSNGRHIISVGEDSHVYVWNYDGLCLPLSKEAKSIRSCEHFFHDDVS  564

Query  440  VVVPWCGA--------------GSSVPGSMLssgkaistsssSC-------CQFKGCATW  324
            V +PW G                S VP  + ++     +   S        C  KG ATW
Sbjct  565  VAIPWSGMEEERSVLDSCSLQHSSKVPEFLEAASWFRDSERLSLGGWFSVDCPSKGSATW  624

Query  323  PEEKLP----NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYG  156
            PEEKLP     ++       + ++ +  + + L      WGLV+VTAG DG IRTFLN+G
Sbjct  625  PEEKLPVWAVEVAHHGHHHDNQQYHQHHYYNNLRDLSGTWGLVIVTAGWDGVIRTFLNFG  684

Query  155  LPIRF  141
            LP+R 
Sbjct  685  LPVRL  689



>emb|CDY14377.1| BnaA10g06780D [Brassica napus]
Length=642

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 92/178 (52%), Gaps = 44/178 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIW-NYNELQTS-----KTVRSYESFYSHNA  444
            GV  +  L  A+ TSD KH+VS  EDSNV IW N  EL +S     K ++S+E F S NA
Sbjct  481  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNVEELDSSSSSQTKKIKSFERF-STNA  539

Query  443  SVVVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPE  318
            SV   W G                      VPGS+                 KG ATWPE
Sbjct  540  SVAATWSGFSDHNATLPFASPPCLSLNEGYVPGSVP----------------KGSATWPE  583

Query  317  EKLPNLSP-SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            E LP  +P S +  S YKFLKS++Q + +S    WG+V+VT G DG IRTF NYGLP+
Sbjct  584  ENLPANNPLSSMTASHYKFLKSSYQRSTSSLA--WGMVIVTGGWDGRIRTFQNYGLPV  639



>ref|XP_009119898.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
 ref|XP_009119899.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
Length=642

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 92/178 (52%), Gaps = 44/178 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIW-NYNELQTS-----KTVRSYESFYSHNA  444
            GV  +  L  A+ TSD KH+VS  EDSNV IW N  EL +S     K ++S+E F S NA
Sbjct  481  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNVEELDSSSSSQTKKIKSFERF-STNA  539

Query  443  SVVVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPE  318
            SV   W G                      VPGS+                 KG ATWPE
Sbjct  540  SVAATWSGFSDHNATLPFASPPCLSLNEGYVPGSVP----------------KGSATWPE  583

Query  317  EKLPNLSP-SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            E LP  +P S +  S YKFLKS++Q + +S    WG+V+VT G DG IRTF NYGLP+
Sbjct  584  ENLPANNPLSSMTASHYKFLKSSYQRSTSSLA--WGMVIVTGGWDGRIRTFQNYGLPV  639



>ref|XP_003522540.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=703

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 73/173 (42%), Positives = 95/173 (55%), Gaps = 38/173 (22%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASVVVPWCGAGS-  411
            A+ TSD KH++S  EDSNV +WN ++ ++    +K + S E F+S NAS+ V W G  S 
Sbjct  537  ASLTSDGKHILSACEDSNVYLWNVSQEESNPVKAKKITSCERFFS-NASIAVTWHGLKSQ  595

Query  410  ---------------------SVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP  294
                                 S P S   S +    S       KG ATWPEEKLP  SP
Sbjct  596  NIEIQHQLDALDKRSSQVIQLSPPASFSLSQEFFLESFP-----KGSATWPEEKLPVSSP  650

Query  293  ----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
                S + KS+YKFLKS+ +S   SS + WG+V+VTAG DG I++F NYGLPI
Sbjct  651  KAKTSVMRKSEYKFLKSSCKST--SSAHAWGMVIVTAGWDGRIKSFHNYGLPI  701



>ref|NP_851068.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10398.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED93293.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=694

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 96/168 (57%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNELQTSK---------TVRSYES  462
            G RN+   + A+FT+D KH+VS  +DS+V +WN   ++  Q+S           +RS+E 
Sbjct  527  GSRNAGNQISASFTADGKHIVSACDDSSVYVWNCVGHDPEQSSPGFFSHTKRLKIRSFEK  586

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  587  F-SADVSVAIPWCGFTPVLSGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  645

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG I+ F NYGLP+
Sbjct  646  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIKLFHNYGLPV  692



>gb|KHN19514.1| WD repeat-containing protein 44 [Glycine soja]
Length=703

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 73/173 (42%), Positives = 95/173 (55%), Gaps = 38/173 (22%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASVVVPWCGAGS-  411
            A+ TSD KH++S  EDSNV +WN ++ ++    +K + S E F+S NAS+ V W G  S 
Sbjct  537  ASLTSDGKHILSACEDSNVYLWNVSQEESNPVKAKKITSCERFFS-NASIAVTWHGLKSQ  595

Query  410  ---------------------SVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP  294
                                 S P S   S +    S       KG ATWPEEKLP  SP
Sbjct  596  NIEIQHQLDALDKRSSQVIQLSPPASFSLSQEFFLESFP-----KGSATWPEEKLPVSSP  650

Query  293  ----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
                S + KS+YKFLKS+ +S   SS + WG+V+VTAG DG I++F NYGLPI
Sbjct  651  KAKTSVMRKSEYKFLKSSCKST--SSAHAWGMVIVTAGWDGRIKSFHNYGLPI  701



>ref|NP_197820.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AED93292.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=698

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 96/168 (57%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNELQTSK---------TVRSYES  462
            G RN+   + A+FT+D KH+VS  +DS+V +WN   ++  Q+S           +RS+E 
Sbjct  531  GSRNAGNQISASFTADGKHIVSACDDSSVYVWNCVGHDPEQSSPGFFSHTKRLKIRSFEK  590

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  591  F-SADVSVAIPWCGFTPVLSGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  649

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG I+ F NYGLP+
Sbjct  650  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIKLFHNYGLPV  696



>ref|XP_006394689.1| hypothetical protein EUTSA_v10003733mg [Eutrema salsugineum]
 gb|ESQ31975.1| hypothetical protein EUTSA_v10003733mg [Eutrema salsugineum]
Length=705

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 92/168 (55%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE------------LQTSKTVRSYES  462
            G RN+   + A+FT+D KH++S  +DS+V +WN  E                  +RS+E 
Sbjct  538  GSRNAGNQISASFTADGKHIISACDDSSVYVWNCIENDPEPPSPGFFSYTKRLKIRSFEK  597

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  598  F-SVDVSVAIPWCGFAPVISGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  656

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S Y+FL+S+ +    SS +LWGLV+VT G DG IR F NYGLP+
Sbjct  657  AIRRSHYRFLRSSCRRTSESS-HLWGLVIVTGGWDGRIRLFHNYGLPV  703



>gb|KDP28461.1| hypothetical protein JCGZ_14232 [Jatropha curcas]
Length=747

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 101/198 (51%), Gaps = 44/198 (22%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASV  438
            G+ N+   + A FTS   H++S +EDSN+ +WNY      +   KT  + E F+S+NASV
Sbjct  551  GIHNAGSQISALFTSGGTHIISASEDSNIYVWNYAIKDGPVPRVKTNWACEHFFSNNASV  610

Query  437  VVPW----CG--AGSSVPGSMLssgkaistsssSCC-------------------QF---  342
             +PW    CG  A S +  + L    +   +                        QF   
Sbjct  611  AIPWPGLACGNSASSDIMRTTLPFMNSERCNEEQMSVHKELGESSQCKSSFSSPDQFSLS  670

Query  341  ---------KGCATWPEEKLPN-LSPSP-VLKSDYKFLKSAWQSALASSPNLWGLVVVTA  195
                     KG ATWPEE LP+ LS SP + KS YKFL++++QS +  SP+ W L +VTA
Sbjct  671  HGFFSESLPKGSATWPEENLPSSLSMSPKMFKSQYKFLRTSYQS-VHGSPHAWNLAIVTA  729

Query  194  GLDGYIRTFLNYGLPIRF  141
            G DG IR F NYGLP+R 
Sbjct  730  GWDGRIRWFQNYGLPVRL  747



>ref|XP_009788735.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=722

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 28/177 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSK-----TVRSYESFYSHNAS  441
            G+RN+   + A FTSD KH++S +EDSNV +WN++  + S      T+ S+E F++ +A+
Sbjct  546  GLRNAGSHLSAAFTSDGKHIISASEDSNVYLWNFHIPEESSVSQPGTLSSFE-FFNGDAT  604

Query  440  VVVPWCG----------AGSSVPGSMLssgkaistsssSCCQF------KGCATWPEEKL  309
            + +PW G              +  S+ +     S   S   +       KG ATWPEEKL
Sbjct  605  IAIPWSGLKNVNHENRCHSQGLSQSLTNFPFPASPWFSLGQELFLEAIPKGSATWPEEKL  664

Query  308  P----NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            P       PS + KS YKFLK + QS+  S  + WGLV+VTAG DG IR+F NYGLP
Sbjct  665  PVSHPRSVPSAMCKSHYKFLKLSCQSS--SRSHAWGLVIVTAGYDGRIRSFHNYGLP  719



>ref|XP_007039112.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY23613.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=727

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 103/177 (58%), Gaps = 28/177 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNAS  441
            GVRN+     A+FT+D KH+VS  ED+NV IWN    +E  L  +K +RS E F S NAS
Sbjct  551  GVRNNGNQTLASFTADGKHIVSACEDANVYIWNCVAQDEPTLSQAKDIRSCERF-SANAS  609

Query  440  VVVPWCGA-GSSVPG---SMLssgkaistsssSCCQF------------KGCATWPEEKL  309
            + +PW G  G+S  G    +L+     +   SS   F            KG ATWPEE L
Sbjct  610  IAIPWSGLNGNSENGRQFEVLNDNLPENLPFSSPSYFSLSNEYFLESFPKGSATWPEETL  669

Query  308  PNLSPSPVL----KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            P+ SP  V     KS YKFLK++ QS  +S  + WGLV+VTAG DG IR+FLNYGLP
Sbjct  670  PSSSPMSVSSSMHKSQYKFLKTSCQSTFSS--HAWGLVIVTAGSDGRIRSFLNYGLP  724



>ref|XP_002321388.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEF05515.1| WD-40 repeat family protein [Populus trichocarpa]
Length=726

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 100/175 (57%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNASVVV  432
            N+A  + A+FT D KH+VS  EDS+V +WNY + +      SK  RSYE F + NASV +
Sbjct  553  NAANQISASFTLDGKHIVSTCEDSSVHLWNYVDQEQPSTPRSKNSRSYEHFTA-NASVAI  611

Query  431  PWCGA--GSSVPG---------SMLssgkaistsssSCCQF------KGCATWPEEKLPN  303
            PWCG   G S  G         S      +   S S   ++      KG ATWPEEKLP+
Sbjct  612  PWCGMKYGGSENGWGFRVSDNSSQEVLPLSSPASFSLSQEYFVESFPKGSATWPEEKLPS  671

Query  302  LSPS---PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               S    + KS YKFLK++ QS  AS  + WGLV+VTAG DG I++F NYGLP+
Sbjct  672  SPLSASSTMHKSQYKFLKNSCQSTAAS--HAWGLVIVTAGWDGRIKSFHNYGLPV  724



>ref|XP_009150956.1| PREDICTED: vegetative incompatibility protein HET-E-1 [Brassica 
rapa]
 ref|XP_009150957.1| PREDICTED: vegetative incompatibility protein HET-E-1 [Brassica 
rapa]
 ref|XP_009150958.1| PREDICTED: vegetative incompatibility protein HET-E-1 [Brassica 
rapa]
Length=661

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 93/170 (55%), Gaps = 20/170 (12%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-------------YNELQTSKTVRSYE  465
            G RN+   + A+FT D KH++S  +DS+V IWN             ++  +  K +RS+E
Sbjct  493  GSRNAGNQISASFTGDGKHIISACDDSSVYIWNCVPHDPEPPSPGFFSHTKRIK-IRSFE  551

Query  464  SFYSHNASVVVPWCGAGSSV--PGSMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP  294
             F S + SV +PWCG  S     GS LS               KG ATWPEEKL +  SP
Sbjct  552  KF-SADVSVAIPWCGFSSPAISGGSELSPSLFSLGREYVLDSPKGAATWPEEKLASSFSP  610

Query  293  -SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               + +S Y+FL+S+ +   A S +LWGLV+VT G  G IR F NYGLP+
Sbjct  611  VRAIRRSHYRFLRSSCRRT-AESSHLWGLVIVTGGGGGRIRLFHNYGLPV  659



>ref|XP_007039113.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY23614.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=610

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 103/177 (58%), Gaps = 28/177 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNE--LQTSKTVRSYESFYSHNAS  441
            GVRN+     A+FT+D KH+VS  ED+NV IWN    +E  L  +K +RS E F S NAS
Sbjct  434  GVRNNGNQTLASFTADGKHIVSACEDANVYIWNCVAQDEPTLSQAKDIRSCERF-SANAS  492

Query  440  VVVPWCGA-GSSVPG---SMLssgkaistsssSCCQF------------KGCATWPEEKL  309
            + +PW G  G+S  G    +L+     +   SS   F            KG ATWPEE L
Sbjct  493  IAIPWSGLNGNSENGRQFEVLNDNLPENLPFSSPSYFSLSNEYFLESFPKGSATWPEETL  552

Query  308  PNLSPSPVL----KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            P+ SP  V     KS YKFLK++ QS  +S  + WGLV+VTAG DG IR+FLNYGLP
Sbjct  553  PSSSPMSVSSSMHKSQYKFLKTSCQSTFSS--HAWGLVIVTAGSDGRIRSFLNYGLP  607



>ref|XP_009125213.1| PREDICTED: uncharacterized protein LOC103850247 [Brassica rapa]
Length=703

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 93/180 (52%), Gaps = 24/180 (13%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL--------QTSKTVRSYESFY  456
            ++ +R +     A FTSD KH+VS  EDS + +W+Y++         Q  KT+RSYE F 
Sbjct  523  ASSLRTTLSPTSALFTSDGKHIVSTIEDSGIHVWDYSQPNKKAASPPQKPKTIRSYEGFL  582

Query  455  SHNASVVVPWCGAGS------SVPGSMLssgkaistsssSC-CQFKGCATWPEEKL----  309
            S N SV +PW G G       S    +      +      C  Q KG  TWPEEKL    
Sbjct  583  SDNVSVAIPWLGQGKEEDSVCSFIADLDKKFAHLPLPVRDCFSQVKGATTWPEEKLGVVA  642

Query  308  ----PNLSPSPVLKSDYKFLKSAWQSALAS-SPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                  +S +   +S  + L+S  Q+   + +P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  643  GSAAAAISATASSRSKLRLLRSVCQNVNNTCTPHLWGLVIVTATWDGRIRVFHNYGLPIR  702



>ref|XP_002874189.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50448.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 95/168 (57%), Gaps = 17/168 (10%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN---YNELQTSK---------TVRSYES  462
            G RN+   + A+FT+D KH+VS  +DS+V +WN   ++  Q S           +RS+E 
Sbjct  536  GSRNAGNQISASFTADGKHIVSACDDSSVYVWNCVGHDPEQPSPGFFSHTKRLKIRSFEK  595

Query  461  FYSHNASVVVPWCGAGSSVPG-SMLssgkaistsssSCCQFKGCATWPEEKLPN-LSP-S  291
            F S + SV +PWCG    + G S LS               KG ATWPEEKL +  SP  
Sbjct  596  F-SADVSVAIPWCGFTPVLSGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVK  654

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + +S YKFL+S+ +    SS +LWGLV+VT G DG I+ F NYGLP+
Sbjct  655  AIRRSHYKFLRSSCRRTSESS-HLWGLVIVTGGWDGRIKLFHNYGLPV  701



>ref|XP_004240961.1| PREDICTED: WD repeat-containing protein 44 [Solanum lycopersicum]
Length=701

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 101/177 (57%), Gaps = 28/177 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G+RN+   + A F+SD KH++S +EDSNV +WN +      +   + VRS+E FYS +AS
Sbjct  525  GLRNAGSHLSAAFSSDGKHIISASEDSNVYLWNCHIPEETSVSQPEAVRSFEFFYS-DAS  583

Query  440  VVVPWCGAG---------SSVPGSMLssgkaistsssSCCQF-------KGCATWPEEKL  309
            + +PW G           S V    L++    ++   S  Q        KG ATWPEEKL
Sbjct  584  IAIPWSGLKNVNHENQCHSQVLSQSLNNFPLGASPCFSLGQGLFLEAIPKGSATWPEEKL  643

Query  308  PNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            P  SP    S + KS YKFLKS+     +SS + WGLV+VTAG DG IR++ NYGLP
Sbjct  644  PLSSPRSVPSAMCKSQYKFLKSS--CQSSSSSHAWGLVIVTAGYDGRIRSYRNYGLP  698



>ref|XP_007136464.1| hypothetical protein PHAVU_009G047400g [Phaseolus vulgaris]
 gb|ESW08458.1| hypothetical protein PHAVU_009G047400g [Phaseolus vulgaris]
Length=702

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 91/168 (54%), Gaps = 28/168 (17%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASVVVPWCG----  420
            A+FTSD KH++S  EDSNV +WN N  ++    +K + S E FYS NASV VPW G    
Sbjct  536  ASFTSDGKHILSACEDSNVYLWNVNSQESNPVKAKKITSCERFYS-NASVAVPWHGLKSI  594

Query  419  ------------AGSSVPGSMLssgkaistsssSCCQF-KGCATWPEEKLP----NLSPS  291
                         GSS    +                F KG ATWPEEKLP        S
Sbjct  595  NIENEHQLDLLDKGSSQVMQLNPPASFSLNQEFILESFPKGSATWPEEKLPVSSSKAKTS  654

Query  290  PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             + KS+Y FLKS+ +S   SS + WG+V+VTAG DG I++F NYGLPI
Sbjct  655  VIHKSEYNFLKSSCKST--SSAHSWGMVIVTAGWDGRIKSFHNYGLPI  700



>ref|XP_002534336.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF28046.1| WD-repeat protein, putative [Ricinus communis]
Length=714

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 97/184 (53%), Gaps = 39/184 (21%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSYESFYSHNAS  441
            G++N++  + A+FTSD KH++S +EDSNV +WN    Q      +K +RS E F S NAS
Sbjct  537  GLKNASSQMSASFTSDGKHIISASEDSNVYMWNCINQQENVPVQAKKIRSCERF-STNAS  595

Query  440  VVVPWCGAGS----------------------SVPGSMLssgkaistsssSCCQFKGCAT  327
            V +PW G                         S P S     +    S       KG AT
Sbjct  596  VAIPWSGLRHGNLRNGWGFHVSNGYSPEVMPFSSPASFFLGQEYFLESYP-----KGSAT  650

Query  326  WPEEKLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNY  159
            WPEEKLP  SP    S + KS  KFL+++ Q+   S  + WGLV+VTAG DG IR+F NY
Sbjct  651  WPEEKLPVSSPFSASSGMNKSHCKFLEASRQNTAIS--HAWGLVIVTAGWDGRIRSFHNY  708

Query  158  GLPI  147
            GLP+
Sbjct  709  GLPV  712



>emb|CDY13372.1| BnaC06g13850D [Brassica napus]
Length=696

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 92/179 (51%), Gaps = 23/179 (13%)
 Frame = -3

Query  611  STGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-------QTSKTVRSYESFYS  453
            ++ +R +     A FTSD KH+VS  EDS + +W+Y++        Q  KT++SYE F S
Sbjct  517  ASSLRTTLSPTSALFTSDGKHIVSTIEDSGIHVWDYSQPNKKAASPQKPKTIKSYEGFLS  576

Query  452  HNASVVVPWCGAGS------SVPGSMLssgkaistsssSC-CQFKGCATWPEEKL-----  309
             N SV +PW G G       S    +      +      C  Q KG  TWPEEKL     
Sbjct  577  DNVSVAIPWLGQGKEEDSVCSFIADLDKKFAHLPLPVRDCFSQVKGATTWPEEKLGVVAG  636

Query  308  ---PNLSPSPVLKSDYKFLKSAWQSALAS-SPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
                 +S +   +   + L+S  Q+   + +P+LWGLV+VTA  DG IR F NYGLPIR
Sbjct  637  SAAAAISATASSRFKLRLLRSVCQNVNNTCTPHLWGLVIVTATWDGRIRVFHNYGLPIR  695



>ref|XP_006360158.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=701

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 100/177 (56%), Gaps = 28/177 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G+RN+   + A F+SD KH++S +EDSNV +WN +      +   + VRS+E FYS +AS
Sbjct  525  GLRNAGSHLSAAFSSDGKHIISASEDSNVYLWNCHIPEETSVSQPEAVRSFEFFYS-DAS  583

Query  440  VVVPWCGAG---------SSVPGSMLssgkaistsssSCCQF-------KGCATWPEEKL  309
            + +PW G           S V    L++     +   S  Q        KG ATWPEEKL
Sbjct  584  IAIPWSGLKNVNHENQCHSQVLSQSLNNFPLGVSPCFSLGQGLFLEAIPKGSATWPEEKL  643

Query  308  PNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            P  SP    S + KS YKFLKS+     +SS + WGLV+VTAG DG IR++ NYGLP
Sbjct  644  PLSSPRSVPSAMCKSQYKFLKSS--CQSSSSSHAWGLVIVTAGYDGRIRSYHNYGLP  698



>ref|XP_003527990.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=701

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 97/169 (57%), Gaps = 30/169 (18%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASVVVPWCGAGSS  408
            A+ TSD KH++S  EDSNV +WN ++ ++    +K + S E F+S NASV VPW G  S 
Sbjct  535  ASMTSDGKHILSACEDSNVYLWNVSQEESNPLKAKKITSCERFFS-NASVAVPWHGLKSQ  593

Query  407  VPGSMLssgkaistsssSCCQF------------------KGCATWPEEKLPNLSP----  294
                +     A+  +SS   Q                   KG ATWPEEKLP  SP    
Sbjct  594  NI-EIEHQLDALDKTSSQVIQLSPPASFSLSQEFFLESFPKGSATWPEEKLPVSSPKAKA  652

Query  293  SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            S + KS+YKFLKS+ +S   SS + WG+V+VTAG DG I++F NYGLPI
Sbjct  653  SVMRKSEYKFLKSSCKST--SSAHAWGMVIVTAGWDGRIKSFHNYGLPI  699



>emb|CDY35661.1| BnaC09g29830D [Brassica napus]
Length=641

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 92/178 (52%), Gaps = 44/178 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIW-NYNELQTS-----KTVRSYESFYSHNA  444
            GV  +  L  A+ TSD KH+VS  EDSNV IW N  EL +S     K ++S+E F S NA
Sbjct  480  GVCKTRSLTSASLTSDGKHIVSACEDSNVYIWSNGEELDSSSSSQTKKIKSFERF-STNA  538

Query  443  SVVVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPE  318
            SV   W G                      VPGS+                 KG ATWPE
Sbjct  539  SVAATWSGFSDYNTSLPFASPPCLSLNEGYVPGSVP----------------KGSATWPE  582

Query  317  EKLPNLSP-SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            E LP  +P S +  S YKFLKS++Q + +S    WG+V+VT G DG I+TF NYGLP+
Sbjct  583  ENLPANNPLSSMTASHYKFLKSSYQRSTSSLA--WGMVIVTGGWDGRIKTFQNYGLPV  638



>ref|XP_006350514.1| PREDICTED: WD repeat-containing protein YMR102C-like [Solanum 
tuberosum]
Length=731

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 98/179 (55%), Gaps = 29/179 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN----YNELQTSKTVRSYESFYSHNASV  438
            G R +   + A+FT D KH+VS +EDSNV +WN     + +   K VRS E F+S ++++
Sbjct  554  GPRTAGNHLSASFTLDGKHIVSASEDSNVYVWNCDVPKDYVSQPKVVRSSE-FFSSDSTI  612

Query  437  VVPW-------------CGAGSSVPGSMLssgkaistsssSCCQF-----KGCATWPEEK  312
             +PW             CG G S   + +    +    S     F     KG ATWPEEK
Sbjct  613  AIPWSGLKTVNPDNGRHCGGGLSQTSNNILPFISSPYLSLGSELFLEAIPKGSATWPEEK  672

Query  311  LPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            LP  SP    S + KS+YKFLKS+     +S  + WGLV+VTAG DG IR+F NYGLP+
Sbjct  673  LPVSSPRSTSSGMCKSEYKFLKSS--CQSSSDSHAWGLVIVTAGYDGRIRSFHNYGLPL  729



>ref|XP_006382834.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|ERP60631.1| WD-40 repeat family protein [Populus trichocarpa]
Length=655

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 99/181 (55%), Gaps = 29/181 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+  S   + A+FTS+ +H++SV ED  V +WNY+ L TS     K+V+S E F+S   S
Sbjct  473  GLPKSGSQMSASFTSNGRHIISVGEDCRVYVWNYDGLCTSWSKHIKSVKSCEFFFSEGVS  532

Query  440  VVVPWCGAGSSVP--GSMLssgkaistsssSCCQF------------KGC-ATWPEEKLP  306
            V VPW G G+ V   GS  S  +  ++      +F            +G  ATWPEEKLP
Sbjct  533  VAVPWSGTGTEVRGLGSRRSLTEETASWRKDSERFSLGSWFFMDGRCRGSYATWPEEKLP  592

Query  305  NLSPSPVLKSDY--KFLKSAWQSALASSPN------LWGLVVVTAGLDGYIRTFLNYGLP  150
             +   PVL ++Y  + +KS  Q    +S +       WGLV+VTAG DG IR F NYGLP
Sbjct  593  -MWDVPVLDAEYQNQQIKSLHQQQCVNSNDHISLSEAWGLVIVTAGWDGKIRAFHNYGLP  651

Query  149  I  147
            I
Sbjct  652  I  652



>ref|XP_011044680.1| PREDICTED: WD repeat-containing protein 44 [Populus euphratica]
Length=720

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 99/175 (57%), Gaps = 28/175 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNASVVV  432
            N+A  + A+FT D KH+VS  EDS+V +WNY + +      SK  RSYE F + NASV +
Sbjct  547  NAANQLSASFTLDGKHIVSTCEDSSVHLWNYMDQEQPSTPRSKNSRSYEHFTA-NASVAI  605

Query  431  PWCGA--GSSVPG---------SMLssgkaistsssSCCQF------KGCATWPEEKLPN  303
            PWCG   G S  G         S      +   S S   ++      KG ATWPEEKLP+
Sbjct  606  PWCGMKYGGSENGWGFRVSDNSSQEVLPLSSPASFSLSQEYFIESFPKGSATWPEEKLPS  665

Query  302  LSPS---PVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               S    + KS YKFLK++ QS   S  + WGLV+VTAG DG I++F NYGLP+
Sbjct  666  SPLSASSTMHKSQYKFLKNSCQSTATS--HAWGLVIVTAGWDGRIKSFHNYGLPV  718



>ref|XP_008669015.1| PREDICTED: WD repeat-containing protein 44-like [Zea mays]
 gb|AFW59263.1| hypothetical protein ZEAMMB73_141277 [Zea mays]
Length=696

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 99/197 (50%), Gaps = 48/197 (24%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNA  444
            +G+R  +    ATFT D +H+V  +EDSN+ +WN+       L+ +KT+ S E FYS+NA
Sbjct  501  SGLRTGSCQSLATFTPDGQHIVCASEDSNIYVWNHENQDEASLKHAKTIWSSERFYSNNA  560

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCC----------------------------  348
            ++ +PW G     P S+ S   +    +  C                             
Sbjct  561  AIAIPWNGPKPRNPVSLASQILSPQGDNLWCMSKAVKCSSSQSEDSAINSFVSRFAPGIF  620

Query  347  ----QF------KGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVV  201
                +F      +  ATWPEE LP+ S   +L +S YKFL++ +QS    +PN WG V+V
Sbjct  621  NLNQEFSSESTCRSSATWPEEILPSRSIRAILDESQYKFLRNCFQS----TPNSWGQVIV  676

Query  200  TAGLDGYIRTFLNYGLP  150
            TAG DG IR+F NYGLP
Sbjct  677  TAGWDGKIRSFQNYGLP  693



>ref|XP_010541487.1| PREDICTED: WD repeat-containing protein 44 [Tarenaya hassleriana]
Length=703

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 91/167 (54%), Gaps = 23/167 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN------------YNELQTSK--TVRSY  468
            G RN+   + A+FT+D KH++S  +DS+V +WN               L   K   +RS+
Sbjct  544  GSRNAGNQISASFTADGKHIISACDDSSVYMWNCCVGRGHDPEPSSGSLSRKKRLKIRSF  603

Query  467  ESFYSHNASVVVPWCGAGSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSP  288
            E F S N SV +PW G    +  S+ S G+     S      KG ATWPEEKL       
Sbjct  604  ERF-SANVSVAIPWRGLNPELSPSLFSLGREYVLDSP-----KGTATWPEEKLG--PAKA  655

Query  287  VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            + +S YKFL+S+ Q    SS +LWGLV+VT G DG IR F NYGLP+
Sbjct  656  IRRSQYKFLQSSCQRTSESS-HLWGLVIVTGGWDGRIRLFHNYGLPV  701



>ref|XP_002446949.1| hypothetical protein SORBIDRAFT_06g025690 [Sorghum bicolor]
 gb|EES11277.1| hypothetical protein SORBIDRAFT_06g025690 [Sorghum bicolor]
Length=695

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 100/197 (51%), Gaps = 48/197 (24%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNA  444
            +G+R  +    ATFT D +H+VS +EDSN+ +WN+       L+ +KT+ S E F+S+NA
Sbjct  500  SGLRTGSCQSLATFTPDGQHIVSASEDSNIYVWNHENQDEPSLKHAKTIWSSERFHSNNA  559

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCC----------------------------  348
            ++ +PW G     P S+ S   +    +  C                             
Sbjct  560  AIAIPWNGQKPRNPVSLASQILSPQGDNFWCMSKAVKCSSSRSEDSAINSFVSRFAPGIF  619

Query  347  ----QF------KGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVV  201
                +F      +  ATWPEE LP+ S   +L +S YKFL++ +Q+    +PN WG V+V
Sbjct  620  NLNQEFSSESTCRSSATWPEEILPSRSIRAILDESQYKFLRNCFQT----TPNSWGQVIV  675

Query  200  TAGLDGYIRTFLNYGLP  150
            TAG DG IR+F NYGLP
Sbjct  676  TAGWDGKIRSFQNYGLP  692



>gb|EPS62097.1| hypothetical protein M569_12696, partial [Genlisea aurea]
Length=465

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 93/167 (56%), Gaps = 29/167 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVRSYESFYSHNASVVVPW  426
            G+RNS   + A+FT + KH+VS +EDSNVC+WNY+  + + TVRS E       S+ VPW
Sbjct  312  GLRNSGCCLSASFTRNGKHIVSASEDSNVCLWNYDARRGT-TVRSLEFLPCEAPSIAVPW  370

Query  425  CGAGSSV--------PGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP------SP  288
             G   S         PG   SS  A              ATWPEEKLP ++       S 
Sbjct  371  PGMDRSSFEIVPVVGPGFFSSSAAAA-------------ATWPEEKLPPIAENVKRNSSR  417

Query  287  VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            + KS+Y+  K++ Q++ +S  +  GLV VTAG DG IR+F NYGLPI
Sbjct  418  LGKSEYRLFKASCQNS-SSGTHACGLVFVTAGSDGRIRSFHNYGLPI  463



>ref|XP_004502686.1| PREDICTED: WD repeat-containing protein 44-like [Cicer arietinum]
Length=705

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 95/170 (56%), Gaps = 30/170 (18%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQ----TSKTVRSYESFYSHNASVVVPWCGAGSS  408
            A+FTSD KH++S  EDSNV +WN N+ +     SK +RS E F+S NASV VPW G  S 
Sbjct  537  ASFTSDGKHILSAGEDSNVYLWNINQEEPYPVKSKKIRSCERFFS-NASVAVPWHGLKSQ  595

Query  407  VPGS------------MLssgkaistsssSCCQF------KGCATWPEEKLP-----NLS  297
            +  +            ++        S S   +F      KG ATWPEEKLP        
Sbjct  596  ITVNEQLNVLDKKSPPVIQLHPNPPASFSLGQEFFLESFPKGSATWPEEKLPVSSSKTKK  655

Query  296  PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             S + +S+YK LKS+ +S   +  + WG+V+VTAG DG I++F NYGLP+
Sbjct  656  TSLLHRSEYKMLKSSCKST--ARAHAWGMVIVTAGWDGRIKSFHNYGLPV  703



>gb|KHG23923.1| putative WD repeat-containing C3H5.08c [Gossypium arboreum]
Length=719

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 96/178 (54%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-----YNELQTSKTVRSYESFYSHNAS  441
            G  N+      + T+D KH+VS  +D+NV IWN      N +  SK +RS E F S NAS
Sbjct  543  GAHNNGNQTFTSITADGKHIVSACDDANVYIWNCVHQDKNSISQSKDIRSCEHF-SANAS  601

Query  440  VVVPWCGAG-------------SSVPGSM---LssgkaistsssSCCQFKGCATWPEE--  315
            + +PWCG                 +P  +   L S  ++    SS    KG ATWPEE  
Sbjct  602  IAIPWCGLKYGNTENRQFEVPQEDLPHDLPFSLPSYFSMGHEYSSESLPKGSATWPEETL  661

Query  314  --KLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
                P   PS + KS YKFLK++ QS   S  ++WGLV+VTAG DG IR+FLNYGLP+
Sbjct  662  PPSSPLSMPSSIHKSQYKFLKTSCQSTFDS--HVWGLVIVTAGSDGRIRSFLNYGLPV  717



>ref|XP_010933844.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Elaeis 
guineensis]
Length=755

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 100/200 (50%), Gaps = 49/200 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVRSY---ESFYSHNAS  441
            G RN    + A+FT+D +H+++  EDSNV +WN+   EL +S  ++S    E F S + S
Sbjct  560  GPRNGGSQISASFTADGRHIIAACEDSNVYVWNHANQELPSSNHLKSTWSCERFSSDSVS  619

Query  440  VVVPWCGAGSSVPGSM------------------------------------Lssgkais  369
            V +PW G G   P S+                                    LS   + +
Sbjct  620  VAIPWHGLGCRNPVSVTFEVLPSHEDVSLDQAGTTDNSSRLGEDSFGNNTLHLSPSGSFT  679

Query  368  tsssSCCQF--KGCATWPEEKLPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
                   +F  KG ATWPEEKLP+  ++ S + KS Y+FLKS+ Q+    + + WG V+V
Sbjct  680  LRHEFISEFLPKGSATWPEEKLPSSSMTTSTLCKSQYRFLKSSCQN----TSHAWGQVIV  735

Query  200  TAGLDGYIRTFLNYGLPIRF  141
            T G DG IR+F NYGLP++ 
Sbjct  736  TGGWDGRIRSFQNYGLPVQL  755



>ref|XP_010933843.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Elaeis 
guineensis]
Length=788

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 100/200 (50%), Gaps = 49/200 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVRSY---ESFYSHNAS  441
            G RN    + A+FT+D +H+++  EDSNV +WN+   EL +S  ++S    E F S + S
Sbjct  593  GPRNGGSQISASFTADGRHIIAACEDSNVYVWNHANQELPSSNHLKSTWSCERFSSDSVS  652

Query  440  VVVPWCGAGSSVPGSM------------------------------------Lssgkais  369
            V +PW G G   P S+                                    LS   + +
Sbjct  653  VAIPWHGLGCRNPVSVTFEVLPSHEDVSLDQAGTTDNSSRLGEDSFGNNTLHLSPSGSFT  712

Query  368  tsssSCCQF--KGCATWPEEKLPN--LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
                   +F  KG ATWPEEKLP+  ++ S + KS Y+FLKS+ Q+    + + WG V+V
Sbjct  713  LRHEFISEFLPKGSATWPEEKLPSSSMTTSTLCKSQYRFLKSSCQN----TSHAWGQVIV  768

Query  200  TAGLDGYIRTFLNYGLPIRF  141
            T G DG IR+F NYGLP++ 
Sbjct  769  TGGWDGRIRSFQNYGLPVQL  788



>ref|XP_011023006.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
Length=682

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 93/187 (50%), Gaps = 33/187 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNAS  441
            G+  S   + A+F S  +H++SV ED  V +WNY+ L T     +K+VRS E F+S   S
Sbjct  496  GLPKSGSQMSASFASKGRHIISVGEDCRVYVWNYDGLCTPWSKHTKSVRSCEYFFSEGVS  555

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQFK-------------------GCATWPE  318
            V VPW G G+ + G      ++   +       +                   G ATWPE
Sbjct  556  VAVPWSGPGTELRGLSSRGLRSYVQTEGDASWMRDSDRFSLGSWFFMDGRCRGGSATWPE  615

Query  317  EKLPNLSPSPVLKSDYKFLKSAW--------QSALASSPNLWGLVVVTAGLDGYIRTFLN  162
            EKLP     PVL+ +Y+  ++           +   S P+ WGLV+VTAG DG I+TF N
Sbjct  616  EKLPP-RDVPVLEDEYQNQQTEDLHQQHCVNTNDQISPPDAWGLVIVTAGWDGKIKTFHN  674

Query  161  YGLPIRF  141
            YGLPI+ 
Sbjct  675  YGLPIKL  681



>gb|KJB18688.1| hypothetical protein B456_003G065400 [Gossypium raimondii]
Length=649

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 87/178 (49%), Gaps = 26/178 (15%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE--LQTS---KTVRSYESFYSHNASVVV  432
             S   + A+FTS  KH++SV ED  V +WNYN+  LQTS   K+VRS E F+  + SV +
Sbjct  472  KSGSQMSASFTSTGKHIISVGEDCRVYVWNYNDMCLQTSKHAKSVRSCEHFFCQDVSVAI  531

Query  431  PWCGAGSSVPGSMLssgkaists---ssSCCQF--------------KGCATWPEEKLPN  303
            PW G G     S  +  +             QF              KG ATWPEEKLP 
Sbjct  532  PWLGQGPDHRHSARAPREGRMEGGSWIRDSEQFSIGNWFSIDGSGSSKGSATWPEEKLPL  591

Query  302  LSPSPVLKSDYKFLKSAWQSALA----SSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
               + V +  Y + +       A    S P  WGLV+V  G +G I+TF NYGLP+R 
Sbjct  592  WDATVVERESYTYDQQQLCHTGANDHTSLPETWGLVIVAGGWNGTIKTFHNYGLPVRL  649



>ref|XP_009631166.1| PREDICTED: uncharacterized protein LOC104120978 isoform X2 [Nicotiana 
tomentosiformis]
Length=729

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (54%), Gaps = 30/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G RN+   + ATFTSD KH++S +EDSNV +WN +  +       K VRS E F+S + S
Sbjct  551  GQRNAGNHLSATFTSDGKHIISASEDSNVYVWNCDIRKDDYVSQPKVVRSSE-FFSSDVS  609

Query  440  VVVPWCG-------------AGSSVPGSMLssgkaistsssSCCQF-----KGCATWPEE  315
            + +PW G              G S   + L    A    S  C  F     KG ATWPEE
Sbjct  610  IAIPWSGLKTVNPDNGWHSEGGLSQNPNSLLPFMASPYLSLGCELFLEAIPKGSATWPEE  669

Query  314  KL----PNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KL    P    S + +S+YK LKS+     +S+ + WGLV+VTAG DG IR+F NYGLP+
Sbjct  670  KLPVSSPRSVSSRMCRSEYKLLKSS--CQSSSNSHAWGLVIVTAGYDGRIRSFHNYGLPL  727



>ref|XP_009631159.1| PREDICTED: uncharacterized protein LOC104120978 isoform X1 [Nicotiana 
tomentosiformis]
Length=730

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (54%), Gaps = 30/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G RN+   + ATFTSD KH++S +EDSNV +WN +  +       K VRS E F+S + S
Sbjct  552  GQRNAGNHLSATFTSDGKHIISASEDSNVYVWNCDIRKDDYVSQPKVVRSSE-FFSSDVS  610

Query  440  VVVPWCG-------------AGSSVPGSMLssgkaistsssSCCQF-----KGCATWPEE  315
            + +PW G              G S   + L    A    S  C  F     KG ATWPEE
Sbjct  611  IAIPWSGLKTVNPDNGWHSEGGLSQNPNSLLPFMASPYLSLGCELFLEAIPKGSATWPEE  670

Query  314  KL----PNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KL    P    S + +S+YK LKS+     +S+ + WGLV+VTAG DG IR+F NYGLP+
Sbjct  671  KLPVSSPRSVSSRMCRSEYKLLKSS--CQSSSNSHAWGLVIVTAGYDGRIRSFHNYGLPL  728



>ref|XP_004976524.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Setaria italica]
Length=695

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 100/197 (51%), Gaps = 48/197 (24%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNA  444
            +G+R+ +    ATFT D +H+VS +EDSN+ +W++       L+ +KT+ S E F+S+NA
Sbjct  500  SGLRSGSCQSLATFTPDGQHIVSASEDSNIYVWSHENQHEASLKHAKTIWSSERFHSNNA  559

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCC----------------------------  348
            ++ +PW G   S P S+ S        +  C                             
Sbjct  560  AIAIPWNGQKPSNPVSLASQILPPQGDNFWCMSKAVKCNSSRSEDSAINNFVSRFAPGIF  619

Query  347  ----QF------KGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVV  201
                +F      +  ATWPEE LP+ S   +L +S YKFL++ +QS    + N WG V+V
Sbjct  620  NLNQEFSTESTCRSSATWPEEILPSHSIRAILDESQYKFLRNCFQS----TSNSWGQVIV  675

Query  200  TAGLDGYIRTFLNYGLP  150
            TAG DG IR+F NYGLP
Sbjct  676  TAGWDGKIRSFQNYGLP  692



>ref|XP_011032355.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032356.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032357.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032358.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032360.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032361.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032362.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011032363.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
Length=655

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 97/177 (55%), Gaps = 29/177 (16%)
 Frame = -3

Query  593  SAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNASVVVP  429
            S   + A+FTS  +H++SV ED  V +WNY+ L TS     K+V+S E F+S   SV VP
Sbjct  477  SGSQMSASFTSKGRHIISVGEDCRVYVWNYDGLCTSWSKHIKSVKSCEFFFSEGVSVAVP  536

Query  428  WCGAGSSVP--GSMLssgkaistsssSCCQF------------KGC-ATWPEEKLPNLSP  294
            W G G+ V   GS  S  +  ++S     +F            +G  ATWPEEKLP +  
Sbjct  537  WSGTGTEVRGLGSRRSLTEETASSRKDSERFSLGSWFFMDGRCRGSYATWPEEKLP-MWD  595

Query  293  SPVLKSDY--KFLKSAWQSALASSPN------LWGLVVVTAGLDGYIRTFLNYGLPI  147
             PVL ++Y  + +K+  +    ++ +       WGLV+VTAG DG IR F NYGLPI
Sbjct  596  VPVLDAEYQNQQIKNLHEQQCVNTNDHISLSEAWGLVIVTAGWDGKIRAFHNYGLPI  652



>ref|XP_010100708.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXB83870.1| WD repeat-containing protein 44 [Morus notabilis]
Length=734

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 98/186 (53%), Gaps = 34/186 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ----TSKTVRSYESFYSHNASV  438
            G RN+   + ATFT+D  H+VS +EDSNV IWN+   +      K   + E F+S+++SV
Sbjct  548  GFRNAGSQISATFTNDGAHIVSASEDSNVYIWNHRSEEGPTAQPKNHWACEHFFSNSSSV  607

Query  437  VVPWCGAG--------------------SSVPGSMLssgkaistsssSCCQF-----KGC  333
             +PW                        +S+ GS  S   + +  S S   F     KG 
Sbjct  608  AIPWSSRTCRSYFLPSTSGEFTSSDLSVASLRGSKQSRFSSANHLSLSNGIFSESASKGS  667

Query  332  ATWPEEKLP---NLS-PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFL  165
            ATWPEEKLP   +L+  S   K  +KFLKS  QS +   P  WGLV+VTAG DG IR++ 
Sbjct  668  ATWPEEKLPCSNSLAVSSAKCKLQHKFLKSFCQSRVGC-PQTWGLVIVTAGWDGRIRSYQ  726

Query  164  NYGLPI  147
            NYGLP+
Sbjct  727  NYGLPL  732



>ref|XP_002468648.1| hypothetical protein SORBIDRAFT_01g049570 [Sorghum bicolor]
 gb|EER95646.1| hypothetical protein SORBIDRAFT_01g049570 [Sorghum bicolor]
Length=752

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 105/202 (52%), Gaps = 52/202 (26%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSYESFYSHNAS  441
            G+R+S+  VPA FT D  H++S ++DS++ +WNY N++       KTV SYE F+ ++ S
Sbjct  554  GLRSSS-QVPAAFTPDGDHIISASDDSSIYMWNYANQIAPVTSRVKTVWSYERFFCNDVS  612

Query  440  VVVPW-----------------------------------CGAGSSVPGSMLssgkaist  366
            V +PW                                   C A  S+ G  L    + + 
Sbjct  613  VAIPWNASPTKSSISLACNIPSSRQEVSEELHNLQDSTSGCNAEDSLEGDSLHQLPSGNF  672

Query  365  sssSC----CQFKGCATWPEEKLPNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGL  210
            + S+        +G ATWPEE+LP  S +P    + KS YKFLK++ QSA   + + WG 
Sbjct  673  TLSNAFFAELAPRGKATWPEEQLPCNSVTPSSSALRKSQYKFLKTSCQSA---ATHAWGQ  729

Query  209  VVVTAGLDGYIRTFLNYGLPIR  144
            V+VTAG DG IR+F NYGLP++
Sbjct  730  VIVTAGWDGNIRSFQNYGLPMQ  751



>gb|KJB52541.1| hypothetical protein B456_008G267100 [Gossypium raimondii]
Length=719

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 96/178 (54%), Gaps = 28/178 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWN-----YNELQTSKTVRSYESFYSHNAS  441
            G  N+      + T+D KH+VS  +D+NV IWN      N +  SK +RS E F S +AS
Sbjct  543  GAHNNGNQTFTSITADGKHIVSACDDANVYIWNCVHQDKNSISQSKDIRSCEHF-SASAS  601

Query  440  VVVPWCGAG-------------SSVPGSM---LssgkaistsssSCCQFKGCATWPEE--  315
            + +PWCG                 +P  +   L S  ++    SS    KG ATWPEE  
Sbjct  602  IAIPWCGLKYGNTENRQFEVPHEDLPHDLPFSLPSYFSMGHEYSSESLPKGSATWPEETL  661

Query  314  --KLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
                P   PS + KS YKFLK++ QS   S  ++WGLV+VTAG DG IR+FLNYGLP+
Sbjct  662  PPSSPLSMPSSIHKSQYKFLKTSCQSTFDS--HVWGLVIVTAGSDGRIRSFLNYGLPV  717



>emb|CDY47074.1| BnaA03g12240D [Brassica napus]
Length=599

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 84/149 (56%), Gaps = 16/149 (11%)
 Frame = -3

Query  563  SDEKHVVSVTEDSNVCIWNYNE-------LQTSKTVRSYESFYSHNASVVVPWCG---AG  414
            SD K++VS  EDSNV IW+  +          +K +RS+E F S NASV   WCG     
Sbjct  454  SDGKYIVSACEDSNVYIWSNGKESDSSSSYSQTKRIRSFERF-STNASVAATWCGFSDHN  512

Query  413  SSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALA  234
            +++P S         + S      KG ATWPEE L     S +  S YKFLKS++Q A +
Sbjct  513  TTIPFSSPPCLSLKESGSVP----KGNATWPEENLTENPLSSMTASQYKFLKSSYQRATS  568

Query  233  SSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  569  SSL-AWGMVIVTGGWDGRIRTFQNYGLPV  596



>emb|CDY53898.1| BnaA09g53050D [Brassica napus]
Length=638

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 81/153 (53%), Gaps = 14/153 (9%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTSK-------TVRSYESFYSHNASVVVPWCGA  417
            A+FT D KH+VS TEDS V +WN ++L + K        ++SYESF S NASV +PW   
Sbjct  490  ASFTLDGKHIVSTTEDSGVHVWNNSQLPSKKPSSGKPKRIKSYESFISQNASVAIPWLRQ  549

Query  416  GSSVPGSMLssgkaistsssSCC--QFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQS  243
             +    S   +           C    KG  TWPEE+L + S    + S         ++
Sbjct  550  ANRNSLSDCITDMDKKIGKMDSCFSPMKGSTTWPEEQLDDDS---TIVSSRGKKLKLLKN  606

Query  242  ALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             L   P++WGLV+VTA  DG IR F NYGLP+R
Sbjct  607  VL--QPHMWGLVIVTATWDGRIRVFNNYGLPVR  637



>ref|XP_009132471.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
 ref|XP_009132472.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
Length=599

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 83/150 (55%), Gaps = 17/150 (11%)
 Frame = -3

Query  563  SDEKHVVSVTEDSNVCIW-NYNELQ-------TSKTVRSYESFYSHNASVVVPWCG---A  417
            SD K++VS  EDSNV IW N  E          +K +RS+E F S NASV   WCG    
Sbjct  453  SDGKYIVSAREDSNVYIWSNRKESDSSSSSYSQTKRIRSFERF-STNASVAATWCGFSDH  511

Query  416  GSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSAL  237
              ++P S         + S      KG ATWPEE L     S +  S YKFLKS++Q A 
Sbjct  512  NRTIPFSSPPCLSLKESGSVP----KGNATWPEENLTENPLSSMTASQYKFLKSSYQRAT  567

Query  236  ASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            +SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  568  SSSL-AWGMVIVTGGWDGRIRTFQNYGLPV  596



>ref|XP_004985995.1| PREDICTED: WD repeat-containing protein 44-like [Setaria italica]
Length=746

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 107/201 (53%), Gaps = 51/201 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSYESFYSHNAS  441
            G+R+S+  V A+FT D  H++S ++DS++ +WNY N++       KT+ SYE F+ ++ S
Sbjct  549  GLRSSS-QVAASFTPDGDHIISASDDSSIYMWNYANQIAPITSRVKTIWSYERFFCNDVS  607

Query  440  VVVPW-----------------------------------CGAGSSVPGSMLssgkaist  366
            V +PW                                   C A  S+ G  L    + + 
Sbjct  608  VAIPWNASPAKSSISLACNIPSSRQEVSDEFRNLQDSTSHCHAEDSLGGDNLYQLPSGNF  667

Query  365  sssSC----CQFKGCATWPEEKLPNLSPSP---VLKSDYKFLKSAWQSALASSPNLWGLV  207
            + SS        +G ATWPEE+LP+ S +P   + KS YKFLK++ QSA +   + WG V
Sbjct  668  TLSSAFFAESVPRGTATWPEEQLPSNSVTPSSTLRKSQYKFLKTSCQSAAS---HAWGQV  724

Query  206  VVTAGLDGYIRTFLNYGLPIR  144
            +VTAG DG+IR+F NYGLP++
Sbjct  725  IVTAGWDGHIRSFQNYGLPVQ  745



>emb|CDY38748.1| BnaC03g15010D [Brassica napus]
Length=608

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 84/150 (56%), Gaps = 17/150 (11%)
 Frame = -3

Query  563  SDEKHVVSVTEDSNVCIW-NYNELQTS-------KTVRSYESFYSHNASVVVPWCG---A  417
            SD K++VS  EDSNV IW N  E  +S       K +RS+E F S NASV   WCG    
Sbjct  462  SDGKYIVSACEDSNVYIWSNGKESDSSSFFYSQTKRIRSFERF-STNASVAATWCGFSDH  520

Query  416  GSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSAL  237
              ++P S         + S      KG ATWPEE L     S +  S YKFLKS++Q A 
Sbjct  521  NRTIPFSSPPCLSLKESGSVP----KGNATWPEENLTENPLSSMTASQYKFLKSSYQRAT  576

Query  236  ASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            +SS   WG+V+VT G DG IRTF NYGLP+
Sbjct  577  SSSL-AWGMVIVTGGWDGRIRTFQNYGLPV  605



>ref|XP_010553565.1| PREDICTED: WD repeat-containing protein YMR102C-like [Tarenaya 
hassleriana]
Length=722

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 84/157 (54%), Gaps = 15/157 (10%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASVVVPW--CGAG  414
            A FTSD KH+VS TEDS V +W+     N+ +  KT+RS ESF SHN S+ VPW   G  
Sbjct  565  AAFTSDGKHIVSTTEDSGVHVWSCCSQPNKKKPKKTIRSCESFLSHNTSIAVPWPVLGDS  624

Query  413  SSVPG---SMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAW--  249
            +S  G   S +         S  C +     TWPEEKLP+ + S    S     K     
Sbjct  625  NSFGGFISSDMEQRLPPHFPSFECLR-GSTTTWPEEKLPSTTNSSNSSSSSSRSKLKLLR  683

Query  248  ---QSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
               Q+   SSPNLWGLV+V A  DG IR F NYGLP+
Sbjct  684  SVCQNVCGSSPNLWGLVIVAATWDGKIRVFHNYGLPV  720



>ref|XP_004234989.1| PREDICTED: uncharacterized protein LOC101265109 [Solanum lycopersicum]
 ref|XP_010318038.1| PREDICTED: uncharacterized protein LOC101265109 [Solanum lycopersicum]
Length=731

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 99/180 (55%), Gaps = 31/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G R +   + A+FTSD KH+VS +EDSNV +WN +     E Q  K VRS E F+S +++
Sbjct  554  GPRTAGNHLSASFTSDGKHIVSASEDSNVYVWNCDVPKDYESQP-KVVRSSE-FFSSDST  611

Query  440  VVVPW-------------CGAGSSVPGSMLssgkaistsssSCCQF-----KGCATWPEE  315
            + +PW             CG G S   + +    +    S     F     KG ATWPEE
Sbjct  612  IAIPWSGLKIVNPDNGRHCGGGLSQTSNNVLPFISSPYLSLGRELFLEAIPKGSATWPEE  671

Query  314  KLPNLSP----SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KLP  SP    S + KS+Y  L+S+     +S+ + WGLV+VTAG DG IR+F NYGLP+
Sbjct  672  KLPVSSPRSTSSGMCKSEYNLLRSS--CQSSSNSHAWGLVIVTAGYDGRIRSFHNYGLPL  729



>gb|AGT17419.1| signal transducer [Saccharum hybrid cultivar R570]
Length=752

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 108/202 (53%), Gaps = 52/202 (26%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSYESFYSHNAS  441
            G+R+S+  VPA FT D  H++S ++DS++ +WNY N++       KTV SYE F+ ++ S
Sbjct  554  GLRSSS-QVPAAFTPDGDHIISASDDSSIYMWNYANQIAPVTSRVKTVWSYERFFCNDVS  612

Query  440  VVVPW----------------------------------CG-AGSSVPGSMLssgkaist  366
            V +PW                                  CG A +S+ G  L    + + 
Sbjct  613  VAIPWNASPAKSSISLACNIPSSRQEVSEEFHNLQDSTSCGNAENSLEGDSLYQLPSGNF  672

Query  365  sssSC----CQFKGCATWPEEKLPNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGL  210
            + S+        +G ATWPEE+LP+ S +P    + KS YKFLK++ QSA   + + WG 
Sbjct  673  TLSNAFFAELAPRGKATWPEEQLPSNSVTPSSSALRKSQYKFLKTSCQSA---ATHAWGQ  729

Query  209  VVVTAGLDGYIRTFLNYGLPIR  144
            V+VTAG DG IR+F NYGLP++
Sbjct  730  VIVTAGWDGNIRSFQNYGLPMQ  751



>ref|XP_009597709.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Nicotiana tomentosiformis]
 ref|XP_009597710.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Nicotiana tomentosiformis]
 ref|XP_009597711.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Nicotiana tomentosiformis]
Length=658

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 92/187 (49%), Gaps = 36/187 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S     ATFTS  KH+VSV EDS+V +W+YN++     +  K++RS E F+S   S
Sbjct  474  GLSKSGSHTSATFTSTGKHIVSVGEDSHVYLWDYNDISIQASKQRKSIRSCEHFHSKGVS  533

Query  440  VVVPWCGA----------GSSVPGSMLssgkaistsssSCCQF------------KGCAT  327
            V +PW G           GSS    ++   +   + +    +F            +G  T
Sbjct  534  VAIPWAGQATTADDSENFGSSNVDPLIGEPQEDFSKTRDSSRFSIGNWFTMDVSSRGSVT  593

Query  326  WPEEKL----PNLSPSPVLKSD--YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFL  165
            WPEE L     N         D  Y+  K+    AL+ +   WGLVVVTAG DG IRTF 
Sbjct  594  WPEEMLLPSAENYEHHSTYHDDPLYQHNKNVNYRALSPA---WGLVVVTAGWDGKIRTFH  650

Query  164  NYGLPIR  144
            NYGLP+R
Sbjct  651  NYGLPVR  657



>ref|XP_009112863.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
 ref|XP_009112864.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
Length=639

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 81/153 (53%), Gaps = 14/153 (9%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTSK-------TVRSYESFYSHNASVVVPWCGA  417
            A+FT D KH+VS TEDS + +WN ++L + K        ++SYESF S NASV +PW   
Sbjct  491  ASFTLDGKHIVSTTEDSGIHVWNNSQLPSKKPSSGKPKRIKSYESFISQNASVAIPWLRQ  550

Query  416  GSSVPGSMLssgkaistsssSCC--QFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQS  243
             +    S   +           C    KG  TWPEE+L + S    + S         ++
Sbjct  551  ANRNSLSDCITDMDKKIGKMDSCFSPMKGSTTWPEEQLDDDS---TIVSSRGKKLKLLKN  607

Query  242  ALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             L   P++WGLV+VTA  DG IR F NYGLP+R
Sbjct  608  VL--QPHMWGLVIVTATWDGRIRVFNNYGLPVR  638



>ref|XP_003588487.1| WD repeat-containing protein [Medicago truncatula]
 ref|XP_003636395.1| WD repeat-containing protein [Medicago truncatula]
 gb|AES58738.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=784

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 97/174 (56%), Gaps = 28/174 (16%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT----SKTVRSYESFYSHNASVVVP  429
            N+  L+ A+FTSD KH++S  EDSNV +WN ++ ++    +K ++S E F+S NASV VP
Sbjct  536  NAGSLMSASFTSDGKHILSACEDSNVYLWNVSDNESRSTKAKKIKSCERFFS-NASVAVP  594

Query  428  WCGAGS-SVPGSMLssgkaistsssSCCQ----------F------KGCATWPEEKLPNL  300
            W G  S ++  S            + C            F      KG AT+PEEKLP  
Sbjct  595  WGGLKSDNIENSKKLDVLNKRPPQAVCLDPPSSFSLSQDFYLNSIPKGSATYPEEKLPTS  654

Query  299  SPSPVLKSD----YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            SP     S     YKFLKS+ +S   S+ + WGLV+VTAG DG I++F NYGLP
Sbjct  655  SPKSKKSSLHKSAYKFLKSSCKST--SNCHAWGLVIVTAGWDGRIKSFHNYGLP  706



>emb|CDY53435.1| BnaCnng25150D [Brassica napus]
Length=618

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 81/153 (53%), Gaps = 14/153 (9%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTSK-------TVRSYESFYSHNASVVVPWCGA  417
            A+FT D KH+VS TEDS + +WN ++L + K        +RSYESF S NASV +PW   
Sbjct  470  ASFTLDGKHIVSTTEDSGIHVWNNSQLPSKKPSSGKPKRIRSYESFISQNASVAIPWLRQ  529

Query  416  GSSVPGSMLssgkaistsssSCC--QFKGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQS  243
             +    S   +           C    KG  TWPEE+L + S +    S         ++
Sbjct  530  ANRNSLSDCITDMDKKMGKMDSCFSPMKGSTTWPEEQLGDASTT---MSSRGKKLKLLKN  586

Query  242  ALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
             L   P++WGLV+VTA  DG IR + NYGLP+R
Sbjct  587  VL--QPHMWGLVIVTATWDGKIRVYNNYGLPVR  617



>dbj|BAJ99227.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=689

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 93/184 (51%), Gaps = 37/184 (20%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNA  444
            +G+R+ +  + A+FT D +H+VS +EDSN+ +WN +    S     KT  S E F S++A
Sbjct  511  SGLRSGSCQMSASFTPDGEHIVSASEDSNIYVWNRDNQDDSVWRQAKTTYSSERFLSNDA  570

Query  443  SVVVPWCG------------------------AGSSVPGSMLssgkaistsssSCCQFKG  336
            ++ +PW G                        + S+ PG            +   C+   
Sbjct  571  AIAIPWHGTKPRSHVSLASHIQFKYNSSNSFPSRSAAPGIF---NLNQELFAEPSCKGAA  627

Query  335  CATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNY  159
             ATWPEE LP+ S    L +S YK L++  QS    + N WG V+VTAG DG IR+F NY
Sbjct  628  AATWPEEMLPSGSIGASLDESRYKLLRNCSQS----TTNSWGRVIVTAGWDGRIRSFQNY  683

Query  158  GLPI  147
            GLP+
Sbjct  684  GLPV  687



>ref|XP_010520951.1| PREDICTED: WD repeat-containing protein 44-like [Tarenaya hassleriana]
Length=683

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 93/169 (55%), Gaps = 21/169 (12%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-------KTVRSYESFYSHNASV  438
            NS  L   + TSD KH+VS  EDSNV IWN ++ +         K ++S+E F S NASV
Sbjct  515  NSRSLTSVSLTSDGKHIVSACEDSNVYIWNSDDHEEEEPDSSQMKKIKSFERF-STNASV  573

Query  437  VVPW--CGAGSSVPG--------SMLssgkaistsssSCCQFKGCATWPEEKLPN--LSP  294
               W  C    +VP         S LS     + ++++       ATWPEE LP   LS 
Sbjct  574  ATTWSGCSDEDNVPRRTLPFSSPSCLSLSDGFAAAATTAGTVCAAATWPEENLPASPLSS  633

Query  293  SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            S +  S+YKFLK+++Q    SS   WG+V++T G DG IRTF N+GLP+
Sbjct  634  SKMHVSEYKFLKASYQKITTSSL-AWGMVIITGGWDGRIRTFQNFGLPV  681



>ref|XP_008775006.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera]
 ref|XP_008775008.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera]
 ref|XP_008775009.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera]
Length=761

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 100/204 (49%), Gaps = 55/204 (27%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTSKTVR-----SYESFYSHNAS  441
            G+RN+   + A+FT+D ++++S +EDSNV +W++       + R     S E  +S NAS
Sbjct  560  GLRNARSQMSASFTADGRYIISASEDSNVYVWSHANQAVPASNRLKSTWSCERIFSDNAS  619

Query  440  VVVPW----CGAGSSVPGSMLssgkaistsssS-------CC------------------  348
            + +PW    C    SV   +L S       + +       CC                  
Sbjct  620  IAIPWNGLDCRNAVSVASEVLPSQHVFRDQAGNTGCSCPHCCGEDSLGGGSSSSNLHPSP  679

Query  347  -------------QF--KGCATWPEEKLPNLS--PSPVLKSDYKFLKSAWQSALASSPNL  219
                         +F  KG ATWPEEKLP+ S   S + KS YKFLK++ QS    + + 
Sbjct  680  LGGSFALSHEFFSEFLPKGSATWPEEKLPSSSTTASSLCKSQYKFLKTSCQS----TSHA  735

Query  218  WGLVVVTAGLDGYIRTFLNYGLPI  147
            WG V+VTAGLDG IR F NYGLP+
Sbjct  736  WGQVIVTAGLDGRIRWFQNYGLPV  759



>ref|XP_006652653.1| PREDICTED: WD repeat-containing protein 44-like [Oryza brachyantha]
Length=693

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 102/199 (51%), Gaps = 49/199 (25%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNA  444
            +G+RN +  + ATFT + +H++S +EDSN+ IW++        + +KT ++ E F S NA
Sbjct  497  SGLRNGSCQLSATFTPEGQHIISASEDSNIYIWSHENKYESACKQAKTTQTSEHFRSSNA  556

Query  443  SVVVPWCGAG--SSVP--------GSMLssgkaistsssSCC------------------  348
            ++ +PW GA   SSVP        G    S       +SS C                  
Sbjct  557  AIAIPWNGAKPRSSVPLSQILPPQGDTFWSTSKAVRYNSSLCGKDSIVNNSVSTSAAPGI  616

Query  347  -----QF------KGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVV  204
                 +F      K  ATWPEE LP+ + S  L +S +K L++ +Q     +PN WG V+
Sbjct  617  FNLNQEFFIESSCKSSATWPEEILPSTTVSVNLDESQFKLLRNCFQG----TPNSWGQVI  672

Query  203  VTAGLDGYIRTFLNYGLPI  147
            VTAG DG IR+F N+GLP+
Sbjct  673  VTAGYDGRIRSFQNFGLPV  691



>ref|XP_009390051.1| PREDICTED: uncharacterized protein LOC103976536 [Musa acuminata 
subsp. malaccensis]
Length=699

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 69/190 (36%), Positives = 95/190 (50%), Gaps = 34/190 (18%)
 Frame = -3

Query  614  ISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSH  450
            I  G R +   + A+F+SD +HVVSV EDSNV IW+Y+       +  K +RS E F+S 
Sbjct  512  ILKGHRKAKNQLYASFSSDGRHVVSVGEDSNVYIWSYDVSGNLPCRGPKLIRSSEFFFSK  571

Query  449  NASVVVPWCGAGSSVPGSMLssgkaists----ssSCCQFKG------------------  336
             AS+ VPW G G +   +++++   IS+     S   C+ K                   
Sbjct  572  GASIAVPWPGMGCNDREAIVNNSNHISSQPQKISEQVCRLKNPDCLSLGAWPFSDGSSRV  631

Query  335  CATWPEEKL-----PNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRT  171
             ATWPEEKL     P L P    +  +      W  +L S  + W  V+VTAG DG IR+
Sbjct  632  SATWPEEKLSLQTKPRLLPEDCHQQYHHLHHDYW--SLTSMASTWNSVIVTAGDDGAIRS  689

Query  170  FLNYGLPIRF  141
            F N+GLPIR 
Sbjct  690  FHNFGLPIRL  699



>ref|XP_009781900.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Nicotiana sylvestris]
 ref|XP_009781901.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Nicotiana sylvestris]
Length=666

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 91/192 (47%), Gaps = 39/192 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S     ATFTS  KHVVSV EDS+V +W+YN++     + +K++RS E F+S   S
Sbjct  475  GLSKSGSHTSATFTSTGKHVVSVGEDSHVYLWDYNDVSIQASKQTKSIRSCEHFHSKGVS  534

Query  440  VVVPWCGA----------GSSVPGSMLssgkaistsssSCCQFK------------GCAT  327
            V +PW G           GSS    ++   +   + +    +F             G  T
Sbjct  535  VAIPWSGQATTADDSENFGSSNVDPLIGEPQEDFSQTRDSSRFSLGNWFTMDVTSGGSVT  594

Query  326  WPEEKL--------PNLSPSPVLKSDYKFLKSAWQSAL---ASSPNLWGLVVVTAGLDGY  180
            WPEE L         N         D+ + +      L   A SP  WGLVVVTAG DG 
Sbjct  595  WPEEMLLPYDIPSAENDEHRSTYHDDHLYRQQQRNKNLNCRALSP-AWGLVVVTAGWDGK  653

Query  179  IRTFLNYGLPIR  144
            IRTF NYGLP+R
Sbjct  654  IRTFHNYGLPVR  665



>ref|XP_002517227.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF45127.1| WD-repeat protein, putative [Ricinus communis]
Length=654

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 94/188 (50%), Gaps = 36/188 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNAS  441
            G+  S   + A+FTS  KH++SV ED  V +W+Y+EL T      K+VRS E F+S   S
Sbjct  470  GLPKSGSQMSASFTSGGKHIISVGEDCRVYVWDYDELCTPSSKHKKSVRSCEHFFSEGVS  529

Query  440  VVVPWCGAG------------SSVPGSMLssgkaistsssSCCQF------KG-CATWPE  318
            + VPW G              S +P    +S +  S   S    F      +G  ATWPE
Sbjct  530  IAVPWSGMRKELKDVDSGSIHSRMPSEEGTSRRRDSERFSLGNWFFIDGPCRGSSATWPE  589

Query  317  EKLPN----LSPSPVLKSDY-----KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFL  165
            EKLP+    ++        Y     + +K+   + L   PN WGLV+ TAG DG IRTF 
Sbjct  590  EKLPHWDIAMAEEECQHQHYENFQQQLIKTHGHTTL---PNAWGLVIATAGWDGTIRTFH  646

Query  164  NYGLPIRF  141
            NYGLP+R 
Sbjct  647  NYGLPVRL  654



>ref|XP_010931045.1| PREDICTED: lissencephaly-1 homolog 1-like [Elaeis guineensis]
 ref|XP_010931046.1| PREDICTED: lissencephaly-1 homolog 1-like [Elaeis guineensis]
Length=701

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 70/185 (38%), Positives = 97/185 (52%), Gaps = 31/185 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G+R +   + A+FTSD +H+VSV EDS V IWNY+       + SK++R+ E F+S  AS
Sbjct  518  GLRKAKSQLSASFTSDGRHIVSVGEDSYVYIWNYDSSGSLSSKGSKSIRACELFFSERAS  577

Query  440  VVVPWCG-----AGSSVPGSMLssgkaistsssSCCQ----------------FKGCATW  324
            V VPW G     AGS       SS +     +S+C +                 +G ATW
Sbjct  578  VAVPWPGLDHGQAGSGGKTLDASSLQQKILEASTCLRDPDCFSLGTWLFSDGSSRGSATW  637

Query  323  PEEKLPNLSPSPVLKSD----YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYG  156
            PEEKL + +P P  K++    +         +L S   +W LV+VTA  DG IR+F NYG
Sbjct  638  PEEKLSS-TPKPSSKTESCHHHHCHLHHQYHSLTSMAAMWSLVIVTASHDGTIRSFHNYG  696

Query  155  LPIRF  141
            LP+R 
Sbjct  697  LPVRL  701



>gb|KDP26132.1| hypothetical protein JCGZ_22233 [Jatropha curcas]
Length=660

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 64/181 (35%), Positives = 90/181 (50%), Gaps = 30/181 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNAS  441
            G+  S   + A+FTS  +H++SV ED  V +WNY+   T     +K+V S E F+S   S
Sbjct  482  GLPKSGSQMSASFTSTGRHIISVGEDCRVYVWNYDAFCTPSSKHTKSVTSCEHFFSEGVS  541

Query  440  VVVPWCGAGSSVPG-------SMLssgkaistsssSCCQFK---------GC----ATWP  321
            + VPW G  + + G       + +      ++      +F          GC    ATWP
Sbjct  542  IAVPWSGMQTELKGFNSGNIATGVQQEVEGASRRRDSDRFSLGNWLFMDGGCRGSSATWP  601

Query  320  EEKLPNLSPSPVLKSDY--KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            EEKLP    + +   +Y  K   S    AL+ +   WGLV+V AG DG IRTF NYGLP+
Sbjct  602  EEKLPRWDVTTISDENYQQKLRNSNDHMALSDA---WGLVMVGAGWDGTIRTFHNYGLPV  658

Query  146  R  144
            R
Sbjct  659  R  659



>ref|XP_009379832.1| PREDICTED: 2-deoxy-glucose resistant protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379833.1| PREDICTED: 2-deoxy-glucose resistant protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=704

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 96/188 (51%), Gaps = 38/188 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNAS  441
            G R +   + A+F+SD +H++SV EDSNV IWNYN         +K++ S E F+S   S
Sbjct  522  GHRKAKSQLSASFSSDGRHIISVGEDSNVYIWNYNGSGNLPCIGAKSIHSSEFFFSRGVS  581

Query  440  VVVPWCGAG------------SSVPGSMLssgkaistsssSCCQF----------KGCAT  327
            V VPW G G            SS+P  +L         +S C             K  AT
Sbjct  582  VAVPWPGVGYRETDVGNNTQISSLPHKIL--EPFPWLKNSDCFSLGTWLFSDSSSKMSAT  639

Query  326  WPEEKLPNLSPSPVLKSDYKFLKSA------WQSALASSPNLWGLVVVTAGLDGYIRTFL  165
            WPEEKLP+ +  P ++ D+   +S+      W  +LA     W LV+VTAG DG IR+F 
Sbjct  640  WPEEKLPSQT-KPKIQPDHSCGRSSHLHHDYW--SLAHMAGTWNLVIVTAGSDGTIRSFH  696

Query  164  NYGLPIRF  141
            NYGLP++ 
Sbjct  697  NYGLPVQL  704



>ref|XP_010537067.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Tarenaya hassleriana]
 ref|XP_010537068.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Tarenaya hassleriana]
Length=660

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 88/164 (54%), Gaps = 34/164 (21%)
 Frame = -3

Query  584  LVPATFTSDEKHVVSVTEDSNVCIWNYNE----------LQTSKTVRSYESFYSHNASVV  435
            L   + TSD KH+VS  EDSNV IWN ++              K +RS+E F + NASV 
Sbjct  511  LTSVSLTSDGKHIVSACEDSNVYIWNSSDNTHEEESDSSSSQMKKIRSFECFLT-NASVA  569

Query  434  VPWCGAGSS--------VPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLK  279
              WCG  S         +P S LS G A+ +       FKGCATWPEE LP+ SP    K
Sbjct  570  TTWCGFSSEDKSPRQTPLPPSCLSQGLAMGSG------FKGCATWPEENLPS-SPFTTFK  622

Query  278  SDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
             +    K+   ++LA     WG+V+VT G DG IRTF NYGLP+
Sbjct  623  MNVSPYKT---NSLA-----WGMVIVTGGWDGRIRTFQNYGLPL  658



>ref|XP_002523311.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF39027.1| WD-repeat protein, putative [Ricinus communis]
Length=608

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 98/195 (50%), Gaps = 44/195 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS----KTVRSYESFYSHNASV  438
            G+ N+   + A+FTSD  H+VS +EDSNV IWNY   +      K + + E F+S+NASV
Sbjct  414  GLHNAGSQISASFTSDGTHIVSASEDSNVYIWNYIMQEVPVPRVKNIWACEHFFSNNASV  473

Query  437  VVPWCGA--GSSVP----GSMLssgkaistsssSCCQF----------------------  342
             +PW G   G+SV     G+MLSS  +  ++                             
Sbjct  474  AIPWPGTIHGNSVAINISGTMLSSMNSELSNDDRMSIHSESGESSRRKLPFSSPDNFPTR  533

Query  341  ---------KGCATWPEEKLPNLSPSPVLKS-DYKFLKSAWQSALASSPNLWGLVVVTAG  192
                     KG ATWPEE LP+ S    +    YKFLK+    ++  SP+  GLV+VTAG
Sbjct  534  HGFFSESLPKGSATWPEENLPSSSSGISMSKSQYKFLKAI--QSMHGSPHALGLVIVTAG  591

Query  191  LDGYIRTFLNYGLPI  147
             DG IR F NYGLP+
Sbjct  592  WDGRIRWFQNYGLPL  606



>ref|XP_002264456.1| PREDICTED: WD repeat-containing protein YMR102C-like [Vitis vinifera]
 ref|XP_010661969.1| PREDICTED: WD repeat-containing protein YMR102C-like [Vitis vinifera]
Length=753

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 98/203 (48%), Gaps = 50/203 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNAS  441
            G+RN+   + A+FTSD  H+VS +EDSNV +WN           +K   S E F+S+NAS
Sbjct  551  GLRNAGSQISASFTSDGMHIVSASEDSNVYVWNCISQDVPVHSQAKNNWSCERFFSNNAS  610

Query  440  VVVPWCGAG------SSVPGSM----------------------LssgkaistsssSCCQ  345
            V +PWCGA       S++ G+                       L    +     SS   
Sbjct  611  VAIPWCGATCGNSIFSNISGAFPSPKLSVNLPRSDPENKPHQCHLGESSSTILPFSSPDH  670

Query  344  FKGCATWPEEKLPN----------LSPSPVLKS------DYKFLKSAWQSALASSPNLWG  213
            F     +  E LP           L+PS ++ S       YKFLK++ QS    SP+ WG
Sbjct  671  FSVGHGFFSESLPKGSATWPEEKLLTPSSLVVSSAMCKSQYKFLKTSCQSMFG-SPHAWG  729

Query  212  LVVVTAGLDGYIRTFLNYGLPIR  144
            LV+VTAG DG IR+F NYGLPIR
Sbjct  730  LVIVTAGWDGRIRSFQNYGLPIR  752



>ref|XP_004148673.1| PREDICTED: uncharacterized protein LOC101207772 [Cucumis sativus]
 ref|XP_004163054.1| PREDICTED: uncharacterized LOC101207772 [Cucumis sativus]
 gb|KGN48370.1| hypothetical protein Csa_6G483500 [Cucumis sativus]
Length=668

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 98/191 (51%), Gaps = 37/191 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   + A+FT + KH+VSV EDS V +WNY+ L     + +K+ +S E F+S   S
Sbjct  479  GLPKSGSQMSASFTKNGKHIVSVGEDSRVYMWNYDSLFLPSSKEAKSQQSCEHFFSDGVS  538

Query  440  VVVPWCGAGS-----SVPGSMLssgkaistsssSCCQ---------------FKGCATWP  321
            V +PW G G+     S   ++ S+ K    ++S   +               F+G ATWP
Sbjct  539  VAIPWSGVGTEPNCFSNNQALFSNRKNYQRAASWTRETDRFSLSNWFSADGLFRGSATWP  598

Query  320  EEKLPNLSPSPVLKSDYKFLK--SAWQSALASSPN---------LWGLVVVTAGLDGYIR  174
            EE+LP L   P+ + +   L+     Q  L S  +          WGLV+V AGLDG I+
Sbjct  599  EERLP-LWDLPITEDENGSLQHHDCHQKKLNSHRDAHNDGSQLETWGLVMVVAGLDGTIK  657

Query  173  TFLNYGLPIRF  141
            TF NYGLPI+ 
Sbjct  658  TFHNYGLPIKL  668



>ref|XP_007206323.1| hypothetical protein PRUPE_ppa002479mg [Prunus persica]
 gb|EMJ07522.1| hypothetical protein PRUPE_ppa002479mg [Prunus persica]
Length=668

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 63/181 (35%), Positives = 88/181 (49%), Gaps = 33/181 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+  S   +  +FTS+ KH++SV EDS+V +W+Y+    S     ++V+S E F+    S
Sbjct  495  GLPKSGCQMSTSFTSNGKHIISVGEDSHVYLWDYDGFCVSSSKQIRSVKSCEHFFCEGVS  554

Query  440  VVVPWCG-------------------AGSSVP--GSMLssgkaistsssSCCQFKGCATW  324
            V VPW G                    G   P  GS  +   ++ +   S    +G ATW
Sbjct  555  VAVPWSGMRPEQRSLETASGRYCSQRQGHLEPAYGSRDAERFSLGSWLFSNGPCRGSATW  614

Query  323  PEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            PEE+LP  +P       +     A        P+ WGLV+VTAG DG IRTF NYGLP+R
Sbjct  615  PEEELPPRAPQHQDHQHHHHNHPA-------RPDTWGLVIVTAGCDGTIRTFHNYGLPVR  667

Query  143  F  141
             
Sbjct  668  L  668



>gb|EMT30395.1| hypothetical protein F775_32248 [Aegilops tauschii]
Length=692

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 96/183 (52%), Gaps = 36/183 (20%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNA  444
            +G+R+ +  + A+FT D +H+VS +EDSN+ +WN +    S     KT  S E F S+NA
Sbjct  515  SGLRSGSCQMSASFTPDGEHIVSASEDSNIYVWNRDNQDDSVWRQAKTTYSSERFLSNNA  574

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCCQF----------------------KGC-  333
            ++ +PW G   + P S +S    I    SS   F                      KG  
Sbjct  575  AIAIPWHG---TKPRSHVSLASHIQFKYSSSKSFPSRPSAPGIFNLNQELFAEPSCKGAS  631

Query  332  ATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYG  156
            ATWPEE LP+ S    L ++ +K L++  QS    + N WG V+VTAG DG IR+F NYG
Sbjct  632  ATWPEEMLPSGSIGASLDETQHKLLRNCSQS----TANSWGRVIVTAGWDGRIRSFQNYG  687

Query  155  LPI  147
            LP+
Sbjct  688  LPV  690



>ref|XP_006650977.1| PREDICTED: WD repeat-containing protein 44-like [Oryza brachyantha]
Length=751

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 102/211 (48%), Gaps = 54/211 (26%)
 Frame = -3

Query  632  AHLLFPISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSY  468
             H +     G+RNS+  V A+FT D  H++S ++DS++ +WNY N++       KTV S 
Sbjct  546  GHHVISNYKGLRNSS-QVAASFTPDGDHIISASDDSSIYMWNYANQIAPVTNHVKTVWSN  604

Query  467  ESFYSHNASVVVPWCGAGSSVPGSMLssgkaistsssSCCQFK-----------------  339
            E F  H+ ++ +PW    S    S+  +    S+      +FK                 
Sbjct  605  EHFSCHDVAIAIPW--NASQTRNSISLACNITSSRQEVSDEFKNEHDSALCSHPEDSPDG  662

Query  338  ------------------------GCATWPEEKLPNLS--PSPVLKSDYKFLKSAWQSAL  237
                                    G ATWPEE+LP+ S   S + KS YKFLK++ Q+A 
Sbjct  663  DSLYQLPSGNFTLSSAFFAESAPRGSATWPEEQLPSNSSTQSTLRKSQYKFLKASCQNA-  721

Query  236  ASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
              + + WG V+V AG DGYIR+F NYGLP++
Sbjct  722  --ATHAWGQVIVAAGWDGYIRSFQNYGLPVQ  750



>ref|XP_010312469.1| PREDICTED: uncharacterized WD repeat-containing protein C18H10.05 
[Solanum lycopersicum]
Length=659

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 86/190 (45%), Gaps = 37/190 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S     ATF+S  KH+VSV EDS V +W+  ++     + +K++RS E F S   S
Sbjct  470  GLSKSGSHTSATFSSTGKHIVSVGEDSRVYLWDNADINIQASKQTKSIRSCEHFLSEGIS  529

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQ-----------------------FKGCA  330
            V +PW G  ++V  S  S             Q                       F+G  
Sbjct  530  VAIPWSGQATTVGDSENSISSNFDPLRRGEHQEVSSKTRDSRRFSVGNWFSMDVSFRGSV  589

Query  329  TWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNL--------WGLVVVTAGLDGYIR  174
            TWPEE L    P P+ ++D     S        + NL        WGLV+VTAG DG IR
Sbjct  590  TWPEEMLLPDDP-PIAENDEHLCTSNDDHLHQHNKNLNYRALSPAWGLVIVTAGWDGKIR  648

Query  173  TFLNYGLPIR  144
            TF NYGLP+R
Sbjct  649  TFHNYGLPVR  658



>ref|XP_009787742.1| PREDICTED: uncharacterized protein LOC104235633 isoform X2 [Nicotiana 
sylvestris]
Length=727

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 96/180 (53%), Gaps = 30/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G RN+   + A+FTSD KH++S +EDSNV +WN +  +       K V+S E F+S + S
Sbjct  549  GQRNAGNHLSASFTSDGKHIISASEDSNVYVWNCDIRKDDYVSQPKVVKSSE-FFSSDVS  607

Query  440  VVVPWCGAG--------------SSVPGSMLssgkaistsssSCCQF----KGCATWPEE  315
            + +PW G                S  P S+L    +   S           KG ATWPEE
Sbjct  608  IAIPWSGLKTVNPDNGWHSGGGLSQTPNSLLPFMASPYLSLGREMFLEAIPKGSATWPEE  667

Query  314  KLPNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KLP  SP      + +S+YK LKS+     +S+ + WGLV+VTAG  G IR+F NYGLP+
Sbjct  668  KLPVSSPRSVSSRMCRSEYKLLKSS--CQSSSNSHAWGLVIVTAGYGGRIRSFHNYGLPL  725



>ref|XP_009787741.1| PREDICTED: uncharacterized protein LOC104235633 isoform X1 [Nicotiana 
sylvestris]
Length=728

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 96/180 (53%), Gaps = 30/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G RN+   + A+FTSD KH++S +EDSNV +WN +  +       K V+S E F+S + S
Sbjct  550  GQRNAGNHLSASFTSDGKHIISASEDSNVYVWNCDIRKDDYVSQPKVVKSSE-FFSSDVS  608

Query  440  VVVPWCGAG--------------SSVPGSMLssgkaistsssSCCQF----KGCATWPEE  315
            + +PW G                S  P S+L    +   S           KG ATWPEE
Sbjct  609  IAIPWSGLKTVNPDNGWHSGGGLSQTPNSLLPFMASPYLSLGREMFLEAIPKGSATWPEE  668

Query  314  KLPNLSPSP----VLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KLP  SP      + +S+YK LKS+     +S+ + WGLV+VTAG  G IR+F NYGLP+
Sbjct  669  KLPVSSPRSVSSRMCRSEYKLLKSS--CQSSSNSHAWGLVIVTAGYGGRIRSFHNYGLPL  726



>tpg|DAA42921.1| TPA: signal transducer [Zea mays]
Length=751

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 101/204 (50%), Gaps = 54/204 (26%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSYESFYSHNAS  441
            G+R S   VPA FT D  H+++ ++DS++ +WNY N+L       KTV SYE F+ ++ S
Sbjct  551  GLR-SPSQVPAAFTPDGDHIIAASDDSSIYMWNYANQLAPVTSRVKTVWSYEHFFCNDVS  609

Query  440  VVVPWCG--AGSSVP--------GSMLssgkaistsssSCCQF-----------------  342
            V +PW    A SS+            +S     S  S SCC                   
Sbjct  610  VAIPWNALPARSSISLACNIPLSRQEVSEELHNSQESVSCCSAEGSPKADSSCRLPSGNF  669

Query  341  ------------KGCATWPEEKLPNLSPS------PVLKSDYKFLKSAWQSALASSPNLW  216
                        +G ATWPEE+LP+           + KS YKFLK++ QSA   + + W
Sbjct  670  TLSNAFSAELAPRGKATWPEEQLPSSDSVTPSSSSALRKSQYKFLKTSCQSA---ATHAW  726

Query  215  GLVVVTAGLDGYIRTFLNYGLPIR  144
            G V+VTAG DG IR+F NYGLP++
Sbjct  727  GQVIVTAGWDGNIRSFQNYGLPMQ  750



>ref|XP_009383058.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44-like [Musa acuminata subsp. malaccensis]
Length=349

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 97/190 (51%), Gaps = 47/190 (25%)
 Frame = -3

Query  581  VPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVRSY---ESFYSHNASVVVPWCGA  417
            + ATFT+D +H++S +ED N  +W++  ++++ S  V+S    E F+S NAS+ +PW G 
Sbjct  164  ISATFTADGQHIISASEDCNFSVWSHVSHDIRMSNHVKSIWSCEHFFSTNASIAIPWHGL  223

Query  416  GSSVPGSM---------LssgkaistsssSCCQF--------------------------  342
             SS   SM         ++  ++  T + S C                            
Sbjct  224  ESSYRISMTSDVFHSQQVNGDQSGVTENESKCHLQDSDGEVLYLSPSGSFTLSHDFFSEL  283

Query  341  --KGCATWPEEKLP-NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRT  171
              K  ATWPEEKLP N + S V KS YKFLK++      ++ + WG V+ TAG D +IR+
Sbjct  284  LPKSSATWPEEKLPSNCAASSVSKSRYKFLKTS----CXNTSHAWGQVISTAGCDEWIRS  339

Query  170  FLNYGLPIRF  141
            + N+GLP+  
Sbjct  340  YQNFGLPVHI  349



>ref|XP_010919285.1| PREDICTED: uncharacterized protein LOC105043440 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919286.1| PREDICTED: uncharacterized protein LOC105043440 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919287.1| PREDICTED: uncharacterized protein LOC105043440 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919288.1| PREDICTED: uncharacterized protein LOC105043440 isoform X1 [Elaeis 
guineensis]
Length=755

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 100/197 (51%), Gaps = 49/197 (25%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQT-----SKTVRSYESFYSHNAS  441
            G+ N+   + A+FT+D +H++S ++DSNV +WN+   +      SK+  S E  +  NAS
Sbjct  560  GLWNAGSQISASFTADGRHIISTSKDSNVHVWNHVNPEVPASNRSKSTWSCERIFCDNAS  619

Query  440  VVVPW----CGAGSSVPGSMLssg---kaistsssSCCQF--------------------  342
            + +PW    C    SV   +L S    +  + ++ SC +                     
Sbjct  620  IAIPWNGLDCRNAVSVTSEVLPSRYVFRDQAGNTGSCYRHRGEDSFSNNTLHLSPSGSFT  679

Query  341  -----------KGCATWPEEKLPNLS--PSPVLKSDYKFLKSAWQSALASSPNLWGLVVV  201
                       KG ATWPEEKLP+ S   S + KS YKFLK++ Q+    + + WG V+V
Sbjct  680  LSHEFFSEFLPKGSATWPEEKLPSSSTTASTLCKSHYKFLKTSCQN----TSHAWGQVIV  735

Query  200  TAGLDGYIRTFLNYGLP  150
            TAG DG IR+F NYGLP
Sbjct  736  TAGWDGRIRSFQNYGLP  752



>ref|XP_009401778.1| PREDICTED: uncharacterized protein LOC103985710 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=759

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 95/187 (51%), Gaps = 48/187 (26%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNASVVVPW-----  426
            A+FT+D +H+VS ++DSNV  WN     TS     K+ RS E F+S N ++ +PW     
Sbjct  547  ASFTADGQHIVSASDDSNVYFWNRASHNTSTSNHVKSTRSCEHFFSRNTTIAIPWHGLES  606

Query  425  -----------------------------CGAGSS--VPGSMLssgkaistsssSCCQF-  342
                                         C +G S  +    LS   + + S     +F 
Sbjct  607  GDRISVTSEVIHSEKGNSDEAGVPEIDLKCHSGDSYGINALYLSPSGSFTLSHEFFSEFS  666

Query  341  -KGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTF  168
             KG  TWPEEKLP+ S +  L K+ +KFLK+++Q+    + + WG V++TAG DG IR++
Sbjct  667  PKGSVTWPEEKLPSSSAASTLSKAHHKFLKTSFQN----TSHAWGQVILTAGWDGSIRSY  722

Query  167  LNYGLPI  147
             NYGLP+
Sbjct  723  QNYGLPV  729



>ref|XP_010676850.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=716

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 90/156 (58%), Gaps = 10/156 (6%)
 Frame = -3

Query  581  VPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS----KTVRSYESFYSHNASVVVPWCGA  417
            V A++T+D KH++S T+DSN+ IWN+ N+ + S    K + S ESF S NA + VPW G 
Sbjct  531  VFASYTADGKHIISATDDSNIYIWNHPNKGRISNNKPKNIWSSESFISDNALIAVPWHGI  590

Query  416  GSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP---SPVLKS-DYKFLKSAW  249
             +S       + K  + ++          +  +  L NL     SP +   DY FL++  
Sbjct  591  RTSTSELPPLTPKQTTNTNHDHVSPSTIRSQEDAALRNLRAALVSPAVGDIDYGFLRNVC  650

Query  248  QSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            +S L+ S ++WGLV+VT G DG IRT+ NYGLP+R+
Sbjct  651  ESILSGS-HMWGLVIVTGGKDGQIRTYHNYGLPVRY  685



>ref|XP_009401780.1| PREDICTED: uncharacterized protein LOC103985710 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=755

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 95/187 (51%), Gaps = 48/187 (26%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNASVVVPW-----  426
            A+FT+D +H+VS ++DSNV  WN     TS     K+ RS E F+S N ++ +PW     
Sbjct  543  ASFTADGQHIVSASDDSNVYFWNRASHNTSTSNHVKSTRSCEHFFSRNTTIAIPWHGLES  602

Query  425  -----------------------------CGAGSS--VPGSMLssgkaistsssSCCQF-  342
                                         C +G S  +    LS   + + S     +F 
Sbjct  603  GDRISVTSEVIHSEKGNSDEAGVPEIDLKCHSGDSYGINALYLSPSGSFTLSHEFFSEFS  662

Query  341  -KGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTF  168
             KG  TWPEEKLP+ S +  L K+ +KFLK+++Q+    + + WG V++TAG DG IR++
Sbjct  663  PKGSVTWPEEKLPSSSAASTLSKAHHKFLKTSFQN----TSHAWGQVILTAGWDGSIRSY  718

Query  167  LNYGLPI  147
             NYGLP+
Sbjct  719  QNYGLPV  725



>ref|XP_009397845.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397846.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397847.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397848.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397849.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
Length=739

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 98/196 (50%), Gaps = 53/196 (27%)
 Frame = -3

Query  602  VRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY--NELQTSKTVRSY---ESFYSHNASV  438
            +RNS   V A+FTSD +H+VS + DSNV IW++  N + TS  V+S    E F+S NAS+
Sbjct  549  IRNSGSQVSASFTSDGRHIVSASGDSNVYIWSHANNAVPTSNKVKSTLSCECFFSSNASI  608

Query  437  VVPWCG--AGSSVPGSMLssgkaistsssS---------------------------CC-  348
             +PW G  +G  V  S +  G+       +                           CC 
Sbjct  609  AIPWNGLQSGKKVTTSEVLHGQKDVFREKAGVSGNGYGSNCRIEDLFGSNTLYLSPSCCF  668

Query  347  ----QF-----KGCATWPEEKLPNLSPSPVLKSDYKFLK-SAWQSALASSPNLWGLVVVT  198
                +F     K  ATWPEE LP+   +      YK LK S+W ++ A     WGLV+VT
Sbjct  669  SPSHEFLEYVPKSSATWPEENLPSSFAASTF---YKSLKTSSWNTSHA-----WGLVMVT  720

Query  197  AGLDGYIRTFLNYGLP  150
            AGLDG IR++ NYGLP
Sbjct  721  AGLDGRIRSYQNYGLP  736



>ref|XP_010247260.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nelumbo 
nucifera]
Length=699

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+R S   + A+FT D KH++SV EDS V +WNY+ L     + +K+VRS E F     S
Sbjct  522  GLRKSGSQMSASFTLDGKHIISVGEDSRVYVWNYDGLCLQSSKQAKSVRSCEHFLDDGVS  581

Query  440  VVVPWCGAG-------------SSVPGSMLssgkaistsssSC--------CQFKGCATW  324
            V +PW                 SS    +L +      S            C  +G ATW
Sbjct  582  VAIPWSATQQDHKLSDSFSPQHSSKRQELLEATSCHRDSERFSLGSWFSMDCPSRGSATW  641

Query  323  PEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            PEEKLP  +   V  +D          +      +WG+V+VTA  +G +RTF N+GLP+R
Sbjct  642  PEEKLPLWT---VQVTDNDHNHLHHHHSHTDLAGVWGIVIVTASSNGVVRTFHNFGLPVR  698

Query  143  F  141
             
Sbjct  699  L  699



>ref|XP_010676851.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=681

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 90/156 (58%), Gaps = 10/156 (6%)
 Frame = -3

Query  581  VPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS----KTVRSYESFYSHNASVVVPWCGA  417
            V A++T+D KH++S T+DSN+ IWN+ N+ + S    K + S ESF S NA + VPW G 
Sbjct  496  VFASYTADGKHIISATDDSNIYIWNHPNKGRISNNKPKNIWSSESFISDNALIAVPWHGI  555

Query  416  GSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP---SPVLKS-DYKFLKSAW  249
             +S       + K  + ++          +  +  L NL     SP +   DY FL++  
Sbjct  556  RTSTSELPPLTPKQTTNTNHDHVSPSTIRSQEDAALRNLRAALVSPAVGDIDYGFLRNVC  615

Query  248  QSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            +S L+ S ++WGLV+VT G DG IRT+ NYGLP+R+
Sbjct  616  ESILSGS-HMWGLVIVTGGKDGQIRTYHNYGLPVRY  650



>ref|XP_010247261.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nelumbo 
nucifera]
Length=638

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+R S   + A+FT D KH++SV EDS V +WNY+ L     + +K+VRS E F     S
Sbjct  461  GLRKSGSQMSASFTLDGKHIISVGEDSRVYVWNYDGLCLQSSKQAKSVRSCEHFLDDGVS  520

Query  440  VVVPWCGAG-------------SSVPGSMLssgkaistsssSC--------CQFKGCATW  324
            V +PW                 SS    +L +      S            C  +G ATW
Sbjct  521  VAIPWSATQQDHKLSDSFSPQHSSKRQELLEATSCHRDSERFSLGSWFSMDCPSRGSATW  580

Query  323  PEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            PEEKLP  +   V  +D          +      +WG+V+VTA  +G +RTF N+GLP+R
Sbjct  581  PEEKLPLWT---VQVTDNDHNHLHHHHSHTDLAGVWGIVIVTASSNGVVRTFHNFGLPVR  637

Query  143  F  141
             
Sbjct  638  L  638



>ref|XP_010676852.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 90/156 (58%), Gaps = 10/156 (6%)
 Frame = -3

Query  581  VPATFTSDEKHVVSVTEDSNVCIWNY-NELQTS----KTVRSYESFYSHNASVVVPWCGA  417
            V A++T+D KH++S T+DSN+ IWN+ N+ + S    K + S ESF S NA + VPW G 
Sbjct  473  VFASYTADGKHIISATDDSNIYIWNHPNKGRISNNKPKNIWSSESFISDNALIAVPWHGI  532

Query  416  GSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLSP---SPVLKS-DYKFLKSAW  249
             +S       + K  + ++          +  +  L NL     SP +   DY FL++  
Sbjct  533  RTSTSELPPLTPKQTTNTNHDHVSPSTIRSQEDAALRNLRAALVSPAVGDIDYGFLRNVC  592

Query  248  QSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            +S L+ S ++WGLV+VT G DG IRT+ NYGLP+R+
Sbjct  593  ESILSGS-HMWGLVIVTGGKDGQIRTYHNYGLPVRY  627



>ref|XP_007048297.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX92454.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=660

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 91/188 (48%), Gaps = 36/188 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE--LQTS---KTVRSYESFYSHNAS  441
            G+  S   + A+FTS  KH++SV ED +V +WNYN   LQTS   K+VRS E F+  + S
Sbjct  476  GLPKSGSQMSASFTSTGKHIISVGEDCHVYVWNYNGFCLQTSKHTKSVRSCEHFFCEDVS  535

Query  440  VVVPW--------------CGAGSSVPGSMLssgkaistsssSCCQF-------KGCATW  324
            V +PW              C A S   G +  +     +   S   +       K  ATW
Sbjct  536  VALPWLGQVADQSHLHINDCRARSPREGQIEGASGIRDSERFSLGNWFSIDGSCKVSATW  595

Query  323  PEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPN-------LWGLVVVTAGLDGYIRTFL  165
            PEEKLP L  + VL+ +Y       Q    SS N        WGLV+V  G +G IRTF 
Sbjct  596  PEEKLP-LCDAEVLEDEY--CTYDQQQLCHSSANNCTTLSDTWGLVIVAGGWNGTIRTFH  652

Query  164  NYGLPIRF  141
            NYG P+R 
Sbjct  653  NYGFPVRL  660



>ref|XP_011099777.1| PREDICTED: uncharacterized protein LOC105178110 [Sesamum indicum]
Length=659

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 63/186 (34%), Positives = 94/186 (51%), Gaps = 32/186 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL--QTS---KTVRSYESFYSHNAS  441
            G+  S G + A+FTS  KH+VS+ EDS + +WN+ +L  QTS   K+ RS E F S   +
Sbjct  475  GLTKSGGQMSASFTSSGKHIVSIGEDSRIYLWNHEDLCIQTSKQAKSTRSCEHFISEGVT  534

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQ-------------FKGCATWPEEKLPNL  300
            V +PW  + +S P ++ +     S+S     +              +   TWPEEKLP L
Sbjct  535  VALPWSDSDNSSPSTVPTHDHQESSSRIWDSERFSLANWFSMDGSSRASLTWPEEKLP-L  593

Query  299  SPSPVLKSD-------------YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNY  159
               P +++D             ++  K+A +      P  WGLV VT  ++G IRT+ NY
Sbjct  594  CDLPSVENDSQPYICCGDHLHHHQQHKAATRHGPRILPTTWGLVFVTGNMNGTIRTYHNY  653

Query  158  GLPIRF  141
            GLP+R 
Sbjct  654  GLPLRL  659



>gb|KJB09623.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
 gb|KJB09624.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
Length=774

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 92/186 (49%), Gaps = 48/186 (26%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY----NELQTSKTVRSYESFYSHNASV  438
            G+ N+   + A FTSD   +VS +EDSNV +WNY      +  SK  RS E F+S+NASV
Sbjct  553  GLHNAGSQISAVFTSDGMRIVSASEDSNVYVWNYINQDGPVSHSKKNRSCERFFSNNASV  612

Query  437  VVPWCG-----------AGSS----------------VPGSMLssgkaistsssSCCQF-  342
             +PWCG           +G+S                V  S L          SS  +F 
Sbjct  613  AIPWCGITCRNSIFPNMSGTSPSPKDLSSRWCNENTGVLQSELGDSSQHKLPFSSSERFS  672

Query  341  -----------KGCATWPEEKLPN----LSPSPVLKSDYKFLKSAWQSALASSPNLWGLV  207
                       KG ATWPEEKLP+    +  S + KS YK LK++ QSAL SS + WGLV
Sbjct  673  LGHGFFSESLLKGTATWPEEKLPHPDSFVVSSAMCKSQYKLLKTSCQSALGSS-HAWGLV  731

Query  206  VVTAGL  189
            +VTA L
Sbjct  732  IVTAFL  737



>gb|KHG04425.1| WD repeat-containing 44 [Gossypium arboreum]
Length=645

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 90/181 (50%), Gaps = 32/181 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   + A+FTS  +H++SV ED  V +WNY+++     + +K+V S E F+  +  
Sbjct  467  GLHKSGSQMSASFTSTGRHIISVGEDCRVYVWNYDDICPRTSKHTKSVSSCEHFFCEDVC  526

Query  440  VVVPWCGAGSS------------------VPGSMLssgkaistsssSCCQFKGCATWPEE  315
            V +PW G GS                   +  S   S   + +   SC   KG ATWPEE
Sbjct  527  VAIPWLGQGSDQRHSDRSLRGDQIEGTSWIRDSQRFSLGNLFSIDGSC---KGSATWPEE  583

Query  314  KLPNLSPSPVLKSDY-----KFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLP  150
            KL  L  + V + +Y     + L   +    A+ P  WGLV+V  G +G I+TF NYGLP
Sbjct  584  KLM-LWETTVAEDEYYSYEQQQLCHNYGDYHATLPETWGLVIVAGGRNGRIKTFHNYGLP  642

Query  149  I  147
            +
Sbjct  643  V  643



>ref|XP_010671399.1| PREDICTED: uncharacterized protein LOC104888203 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671400.1| PREDICTED: uncharacterized protein LOC104888203 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 94/180 (52%), Gaps = 31/180 (17%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G++ S     A FT+D KH+V+ +EDSNV +W  N+   +     K ++S E F S NAS
Sbjct  523  GLKRSGASCTAFFTADGKHIVAASEDSNVYVWKCNDQDYADSSHVKKIKSSERFLS-NAS  581

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCCQF------------------KGCATWPEE  315
            V +PW G  + +  +   +G        S   F                  KG A WPEE
Sbjct  582  VALPWPGLQNEINRNEWHNGAFNGLPHGSRPHFSPPNFSCRQDFFLELYYPKGSALWPEE  641

Query  314  KL----PNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            KL    P    S + KS+YKFLK+  QS   S+ + WG+V+VTAG DG IR+F NYGLP+
Sbjct  642  KLVSPSPPSLTSSMHKSEYKFLKTC-QSR--SNSDAWGMVIVTAGWDGRIRSFHNYGLPV  698



>gb|EMS66574.1| WD repeat-containing protein 44 [Triticum urartu]
Length=714

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 94/182 (52%), Gaps = 36/182 (20%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNA  444
            +G+R+ +  + A+FT D +H+VS +EDSN+ +WN +    S     KT  S E F S+NA
Sbjct  513  SGLRSGSCQMSASFTPDGEHIVSASEDSNIYVWNRDNQDDSVWRQAKTTYSSERFLSNNA  572

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCCQF----------------------KGC-  333
            ++ +PW G   + P S +S    I    SS   F                      KG  
Sbjct  573  AIAIPWHG---TKPRSHVSLASHIQFKYSSSKSFPSRPSAPGIFNLNQELFAEPSCKGAS  629

Query  332  ATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYG  156
            ATWPEE LP+ S    L ++ +K L++  Q    S+ N WG V+VTAG DG IR F NYG
Sbjct  630  ATWPEEMLPSGSIGASLDETQHKLLRNCSQ----STANSWGRVIVTAGWDGRIRWFQNYG  685

Query  155  LP  150
            LP
Sbjct  686  LP  687



>ref|NP_001147943.1| signal transducer [Zea mays]
 gb|ACG29198.1| signal transducer [Zea mays]
Length=751

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 100/204 (49%), Gaps = 54/204 (26%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSYESFYSHNAS  441
            G+R S   VPA FT D  H+++ ++DS++ +WNY N+L       K V SYE F+ ++ S
Sbjct  551  GLR-SPSQVPAAFTPDGDHIIAASDDSSIYMWNYANQLAPVTSRVKAVWSYEHFFCNDVS  609

Query  440  VVVPWCG--AGSSVP--------GSMLssgkaistsssSCCQF-----------------  342
            V +PW    A SS+            +S     S  S SCC                   
Sbjct  610  VAIPWNALPARSSISLACNIPLSRQEVSEELHNSQESVSCCSAEGSPKADSSCRLPSGNF  669

Query  341  ------------KGCATWPEEKLPNLSPS------PVLKSDYKFLKSAWQSALASSPNLW  216
                        +G ATWPEE+LP+           + KS YKFLK++ QSA   + + W
Sbjct  670  TLSNAFSAELAPRGKATWPEEQLPSSDSVTPSSSSALRKSQYKFLKTSCQSA---ATHAW  726

Query  215  GLVVVTAGLDGYIRTFLNYGLPIR  144
            G V+VTAG DG IR+F NYGLP++
Sbjct  727  GQVIVTAGWDGNIRSFQNYGLPMQ  750



>gb|EMT18175.1| hypothetical protein F775_17680 [Aegilops tauschii]
Length=579

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 97/198 (49%), Gaps = 50/198 (25%)
 Frame = -3

Query  596  NSAGLVPATFTSDEKHVVSVTEDSNVCIWNY-NEL----QTSKTVRSYESFYSHNASVVV  432
             S+  V A+FT D  H++S ++DS + +WN+ N+L       KTV SYE F+S++ S+ +
Sbjct  345  QSSSQVAASFTPDGDHIISASDDSRIYMWNHANQLAPVTSRVKTVWSYERFFSNDVSIAI  404

Query  431  PWCGAGS---------------SVPGSM--LssgkaistsssSCCQF-------------  342
            PW  + S                V G +  +         +  C +              
Sbjct  405  PWNASQSRNSISLACNIPSLRQEVSGDLCDIQDSSTSRCQTEDCLEDDNMFRLPSGNFTL  464

Query  341  ----------KGCATWPEEKLPNLSP--SPVLKSDYKFLKSAWQSALASSPNLWGLVVVT  198
                      +G ATWPEE L + S   S + KS YKFLK++ Q+A   + + WG V+VT
Sbjct  465  SRAFLAESAPRGSATWPEEHLASNSATASMLRKSQYKFLKASCQNA---ATHAWGQVIVT  521

Query  197  AGLDGYIRTFLNYGLPIR  144
            A  DG+IR+F NYGLP++
Sbjct  522  ASWDGHIRSFQNYGLPVQ  539



>gb|EEE61519.1| hypothetical protein OsJ_15820 [Oryza sativa Japonica Group]
Length=384

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 54/202 (27%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE-----LQTSKTVRSYESFYSHNA  444
            +G+R+ +  + ATFT + +H++S +EDSNV +W++        + +KT ++ E F S+NA
Sbjct  187  SGLRSGSCQLSATFTPEGQHIISASEDSNVYVWSHENQYECACKQAKTTQTSEHFRSNNA  246

Query  443  SVVVPW------------------------------------CGAGSSV------PGSML  390
            ++ +PW                                    CG  SS+      P +  
Sbjct  247  AIAIPWNGTKPRSPVPLSSQILPPQGDTFWSMSKAIKYNSSLCGKDSSIKKIVSTPAAPG  306

Query  389  ssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWG  213
                       S C  K  ATWPEE LP+ + S  L +S +K L++ +Q     + N WG
Sbjct  307  IFNLNQEFFIESSC--KSSATWPEEMLPSTTASVNLDESQFKLLRNCFQG----TSNSWG  360

Query  212  LVVVTAGLDGYIRTFLNYGLPI  147
             V+VTAG DG IR F N+GLP+
Sbjct  361  QVIVTAGWDGRIRYFQNFGLPV  382



>ref|XP_008776128.1| PREDICTED: POC1 centriolar protein homolog B-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008776129.1| PREDICTED: POC1 centriolar protein homolog B-like isoform X1 
[Phoenix dactylifera]
Length=706

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 96/184 (52%), Gaps = 29/184 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G+R +   + A+FTSD +H+VSV EDS V IWNY+       + SK++R+ E F S  AS
Sbjct  523  GLRKAKNQLSASFTSDGRHIVSVGEDSYVYIWNYDSSGSLSSKGSKSIRACELFLSEGAS  582

Query  440  VVVPWCG-----AGSSVPGSMLssgkaistsssSCCQF----------------KGCATW  324
            V +PW G     AG S      SS +     +S+C +                 +G ATW
Sbjct  583  VAIPWPGLDHEHAGLSNKILDASSLQQKILEASTCPRDPDCFSLGTWLFSDGSSRGSATW  642

Query  323  PEEKLPNL-SPSPVLKSDYKFLKSAWQS--ALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            PEEKL +   PS  ++S +       +   +LAS    W LV+VTA  DG IR+F NYGL
Sbjct  643  PEEKLSSTPKPSLTVESCHLHHCHLHRKYYSLASMAATWSLVIVTASHDGTIRSFHNYGL  702

Query  152  PIRF  141
            P+R 
Sbjct  703  PVRL  706



>ref|XP_008776130.1| PREDICTED: uncharacterized protein LOC103696321 isoform X2 [Phoenix 
dactylifera]
Length=705

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 96/184 (52%), Gaps = 29/184 (16%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G+R +   + A+FTSD +H+VSV EDS V IWNY+       + SK++R+ E F S  AS
Sbjct  522  GLRKAKNQLSASFTSDGRHIVSVGEDSYVYIWNYDSSGSLSSKGSKSIRACELFLSEGAS  581

Query  440  VVVPWCG-----AGSSVPGSMLssgkaistsssSCCQF----------------KGCATW  324
            V +PW G     AG S      SS +     +S+C +                 +G ATW
Sbjct  582  VAIPWPGLDHEHAGLSNKILDASSLQQKILEASTCPRDPDCFSLGTWLFSDGSSRGSATW  641

Query  323  PEEKLPNL-SPSPVLKSDYKFLKSAWQS--ALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
            PEEKL +   PS  ++S +       +   +LAS    W LV+VTA  DG IR+F NYGL
Sbjct  642  PEEKLSSTPKPSLTVESCHLHHCHLHRKYYSLASMAATWSLVIVTASHDGTIRSFHNYGL  701

Query  152  PIRF  141
            P+R 
Sbjct  702  PVRL  705



>emb|CBI37573.3| unnamed protein product [Vitis vinifera]
Length=668

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 86/189 (46%), Gaps = 37/189 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+R S   + A+FTS  +H+VSV EDS V +WNY+       +  K+V+S E F+    S
Sbjct  483  GLRKSGSQMSASFTSTGRHIVSVGEDSRVYVWNYDGFCSQSSKQMKSVQSCEHFFFEGVS  542

Query  440  VVVPWCGAGSSVPG------------------------SMLssgkaistsssSCCQFKGC  333
            V +PW   G+   G                        S   S     +   SC   +G 
Sbjct  543  VAIPWSDTGAEKKGLGSDSLRQSPPTQDHLEATSWIRDSERFSLGNWFSMDGSC---RGG  599

Query  332  ATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNL-----WGLVVVTAGLDGYIRTF  168
            ATWPEEKLP           +   +    + + +  +L     WGLV+ TAG DG IRTF
Sbjct  600  ATWPEEKLPLWGAPEHDHHHHDHQQQQQHNDVQNHNHLALSEAWGLVIATAGWDGTIRTF  659

Query  167  LNYGLPIRF  141
             NYGLP+R 
Sbjct  660  HNYGLPVRL  668



>ref|XP_002275497.1| PREDICTED: WD repeat-containing protein YMR102C [Vitis vinifera]
 ref|XP_010649405.1| PREDICTED: WD repeat-containing protein YMR102C [Vitis vinifera]
 ref|XP_010649406.1| PREDICTED: WD repeat-containing protein YMR102C [Vitis vinifera]
Length=674

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 65/189 (34%), Positives = 88/189 (47%), Gaps = 37/189 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL--QTS---KTVRSYESFYSHNAS  441
            G+R S   + A+FTS  +H+VSV EDS V +WNY+    Q+S   K+V+S E F+    S
Sbjct  489  GLRKSGSQMSASFTSTGRHIVSVGEDSRVYVWNYDGFCSQSSKQMKSVQSCEHFFFEGVS  548

Query  440  VVVPWCGAGSSVPG------------------------SMLssgkaistsssSCCQFKGC  333
            V +PW   G+   G                        S   S     +   SC   +G 
Sbjct  549  VAIPWSDTGAEKKGLGSDSLRQSPPTQDHLEATSWIRDSERFSLGNWFSMDGSC---RGG  605

Query  332  ATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNL-----WGLVVVTAGLDGYIRTF  168
            ATWPEEKLP           +   +    + + +  +L     WGLV+ TAG DG IRTF
Sbjct  606  ATWPEEKLPLWGAPEHDHHHHDHQQQQQHNDVQNHNHLALSEAWGLVIATAGWDGTIRTF  665

Query  167  LNYGLPIRF  141
             NYGLP+R 
Sbjct  666  HNYGLPVRL  674



>ref|XP_004289406.1| PREDICTED: WD repeat-containing protein 44 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466766.1| PREDICTED: WD repeat-containing protein 44 [Fragaria vesca subsp. 
vesca]
Length=688

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 89/189 (47%), Gaps = 38/189 (20%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-----ELQTSKTVRSYESFYSHNAS  441
            G+  S   + A+FTS  K ++SV EDS V +W+Y+       + +K+VRS E FY    S
Sbjct  500  GLPKSGSQMSASFTSSGKRIISVGEDSRVYLWDYDSSCLPSSKQTKSVRSCEHFYCEGVS  559

Query  440  VVVPWCGAG--------------SSVPGSMLssgkaistsssSCCQF-------KGCATW  324
            V +PW G G              S   G + ++  +  +       +       +G ATW
Sbjct  560  VAIPWSGMGTEKMNFEVASPQYCSQTQGRIEATPSSRDSERFLLGNWFFLDGPCRGSATW  619

Query  323  PEEKLPNLSPSPVLKSD----------YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIR  174
            PEE LP    SPV   +          ++   S   + L  S   WGLV+VTAG DG IR
Sbjct  620  PEENLPQWD-SPVAGDEDDHQQHGEHQHRHNHSKAHNHLTKSET-WGLVIVTAGWDGKIR  677

Query  173  TFLNYGLPI  147
            TF NYGLP+
Sbjct  678  TFHNYGLPV  686



>gb|KHN34060.1| WD repeat-containing protein 44 [Glycine soja]
Length=601

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 87/186 (47%), Gaps = 34/186 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   + ++FTS  KH++SV EDS+V IWN++++     + +K+ RS E F+S   +
Sbjct  419  GLPKSGCQMSSSFTSSGKHIISVGEDSHVYIWNFDDMGNASSKQTKSERSCEYFFSKGVT  478

Query  440  VVVPWCGA--------------GSSVPGSMLssgkaistsss----------SCCQFKGC  333
            V +PW G                S +P   L                       C  +G 
Sbjct  479  VAIPWSGMKADKRDSSGNYSHHSSEMPTQQLEVASEARDHKRFSLGNWFAIDGTC--RGS  536

Query  332  ATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASS--PNLWGLVVVTAGLDGYIRTFLNY  159
             TWPEEKLP+    P+ + +Y   +  ++           WGL +V AG DG I+TF N+
Sbjct  537  MTWPEEKLPSWDL-PITEDEYGHQQLCYKDNCHGRNVSETWGLSIVAAGCDGTIKTFHNF  595

Query  158  GLPIRF  141
            GLP+R 
Sbjct  596  GLPVRL  601



>ref|XP_011026823.1| PREDICTED: uncharacterized protein LOC105127281 [Populus euphratica]
Length=140

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 6/71 (8%)
 Frame = -3

Query  341  KGCATWPEEKLPNLSPSPVLKS----DYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIR  174
            +G ATWPEEKLPN SP     S    ++K+LKSA Q+ L+S  ++WGLV+VTAG DG IR
Sbjct  72   RGSATWPEEKLPNSSPKAASPSKSRPEFKYLKSACQNMLSS--HMWGLVIVTAGWDGRIR  129

Query  173  TFLNYGLPIRF  141
            T+LNYGLP+R 
Sbjct  130  TYLNYGLPLRL  140



>ref|XP_008441025.1| PREDICTED: WD repeat-containing protein 44 [Cucumis melo]
 ref|XP_008441026.1| PREDICTED: WD repeat-containing protein 44 [Cucumis melo]
 ref|XP_008441027.1| PREDICTED: WD repeat-containing protein 44 [Cucumis melo]
Length=666

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 90/191 (47%), Gaps = 37/191 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   + A+FT   KH+VSV EDS V +W+Y+ L     + +K+ +S E F+S   S
Sbjct  477  GLPKSGSQMSASFTKSGKHIVSVGEDSRVYMWSYDSLCLPSTKETKSQQSCEHFFSDGVS  536

Query  440  VVVPWCGAGS-------SVPGSMLssgkaistsssSCCQ-------------FKGCATWP  321
            V +PW G G+       + P          + S +                 F+G ATWP
Sbjct  537  VAIPWPGIGTEPKCFSNNQPQFSYRKNYQRAASWTRDTDRFSLSNWFSADGLFRGSATWP  596

Query  320  EEKLPNLSPSPVLKSDYKFLK--SAWQSAL---------ASSPNLWGLVVVTAGLDGYIR  174
            EE+LP L   P+   +   L+     Q  L          S    WGLV+V AGLDG I+
Sbjct  597  EERLP-LWDLPIADDEDGNLQHHDCHQKKLNSHCDAHNDGSQLETWGLVIVVAGLDGTIK  655

Query  173  TFLNYGLPIRF  141
            TF NYGLPI+ 
Sbjct  656  TFHNYGLPIKL  666



>gb|AES72820.2| transducin/WD-like repeat-protein [Medicago truncatula]
Length=628

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 85/186 (46%), Gaps = 22/186 (12%)
 Frame = -3

Query  632  AHLLFPISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSY  468
             H L     G+  S   +  +FTS  KH++SV EDS V IWN+N+ +       KT  S 
Sbjct  443  GHELVQTYKGLSMSGSQMSGSFTSSGKHIISVGEDSRVYIWNFNDSEGHFSKQRKTESSC  502

Query  467  ESFYSHNASVVVPWCGAGSSVPGSMLssgkaistsssSCCQ----------------FKG  336
            E F S   +V +PW G  +    S+       S +   C +                 +G
Sbjct  503  EYFRSKGVTVAIPWSGMTAERSCSLSDFANYSSKTQRQCVRESERFSFGSWFSIDGSCRG  562

Query  335  CATWPEEKLPN-LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNY  159
              TWPEEKLP+  SP   ++S+ + L           P  WGL VV AGLDG I+TF N+
Sbjct  563  SMTWPEEKLPSWDSPLSEVESEDEELCLKNLCHDNCVPETWGLSVVAAGLDGTIKTFHNF  622

Query  158  GLPIRF  141
            G P R 
Sbjct  623  GFPARL  628



>emb|CAH66853.1| OSIGBa0103M18.5 [Oryza sativa Indica Group]
 emb|CAH67028.1| OSIGBa0139P06.1 [Oryza sativa Indica Group]
 gb|EEC77817.1| hypothetical protein OsI_17021 [Oryza sativa Indica Group]
Length=683

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 54/202 (27%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNA  444
            +G+R+ +  + ATFT + +H++S +EDSNV +W++        + +KT ++ E F S+NA
Sbjct  486  SGLRSGSCQLSATFTPEGQHIISASEDSNVYVWSHENQYECACKQAKTTQTSEHFRSNNA  545

Query  443  SVVVPW------------------------------------CGAGSSV------PGSML  390
            ++ +PW                                    CG  SS+      P +  
Sbjct  546  AIAIPWNGTKPRSPVPLSSQILPPQGDTFWSMSKAIKYNSSLCGKDSSIKKIVSTPAAPG  605

Query  389  ssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWG  213
                       S C  K  ATWPEE LP+ + S  L +S +K L++ +Q     + N WG
Sbjct  606  IFNLNQEFFIESSC--KSSATWPEEMLPSTTASVNLDESQFKLLRNCFQG----TSNSWG  659

Query  212  LVVVTAGLDGYIRTFLNYGLPI  147
             V+VTAG DG IR F N+GLP+
Sbjct  660  QVIVTAGWDGRIRYFQNFGLPV  681



>emb|CAE02246.2| OSJNBb0032E06.1 [Oryza sativa Japonica Group]
Length=680

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 54/202 (27%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNA  444
            +G+R+ +  + ATFT + +H++S +EDSNV +W++        + +KT ++ E F S+NA
Sbjct  483  SGLRSGSCQLSATFTPEGQHIISASEDSNVYVWSHENQYECACKQAKTTQTSEHFRSNNA  542

Query  443  SVVVPW------------------------------------CGAGSSV------PGSML  390
            ++ +PW                                    CG  SS+      P +  
Sbjct  543  AIAIPWNGTKPRSPVPLSSQILPPQGDTFWSMSKAIKYNSSLCGKDSSIKKIVSTPAAPG  602

Query  389  ssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWG  213
                       S C  K  ATWPEE LP+ + S  L +S +K L++ +Q     + N WG
Sbjct  603  IFNLNQEFFIESSC--KSSATWPEEMLPSTTASVNLDESQFKLLRNCFQG----TSNSWG  656

Query  212  LVVVTAGLDGYIRTFLNYGLPI  147
             V+VTAG DG IR F N+GLP+
Sbjct  657  QVIVTAGWDGRIRYFQNFGLPV  678



>ref|XP_010680260.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
[Beta vulgaris subsp. vulgaris]
Length=531

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 91/166 (55%), Gaps = 23/166 (14%)
 Frame = -3

Query  593  SAGLVPATFTSDEKHVVSVTE-DSNVCIWNYN---ELQT--SKTVRSYESFYSHNASVVV  432
            S   + A+FT++ +H+VS+ + DS+V IWN+    EL T  +K+ RS E F+S   SV V
Sbjct  372  SGSQMSASFTTNGRHIVSIGQADSHVYIWNHENPIELSTRHTKSTRSCEHFFSEGVSVAV  431

Query  431  PWCG---------AGSSVPGSMLssgkaistsssSCCQFKGCATWPEEKLPNLS-PSPVL  282
            PWCG         +GS+      ++      S ++    K  A WPE+ LP  + P P  
Sbjct  432  PWCGTQTLPKDSDSGSTEYEGACAAQDPYKFSLTNVFSSKSSAIWPEDMLPVFTEPEP--  489

Query  281  KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
              DY    S  ++ +A SP  WGL +VTA  DG IRTF NYGLP++
Sbjct  490  -EDYC---SQARNKVAHSP-AWGLAIVTANWDGIIRTFHNYGLPLK  530



>ref|NP_001053589.1| Os04g0568400 [Oryza sativa Japonica Group]
 dbj|BAF15503.1| Os04g0568400 [Oryza sativa Japonica Group]
 dbj|BAG96138.1| unnamed protein product [Oryza sativa Japonica Group]
Length=698

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 54/202 (27%)
 Frame = -3

Query  608  TGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNA  444
            +G+R+ +  + ATFT + +H++S +EDSNV +W++        + +KT ++ E F S+NA
Sbjct  501  SGLRSGSCQLSATFTPEGQHIISASEDSNVYVWSHENQYECACKQAKTTQTSEHFRSNNA  560

Query  443  SVVVPW------------------------------------CGAGSSV------PGSML  390
            ++ +PW                                    CG  SS+      P +  
Sbjct  561  AIAIPWNGTKPRSPVPLSSQILPPQGDTFWSMSKAIKYNSSLCGKDSSIKKIVSTPAAPG  620

Query  389  ssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWG  213
                       S C  K  ATWPEE LP+ + S  L +S +K L++ +Q     + N WG
Sbjct  621  IFNLNQEFFIESSC--KSSATWPEEMLPSTTASVNLDESQFKLLRNCFQG----TSNSWG  674

Query  212  LVVVTAGLDGYIRTFLNYGLPI  147
             V+VTAG DG IR F N+GLP+
Sbjct  675  QVIVTAGWDGRIRYFQNFGLPV  696



>ref|XP_006350983.1| PREDICTED: nuclear distribution protein PAC1-1-like [Solanum 
tuberosum]
Length=657

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 86/188 (46%), Gaps = 35/188 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIW------NYNELQTSKTVRSYESFYSHNA  444
            G+  S     AT +S  KH+VSV EDS V +W      N    + +K++RS E F S   
Sbjct  470  GLSKSGCHTSATISSTGKHIVSVGEDSRVYLWDNADDINIQASKQTKSIRSCEHFLSEGI  529

Query  443  SVVVPWCGAGSSVP-----GSMLssgkaistsssSC-----------------CQFKGCA  330
            SV +PW G  ++V      GS            +SC                   F+G  
Sbjct  530  SVAIPWSGQATTVVDSENFGSSNFDPLRGEHQKASCKTLDSRRFSVGNWFSMDVSFRGSV  589

Query  329  TWPEEKL-PNLSPSPVLKSDYKFLKSAWQ-----SALASSPNLWGLVVVTAGLDGYIRTF  168
            TWPEE L P+ +   +  S    L    Q     +  A SP  WGLV+VTAG DG IRTF
Sbjct  590  TWPEEMLLPHENDEHLCSSKVDHLHQQHQHNKNLNYRALSP-AWGLVIVTAGWDGKIRTF  648

Query  167  LNYGLPIR  144
             NYGLP+R
Sbjct  649  HNYGLPVR  656



>ref|XP_008361062.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Malus domestica]
 ref|XP_008361069.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Malus domestica]
Length=646

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 89/189 (47%), Gaps = 36/189 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNE------LQTSKTVRSYESFYSHNA  444
            G+  S     A+FTS  KH++SV EDS V +W+Y+E       + +K+V+S E F     
Sbjct  460  GLAKSGSQTSASFTSSGKHIISVGEDSXVYLWDYDEPCVSSSSKQTKSVQSCEHFLCEGV  519

Query  443  SVVVPWCGAGSS-----VPGSMLssgkaistsssSCCQF--------KGCATWPEEKLP-  306
            SV VPW G          PG + ++  +  +   S   +         G ATWPEEKLP 
Sbjct  520  SVAVPWPGMRREQRSLETPGHLEAAPGSRDSECFSLGNWFFLNGPCRGGSATWPEEKLPL  579

Query  305  NLSPSPVLKSD--------------YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTF  168
             L   PV++ +               +    A      S P  WGLV+ TAG DG IRTF
Sbjct  580  PLWDLPVIRDENGQCHXQRQVHHRQQQQHNRALNHTAESEP--WGLVIATAGCDGTIRTF  637

Query  167  LNYGLPIRF  141
             NYGLP+R 
Sbjct  638  HNYGLPVRL  646



>ref|XP_003558975.1| PREDICTED: WD repeat-containing protein 44 [Brachypodium distachyon]
Length=752

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 92/190 (48%), Gaps = 49/190 (26%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNY-NELQ----TSKTVRSYESFYSHNASVVVPWCGAGS  411
            A+FT D  H++S ++DS++ +WNY N++       KTV SYE F+ ++ S+  PW    S
Sbjct  565  ASFTPDGDHIISASDDSSIYMWNYANQINPITNRVKTVWSYERFFCNDVSIATPWNALRS  624

Query  410  --------SVPGSMLssgkaistsssSCCQF-----------------------------  342
                    ++P S             S  ++                             
Sbjct  625  RNSISLACNIPSSRQEVPDDFHNIQDSTSRYPAEDSLDSDNLYHLPSGNFTLSNAFFAES  684

Query  341  --KGCATWPEEKLPNLSP--SPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIR  174
              +G ATWPEE+LP+ S   S + KS YKFLK++ Q+A   + + WG V+VT   DG IR
Sbjct  685  APRGSATWPEEQLPSNSATTSTLRKSQYKFLKASCQNA---ATHAWGQVIVTGSWDGRIR  741

Query  173  TFLNYGLPIR  144
            +F NYGLP++
Sbjct  742  SFQNYGLPVQ  751



>ref|XP_010533561.1| PREDICTED: WD repeat-containing protein 44-like [Tarenaya hassleriana]
 ref|XP_010533562.1| PREDICTED: WD repeat-containing protein 44-like [Tarenaya hassleriana]
 ref|XP_010533563.1| PREDICTED: WD repeat-containing protein 44-like [Tarenaya hassleriana]
Length=702

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 88/166 (53%), Gaps = 29/166 (17%)
 Frame = -3

Query  575  ATFTSDEKHVVSVTEDSNVCIWNYNELQTSK------------TVRSYESFYSHNASVVV  432
            A+FTSD KH+VS TEDS+V +W+Y+  Q ++            ++RS E F S N SV V
Sbjct  543  ASFTSDGKHIVSTTEDSSVNVWSYSSSQPNQKASSSSSSKKPKSIRSCERFVSDNTSVAV  602

Query  431  PW-------CGAGSSVPGSMLssgkaistsssSCCQ---FKGCATWPEEKLPNLSPSPVL  282
            PW        G G    G +L   +  S+SS  C +        TWPEEKLP +  SP +
Sbjct  603  PWGPVDKNRLGLGFISDGLLL--PQCPSSSSLDCLRGSSTTSTTTWPEEKLPRVE-SPNM  659

Query  281  KSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIR  144
            K     L++ W        +LWGLV+V A  DG IR F NYGLP+R
Sbjct  660  K---LLLRNGWPHHHHHH-HLWGLVIVAATWDGKIRAFHNYGLPVR  701



>gb|KJB71300.1| hypothetical protein B456_011G115900 [Gossypium raimondii]
 gb|KJB71301.1| hypothetical protein B456_011G115900 [Gossypium raimondii]
 gb|KJB71302.1| hypothetical protein B456_011G115900 [Gossypium raimondii]
Length=645

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 86/177 (49%), Gaps = 24/177 (14%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   + A+FTS  +H++SV ED  V +WNY+++     + +K+V S E F+  + S
Sbjct  467  GLPKSRSQMSASFTSTGRHIISVGEDCRVYVWNYDDICPRTSKHTKSVSSCEHFFCEDVS  526

Query  440  VVVPWCGAGS-------SVPGSMLssgkaistsssSCC--------QFKGCATWPEEKLP  306
            V +PW G GS       S+ G  +     I  S               K  ATWPEEKL 
Sbjct  527  VAIPWLGQGSDQRHSDRSLRGDQIEGTSWIRDSQRFSLGNWFSIDGSCKSSATWPEEKLM  586

Query  305  ----NLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
                 ++       + + L   +    A+ P  WGLV+V  G +G I+TF NYGLP+
Sbjct  587  LWEITVAEDEYYSYEQQQLCHNYGDYHATLPETWGLVIVAGGRNGRIKTFHNYGLPV  643



>emb|CDP04751.1| unnamed protein product [Coffea canephora]
Length=675

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 92/193 (48%), Gaps = 41/193 (21%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S G   A+FTS  +H+VSV EDS + +WNY+ +     +  K+ RS E F     S
Sbjct  484  GLAKSGGQTSASFTSTGQHIVSVGEDSRIYVWNYDNIMIQLSKAKKSARSCEHFSFEGVS  543

Query  440  VVVPWCGAG---------SSVPGSMLssgkaistsssSCCQF------------KGCATW  324
            + +P+ G G         S+   S   S +++ + +    +F            K  ATW
Sbjct  544  IAIPYSGMGTEKRRAGNDSTSASSQTCSNQSLYSLARDQERFSLASWFSMDVSSKASATW  603

Query  323  PEEKLPNLS-------------PSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDG  183
            PEEKLP                P   L+  ++   ++   +  + P  WGLV VTAG+DG
Sbjct  604  PEEKLPMWEIQYPEHDDQTCDCPDDHLQQLHQHQNNS--QSCGNFPASWGLVFVTAGMDG  661

Query  182  YIRTFLNYGLPIR  144
             IRTF N+GLP++
Sbjct  662  MIRTFHNFGLPMK  674



>emb|CDY43049.1| BnaA03g11960D [Brassica napus]
Length=742

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 88/168 (52%), Gaps = 22/168 (13%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYN-ELQTSKTVR-----SYESFYSHNA  444
            G RN+   + A+ TS+ K +VS +EDSNV +WNY+ E +  ++ R     SYE FY  + 
Sbjct  584  GFRNTNSQISASLTSNGKLLVSASEDSNVYVWNYDSETRAGRSKRVTVTNSYEHFYCRDV  643

Query  443  SVVVPWCGAGSSVPGSMLssgkaistsssSCCQFKGCATWPEEKL-----PNLSPSPVLK  279
            SV  PW   G  +  + +++G   S ++   C  +  ATWP+EKL          SP + 
Sbjct  644  SVAAPW--PGKIINNTAVTNGIISSATNQYFCD-RMSATWPDEKLLLAAKNRARTSPSVS  700

Query  278  SDYKFLKSAWQSALASSPNL--WGLVVVTAGLDGYIRTFLNYGLPIRF  141
             D           + + PN   W +V+VT GL G IRTF N+GLP+R 
Sbjct  701  VDLS------NGPVNAKPNASAWSMVIVTGGLRGEIRTFQNFGLPVRL  742



>ref|XP_004952681.1| PREDICTED: uncharacterized protein LOC101761920 [Setaria italica]
Length=681

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 63/180 (35%), Positives = 80/180 (44%), Gaps = 35/180 (19%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G R S  LVP + TSD +++VS   DSNV IWN+++L     + ++TVRS E F+S   +
Sbjct  512  GRRGSKVLVPPSLTSDGRYLVSAGADSNVYIWNFDKLRGKGTKGARTVRSCEHFFSDGVT  571

Query  440  VVVPW--------CGAGSSVPGSMLssgkaistsssSCCQF----------KGCATWPEE  315
             V  W        C +G        S           CC F             ATWPEE
Sbjct  572  SVATWPGLLHQEICESGGGGGDLQSSDKGPTLCRDRDCCSFGTWFFTDGVGGAAATWPEE  631

Query  314  K-LPNLSPSPVLKSDYKFLK-SAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPIRF  141
            K LP+L          K+L  S         P  W  VVVT   DG IR F NYGLP++ 
Sbjct  632  KLLPSL----------KYLNCSGMDERRPKVPAAWNTVVVTGSRDGVIRCFHNYGLPVKL  681



>ref|XP_008231696.1| PREDICTED: WD repeat-containing protein 44-like [Prunus mume]
Length=661

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 89/189 (47%), Gaps = 49/189 (26%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS-----KTVRSYESFYSHNAS  441
            G+  S   +  +FTS+ KH++SV EDS+V +W+Y+    S     ++V+S E F+    S
Sbjct  488  GLPKSGCQMSTSFTSNGKHIISVGEDSHVYLWDYDGFCVSSSKQIRSVKSCEYFFCEGVS  547

Query  440  VVVPWCGAGSSVPGSMLssgkaistsssSCC-----------------QF----------  342
            V VPW G        M    K++ T+S  CC                 +F          
Sbjct  548  VAVPWSG--------MRPEQKSLETASGRCCSQRQGHLEPAYGSRDAERFSLGSWLFSNG  599

Query  341  --KGCATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTF  168
              +G ATWPEE+LP  +        +     A        P+ WGLV+VTAG DG IRTF
Sbjct  600  PCRGSATWPEEELPPWALQHRDHQQHHHNHLA-------RPDTWGLVIVTAGCDGTIRTF  652

Query  167  LNYGLPIRF  141
             NYGLP+R 
Sbjct  653  HNYGLPVRL  661



>ref|XP_003602569.1| WD repeat-containing protein, putative [Medicago truncatula]
Length=676

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = -3

Query  632  AHLLFPISTGVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQ-----TSKTVRSY  468
             H L     G+  S   +  +FTS  KH++SV EDS V IWN+N+ +       KT  S 
Sbjct  443  GHELVQTYKGLSMSGSQMSGSFTSSGKHIISVGEDSRVYIWNFNDSEGHFSKQRKTESSC  502

Query  467  ESFYSHNASVVVPWCGAGSSVPGSMLssgkaistsssSCCQ----------------FKG  336
            E F S   +V +PW G  +    S+       S +   C +                 +G
Sbjct  503  EYFRSKGVTVAIPWSGMTAERSCSLSDFANYSSKTQRQCVRESERFSFGSWFSIDGSCRG  562

Query  335  CATWPEEKLPN-LSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNY  159
              TWPEEKLP+  SP   ++S+ + L           P  WGL VV AGLDG I+TF N+
Sbjct  563  SMTWPEEKLPSWDSPLSEVESEDEELCLKNLCHDNCVPETWGLSVVAAGLDGTIKTFHNF  622

Query  158  GLP  150
            G P
Sbjct  623  GFP  625



>ref|XP_006585325.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
Length=495

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 87/184 (47%), Gaps = 33/184 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   +  +FTS  K+++SV EDS+V IWN++++     + +K+ RS E F+S   +
Sbjct  316  GLPKSGSQMSGSFTSSGKNIISVGEDSHVYIWNFDDMGNASSKQTKSERSCEYFFSKGVT  375

Query  440  VVVPWCG--------------AGSSVPGSMLssgkaist----------sssSCCQFKGC  333
            V +PW G                S +P   L                  ++   C  +G 
Sbjct  376  VAIPWSGMKADQRDSSGNYSHRSSEMPTQQLEVAPETRDHELFSLGNWFTTDGSC--RGS  433

Query  332  ATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
             TWPEEKLP+    P+ + D + L         S    WGL +V AG DG I+TF N+GL
Sbjct  434  MTWPEEKLPSWDL-PIAEEDQQ-LSHKDNCHDRSVSETWGLSIVAAGCDGTIKTFHNFGL  491

Query  152  PIRF  141
            P+R 
Sbjct  492  PVRL  495



>gb|KHN29160.1| WD repeat-containing protein 44 [Glycine soja]
Length=495

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 87/184 (47%), Gaps = 33/184 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-----QTSKTVRSYESFYSHNAS  441
            G+  S   +  +FTS  K+++SV EDS+V IWN++++     + +K+ RS E F+S   +
Sbjct  316  GLPKSGSQMSGSFTSSGKNIISVGEDSHVYIWNFDDMGNASSKQTKSERSCEYFFSKGVT  375

Query  440  VVVPWCG--------------AGSSVPGSMLssgkaist----------sssSCCQFKGC  333
            V +PW G                S +P   L                  ++   C  +G 
Sbjct  376  VAIPWSGMKADQRDSSGNYSHRSSEMPTQQLEVAPETRDHELFSLGNWFATDGSC--RGS  433

Query  332  ATWPEEKLPNLSPSPVLKSDYKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGL  153
             TWPEEKLP+    P+ + D + L         S    WGL +V AG DG I+TF N+GL
Sbjct  434  MTWPEEKLPSWDL-PIAEEDQQ-LSHKDNCHDRSVSETWGLSIVAAGCDGTIKTFHNFGL  491

Query  152  PIRF  141
            P+R 
Sbjct  492  PVRL  495



>ref|XP_010555742.1| PREDICTED: WD repeat-containing protein 44-like [Tarenaya hassleriana]
 ref|XP_010555743.1| PREDICTED: WD repeat-containing protein 44-like [Tarenaya hassleriana]
Length=655

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 79/162 (49%), Gaps = 29/162 (18%)
 Frame = -3

Query  584  LVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS------KTVRSYESFYSHNASVVVPWC  423
             +  T   +  H+VS  EDSNV IWN ++          K +RS+E F S +ASV   WC
Sbjct  505  FISLTSDGNHNHIVSACEDSNVYIWNRDDAPKESDSCPVKKIRSFERF-STDASVATTWC  563

Query  422  G--AGSSVPGSML--------ssgkaistsssSCCQFKGCATWPEEKLPNLSPSPVLKSD  273
            G  A  +   ++L         S +           FK C TWPEE LP   P     S 
Sbjct  564  GFPAERASRQALLPFPSPPFCLSLEEGFGIGMGPSSFKRCPTWPEENLPAAMPV----SR  619

Query  272  YKFLKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            +KFL +   S+LA     WG V+VT G DG IRTF NYGLP+
Sbjct  620  HKFLST---SSLA-----WGTVIVTGGRDGRIRTFQNYGLPV  653



>ref|XP_004502913.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502914.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Cicer 
arietinum]
Length=622

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 84/182 (46%), Gaps = 33/182 (18%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNEL-QTSKTVRSYES----FYSHNAS  441
            G+  S   +  +FTS  KHV+SV EDS V +WN N+L  TS   R  ES    F S   +
Sbjct  447  GLPMSGSQMSGSFTSSGKHVISVGEDSRVYMWNSNDLGNTSSKQRKSESSCEYFRSKGVT  506

Query  440  VVVPWCG------------AGSS---------VPGSMLssgkaistsssSCCQFKGCATW  324
            V VPW G            A SS          PG   S   +  +  S     +G  TW
Sbjct  507  VAVPWSGMRAERRCSCSNLADSSSLKPHQLAFTPGFRESERFSFGSWFSIDGSCRGSMTW  566

Query  323  PEEKLPNLSPSPVLKSDYKF-LKSAWQSALASSPNLWGLVVVTAGLDGYIRTFLNYGLPI  147
            PEE LP+      L  D K  LK  W       P  WGL VV AGLDG I+TF N+GLP+
Sbjct  567  PEENLPSWD----LPIDGKLCLKDQWYHNCV--PETWGLSVVAAGLDGTIKTFHNFGLPV  620

Query  146  RF  141
            R 
Sbjct  621  RL  622



>ref|XP_009411470.1| PREDICTED: uncharacterized protein LOC103993219 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=734

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 94/196 (48%), Gaps = 45/196 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS---KTVRSYESFYSHNASVV  435
            G  N    + A+FT+D +H++S +EDSNV +W+ ++   S   K+ RS E F+S N S+ 
Sbjct  543  GFHNGRSQISASFTADGQHIISASEDSNVYVWSSHDAPVSNRVKSRRSCEHFFSSNCSIA  602

Query  434  VPWCGAGSSVPGSMLssgkaistsssSCC-----QFKG----------------------  336
            + W G  S    SM S        +S        + KG                      
Sbjct  603  LSWHGFKSGNRISMTSEVFHSQQVNSEQAGGTKDESKGRLEDSNGNDTLFLSPSHGFALG  662

Query  335  ----------CATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
                       ATWPEEKLP  S +P L KS + FLK++ ++    + + WG V++T G 
Sbjct  663  HEFSKFMPKCSATWPEEKLPLNSAAPNLSKSHHNFLKTSCRN----TSHAWGQVILTGGR  718

Query  188  DGYIRTFLNYGLPIRF  141
            DG+IR++ N+GLP+  
Sbjct  719  DGWIRSYQNFGLPVHL  734



>ref|XP_009411471.1| PREDICTED: uncharacterized protein LOC103993219 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 94/196 (48%), Gaps = 45/196 (23%)
 Frame = -3

Query  605  GVRNSAGLVPATFTSDEKHVVSVTEDSNVCIWNYNELQTS---KTVRSYESFYSHNASVV  435
            G  N    + A+FT+D +H++S +EDSNV +W+ ++   S   K+ RS E F+S N S+ 
Sbjct  539  GFHNGRSQISASFTADGQHIISASEDSNVYVWSSHDAPVSNRVKSRRSCEHFFSSNCSIA  598

Query  434  VPWCGAGSSVPGSMLssgkaistsssSCC-----QFKG----------------------  336
            + W G  S    SM S        +S        + KG                      
Sbjct  599  LSWHGFKSGNRISMTSEVFHSQQVNSEQAGGTKDESKGRLEDSNGNDTLFLSPSHGFALG  658

Query  335  ----------CATWPEEKLPNLSPSPVL-KSDYKFLKSAWQSALASSPNLWGLVVVTAGL  189
                       ATWPEEKLP  S +P L KS + FLK++ ++    + + WG V++T G 
Sbjct  659  HEFSKFMPKCSATWPEEKLPLNSAAPNLSKSHHNFLKTSCRN----TSHAWGQVILTGGR  714

Query  188  DGYIRTFLNYGLPIRF  141
            DG+IR++ N+GLP+  
Sbjct  715  DGWIRSYQNFGLPVHL  730



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500